Skip to main content

Absolutely Buckinghamshire July 2026

Page 1


JULY 2026 / £3.95

PLUS

IMANI EVANS

Positive vibes from the Milton Keynes influencer

• VIEW OF THE EARTH

A powerful exhibition opens at Waddesdon

•

THREE OF A KIND

Inside a unique home in Little Chalfont

Buckinghamshire

Festivals, family days out, and top holiday spots, both here and abroad

STATE Sunshine

HANSINE'S TROPICA COLLECTION WILL HAVE YOU LOOKING THE PART, FROM DAWN TO DUSK

Borlase Meadow

Countryside living near Marlow

Nestled within unspoilt countryside, Borlase Meadow is an exclusive collection of just five 5-bedroom family homes by award-winning developer Rectory Homes. Combining timeless architecture with generous gardens and exceptional surroundings, these beautifully crafted homes offer the perfect balance of rural tranquillity and modern convenience. Enjoying a peaceful countryside setting, yet located just a short drive from Marlow and Henley-on-Thames, Borlase Meadow benefits from excellent transport links to London and beyond.

Prices from £2,250,000

WYCLEF

CHRISTINA AGUILERA

CULTURE

18 Agenda Stunning exhibitions and anniversary shows head our way

20 Imani Evans Showing the power of positive thinking

24 Earth Photo An eye-opening look at our world launches at Waddesdon

SUMMER SPECIAL

42 Festivals The best events to enjoy in the sun, starting at Henley

50 Family Top days out perfect for all ages

FOOD & DRINK

68 Food News Tasty bites and new openings across the region

71 Drinks Five superb sips perfect for summer

FASHION & BEAUTY

74 The Shoot Be beach ready with Hansine's Tropica collection

77 Products The best swimwear buys right now

81 Beauty New launches and an en vogue treatment tested

For editorial enquiries please email: mark@zest-media.com

For advertising enquiries please call 07977 195732 or email: abi@zest-media.com

INTERIORS

90 Real Home A three in one of a kind Buckinghamshire home

96 Jensen Beds How to sleep soundly this summer

101 Buys Plenty of ideas to bring summer colours into the home

ON THE COVER

Hansine's Tropica collection (hansineshop.co)

LETTER Editor’s

ABSOLUTELY’S July issue highlights

2 1

Iwas in a meeting recently in London when something caught my eye. It was a moth, which had somehow squeezed into a small gap between a window and the plexi-glass that was shut in the office we were in. I couldn’t concentrate for the next 10 minutes, seeing the moth fluttering manically to find an exit, when I had to put my hand up and apologise, and said I had to sort something. I think everyone in the room thought I was a little bonkers, but I couldn’t rest easy until I knew that moth was out.

I have always had empathy for nature and wildlife. I can’t, for example, walk past a snail that is merrily shifting its way across a pavement after a burst of rain, blissfully unaware it is a busy road and someone – intentionally or not –will soon crush it. I tap it on its shell a couple of times and then slowly move it out of harm’s way.

5

It’s why when an exhibition like Earth Photo comes to town it’s something I am really keen on promoting. It’s being staged at Waddesdon Manor and some of the photos on show are, at first glance, stunning, but most have a really important message about how elements of our wonderful world are being destroyed.

It’s sobering stuff and perfect timing as, this month, we produce a summer special which may take you to places previously unexplored. Just be aware of what is around you.

4

Products Our top picks of the latest swimwear (p77)

3

Wishlist Why it's a colourful month at Absolutely (p14)

Real Home
Three homes in one: exploring a stunning transformation (p90)
MARK KEBBLE EDITOR
Summer Special Festivals, family days out and more (p41)
Earth Photo An exhibition reminding us about the beauty and fragilty of our world (p24)

Wish LIST

TOP SET

Summer pyjamas don't get better than this: Eberjey's so sets are comfortable and stylish for lounging and sleeping. eberjey.com

CANDY CRUSH

Iconic Parisian pâtisserie Maison Ladurée and Casablanca's Charaf Tajer have joined forces on an exclusive capsule collection spanning ready-to-wear, accessories and limited-edition pastry creations. Uniting it all is a signature dreamlike artwork and a bespoke pomelo and mint fl avour, which acts as a nod to the brands' shared love of colour, detail and elegance. laduree.com

BELGIAN STYLE

Essentiel Antwerp have long been popular with lovers of their Belgian twist on design. Visit their site for the 1970s-inspired space age interior as well as the chic, colourful clothes – and don't miss the fabulous Peanuts collab. essentiel-antwerp.com

STAR QUALITY

Everyone's wild for NPG's new Marilyn merch, which includes these Cecil Beaton totes and pouches as well as lots of jewellery and accessories. npgshop.org.uk

FLOWER POWER

Jonathan Anderson breathes new life into the Dioriviera world with playful, colourful designs imbued with a fresh, joyful energy inspired by the beauty of the plant world. dior.com

90S CHIC

Robinson Pelham is celebrating 30 years in the jewellery business by channeling the summer of 1996 with a collection featuring lots of bold colour and sculptural gold. robinsonpelham.com

EDITOR’S PICK

IN THE MIST

Valentino Beauty has launched a playful collection of Born in Roma Hair & Body Mists, which create a so , airy veil of scent for hair and skin. valentino-beauty.co.uk

PERFECT PAIR

This exquisite and unique "Toi et Moi" dress ring showcases a pairing of two captivating gemstones, perfect for any special occasion. berrysjewellers.co.uk

COLOUR WAY

Effortless silhouettes, bold prints and breathable fabrics characterise Albaray's summer collections. The brand has an ongoing commitment to thoughtful, sustainable design. Creating versatile wardrobe staples designed to be worn on repeat. albaray.co.uk

REAL STAR

This OPEIA pendant belongs to a celebratory fi ne jewellery collection by Berry's Jewellers that focuses strongly on celestial-inspired shapes and elements. berrysjewellers.co.uk

READING REP

Following a standout season that earned multiple five-star reviews from critics and audiences, Reading Rep continues to establish itself as one of the UK's most exciting producing theatres. Described by Broadway World as a company that "punches well above what you might expect from a regional theatre" and by British Theatre Guide as "a huge asset to the town", we can't wait to see what the next season brings – which is now on sale. readingrep.com @readingreptheatre

CULTURE FIVE-STAR APPEAL

The Agenda

JULY'S HOTTEST HAPPENINGS

MUSIC

Jools Holland

10 July

WYCOMBE SWAN

As the UK's most popular pianist and bandleader, Jools Holland OBE has performed and recorded with some of the most talented musicians and songwriters in the world. Jools is respected not only as a performer, but also an authority on all music. The 20-piece Rhythm & Blues Orchestra features special guest Andrew Roachford. trafalgartickets.com

EVENT

Craft In Focus

10-12 July

WATERPERRY GARDENS

7 JULY, THE HEXAGON

With their signature irreverence and discerning eye for beautiful dance, BalletBoyz return in 2026 with their brand-new production Still Pointless, marking the 25th anniversary of the company’s critically acclaimed debut, Pointless. The show will also showcase the world-premiere of a brand-new commission by Seirian Gri ths.

whatsonreading.com

Craft In Focus returns to Waterperry Gardens, with the Celebrating Ceramics Festival and the Desire Jewellery & Silversmithing Fair. One ticket gives access to both events and 200 carefully selected exhibitors. Meet makers, commission bespoke pieces, enjoy demonstrations, live music, food and drink, and explore outstanding contemporary ceramics, jewellery and silversmithing. craftinfocus.com

PHOTO: BBC PHOTO ARCHIVE

ART

Simplicity and Complexity

Until 30 August THE BASE, GREENHAM Simplicity and Complexity is a compelling new exhibition by internationally renowned ceramic artist Jin Eui Kim. The exhibition brings together a striking series of sculptural works that explore the intriguing themes of illusion and reality. Working with carefully shaped clay, Jin Eui creates pieces using tonal gradients, precise lines, and patterns, giving his sculptures the appearance that they transform. thebasegreenham.co.uk

White Cube and the Claydon Estate combine to present a breathtaking collection of art GROUNDS FOR discussion

THEATRE

THE CAR MAN

7-11 JULY, MK THEATRE

Loosely based on Bizet’s everpopular opera, Matthew Bourne’s The Car Man has one of the most thrilling and instantly recognisable scores in New Adventures’ repertoire. The familiar 19th-century Spanish cigarette factory becomes a greasy 1950s garage-diner in the American Midwest, where the dreams and passions of a small town are shattered by the arrival of a handsome and enigmatic stranger. miltonkeynes-theatre.co.uk

The

lot has happened to Neil Hannon since the last The Divine Comedy studio album, O ce Politics, in 2019. Their entire back catalogue was lovingly remastered and re-released in 2020, while a sensational best of, Charmed Life, went top 5 when it came out in 2022 accompanied by a nationwide tour. The Divine Comedy's hits include National Express, Something for the Weekend, A Lady of a Certain Age and Our Mutual Friend. atgtickets.com

White Cube at Claydon is a landmark exhibition that brings some of the most influential contemporary artists into dialogue with the historic interiors and gardens of Claydon House in Buckinghamshire. Running until 14th September, this ambitious collaboration between White Cube, the National Trust and the Verney family marks the first time an international contemporary art exhibition of this scale has been presented at the 18th-century mansion. Inside the mansion, Claydon’s extraordinary rococo interiors will transform into atmospheric gallery spaces. Visitors will move through a sequence of rooms where contemporary artworks respond to, contrast with or amplify the house’s historic character.

Beyond the house, the exhibition extends into Claydon’s intimate south-facing gardens. Here, a series of outdoor spaces provide a natural stage for sculpture, encouraging visitors to explore the landscape and encounter artworks in unexpected settings.

A highlight of the exhibition is the opening of two cherished private gardens: the walled Pool Garden and the Florence Nightingale Garden, both made accessible to exhibition visitors through the generous support of the Verney family. These secluded spaces, rarely seen by the public, will host sculptures by Marguerite Humeau and Virginia Overton, whose practices engage with themes of nature, form and transformation.

nationaltrust.org.uk/claydon

PHOTO: JOHAN PERSSON

Feeling confident

Milton Keynes star Imani Evans on self-love, television success and staying authentic

There is something refreshingly unapologetic about Imani Evans. Whether she is lighting up television screens, inspiring thousands online with messages of confidence and self-love, or championing greater representation in fashion, the Milton Keynes-born creator has built a career by embracing exactly who she is. With a growing audience across Instagram and TikTok, appearances on national television and a reputation for promoting positivity, Imani has become one of Buckinghamshire’s most recognisable digital personalities.

Yet behind the glamour, viral moments and television success lies a story rooted in family, creativity and a deep belief in self-worth. For Imani, confidence was never something that appeared overnight. It was nurtured from childhood by a mother determined to ensure her daughter knew the value of her own voice. Looking back, she recalls small but powerful lessons that would ultimately shape the woman she would become. “If I’d mumble under my breath, my mum would ask me to repeat myself properly,” she explains. “She taught me to project my voice and speak with confidence.”

Those early lessons created strong foundations, but like many young women, her journey towards complete self-acceptance was not always straightforward. Fashion became an important outlet during her teenage years, helping her navigate changing

body image and growing self-awareness. “My mum always encouraged me to express myself through fashion,” she says. “That definitely helped with body positivity.”

While confidence occasionally wavered throughout adolescence, Imani believes she truly came into her own in her mid20s. Since then, embracing herself fully has brought a freedom she describes as both empowering and joyful. That sense of certainty seems fitting for someone whose career path was established remarkably early. Long before social media influencing became a recognised profession, Imani already knew exactly where her passions lay.

Fashion was a constant presence throughout her childhood. She spent countless hours exploring her mother’s wardrobe, creating outfits and styling looks for family occasions. What began as a hobby soon became something much more serious. “My mum would actually listen to my fashion advice because I was passionate about it and good at it,” she laughs. Eventually, her mother entrusted her with a budget to shop independently, giving Imani an opportunity to develop her eye for styling and personal expression. Alongside fashion, she immersed herself in performing arts, later studying the subject at college. “Being creative is where I feel happiest,” she says. “I knew it was what I needed to lean into.”

That creative instinct has led to a career filled with significant milestones. Among the most meaningful was becoming the first Afro model to work

with major retailers including Ann Summers and Dorothy Perkins.

For Imani, however, the achievement represented far more than simply appearing in campaigns. “It means so much more than photos on a website or on a shop wall,” she explains. “It’s about representation and influence.”

She understands the impact visibility can have on women who may not have previously seen themselves reflected in mainstream fashion. Seeing diverse body types, skin tones and hair textures celebrated remains something she is deeply passionate about. “When women see someone confidently going after their dreams, it reminds them they can do it too.”

That commitment to authenticity has resonated strongly with her audience. Today, Imani has amassed a substantial following through content centred on fashion, beauty, lifestyle and personal growth. Yet despite the scale of her reach, she remains most a ected by the messages she receives from women who have found confidence through her content.

“When people tell me my videos have helped them feel uplifted or more confident, that’s what stays with me,” she says. In a world often dominated by negativity, Imani believes creating moments of joy carries real value. “If I can make someone smile or laugh for a moment, that’s a beautiful thing.”

Her growing profile reached new heights through Channel 4’s Tempting Fortune, the challenging reality series that sees contestants endure gruelling conditions while resisting luxury temptations that

could reduce a shared prize fund. Simply reaching the end of the competition remains one of the most surreal experiences of her life. “Every day was physically and mentally the hardest thing I’ve ever done,” she says. “It felt incredible to complete something so many people thought I couldn’t."

The impact of the programme became particularly evident once filming ended. Being recognised by viewers during everyday moments continues to surprise her. “Someone stopped me in Tesco recently to tell me how much they loved the show and all the mischief I got up to,” she laughs. “Sometimes you forget how many people actually watched.”

The success of the series was later cemented when season two won Best International Reality Show at the National Reality TV Awards 2025. For Imani, the recognition was both unexpected and deeply rewarding. “I knew people were talking about the show from the very first episode, but I still couldn’t believe it when we won. I ran all the way to the stage in five-inch heels. I didn’t even know my legs could move that fast,” she laughs.

Away from television, one of Imani’s biggest viral moments arrived through her nowfamous “serenading” video, which attracted

“You have to remember to live life outside of social media”

international attention and coverage from major media platforms. While she suspected audiences would enjoy the content, the scale of its success took her completely by surprise.

Looking back, she believes its popularity reflected a broader cultural moment.

“There is so much negative content about relationships online,” she says. “The video was the complete opposite.” Rather than conflict, the clip showcased warmth, humour and genuine connection between strangers. “It reminded people what healthy interactions can actually look like.”

The result was a feel-good moment that resonated far beyond her existing audience and reinforced her belief in the power of positivity. Despite building a career online, Imani is equally aware of social media’s pitfalls. In an era where every moment can potentially become content, she is careful to maintain boundaries between her public and private life. “You have to remember to live life outside social media,” she says firmly. While many creators subscribe to the idea that everything should be documented, Imani disagrees. “I think that’s toxic.” Instead, she advocates for protecting real-world experiences from the constant demands of algorithms and engagement metrics. “You should

be able to spend time with friends, date, travel and enjoy life without feeling the need to film every second.”

Fortunately, Buckinghamshire o ers the perfect antidote to the pressures of online life. Although London remains central to her professional world, Milton Keynes continues to provide the balance she values. “I love the community feel,” she says. “Life feels slower and less pressured.”

A perfect day close to home begins with a co ee and pain au chocolat before browsing the shops at centre:mk. When the weather allows, she heads to Campbell Park with snacks and a good book. “It really is the small things in life,” she smiles.

As for the future, Imani remains characteristically optimistic. There are ambitions still to fulfil, including a dream footwear collection and a return to television, but she is equally open to wherever life may take her next. “I always have something exciting in mind because it keeps life interesting,” she says.

For someone who has built a career by embracing opportunity, creativity and confidence, the next chapter promises to be every bit as compelling as the last.

Follow Imani’s journey online @imanievans_

VIEW OF THE EARTH

A truly stunning – and at times sobering – exhibition is set to open at Waddesdon Manor that will make you look at our planet in a di erent light

This summer, one of the world’s most compelling photography exhibitions arrives in Buckinghamshire as Earth Photo 2026 comes to Waddesdon Manor, bringing together extraordinary images and films that explore our changing planet through the eyes of leading international artists.

Presented in partnership with the Royal Geographical Society, Photoworks and Parker Harris, Earth Photo has become one of the most respected platforms for environmental photography and filmmaking. Now in its eighth year, the exhibition showcases powerful visual storytelling that captures the beauty, fragility and complexity of the world around us. This year’s shortlist features 160 photographs and films by 33 artists from 18 countries, selected from more than 1,400 submissions. Visitors to Waddesdon will encounter striking works that reveal some of the defining environmental stories of our time. From rapidly eroding Arctic coastlines

and Icelandic volcanic eruptions to the hidden realities of industrial food production and the impact of human activity on landscapes and communities, the exhibition o ers a thought-provoking journey across continents and cultures.

The shortlisted works combine documentary photography, fine art, drone imagery, film and experimental techniques, demonstrating the many ways artists are engaging with urgent global issues. Yet alongside these challenges, Earth Photo also celebrates resilience, wonder and our enduring relationship with the natural world.

Set against the magnificent backdrop of Waddesdon Manor’s grounds, the exhibition promises a memorable cultural experience for visitors of all ages. Whether you are passionate about photography, fascinated by the environment or simply looking for inspiration during a summer day out, Earth Photo 2026 o ers a unique opportunity to see the world from new perspectives.

Earth Photo 2026 will be on display at Waddesdon Manor until 31 July. Find out more at waddesdon.org.uk

LEFT: BY ANTONIO AVELAR

VOLCANIC GAZE, 2025, VANUATU

The Kastom of the Imaio people carry their identity into the future.

Practising it is the only way to ensure self-determination, ancestral law, land ownership, knowledge propagation, and the very understanding of one's place in the world. The Mount Yasur volcano is their home. One of the most active in the world, it took the role of their great ancestor, being since referred to in the local dialect as their grandfather.

RIGHT: BY LISEOK

SEOK LEE, FRAME CHUAM ROCK, 2021, GANGWON-DO, EAST SEA, SOUTH KOREA

Photographed at ChuAm Chotdaebawi (Chotdae Rock), on the east coast of Gangwon-do, South Korea, a place known for witnessing the first sunrise in the country. Captured just before dawn, this image records a moment suspended between darkness and light. A rectangular beam of light is physically projected onto the rock formation on site, responding to its surface and scale.

The cool tone of the light echoes the pre-dawn atmosphere, aligning artificial colour with the natural transition of the sky. Rather than illuminating the landscape, the light marks a temporary human presence within a larger natural cycle, reflecting on time, anticipation, and coexistence.

DEVMATI SINGH KHAIRWAR AND MEMORY OF A HOME, 2023, PRINTMAKING 2025, MAJHAULI PAATH, SINGRAULI, INDIA

This gum oil print cra ed in August 2025 from a photograph taken in October 27, 2023, shows the indigenous person, Devmati Singh Khairwar, standing by the crumbling home in Majhauli Paath, just 20 metres from the encroaching Suliyari mining waste dump. She had protested for three years, demanding fair compensation and settlement plan for indigenous lands before being forcibly extracted in December 2025.

An embroidered lush green tree atop a printed dry Sal tree evokes memories of a lost forest, symbolizing her resilience and the environmental destruction threatening her village.

Tracking the Invisible: the new frontier in wildlife forensics. Using a newly developed magnetic powder, Mark Moseley, a forensic investigator at London’s Metropolitan Police, dusts for and detects human fingerprints on an elephant tusk confiscated at Heathrow Airport. Over 200 fingerprinting kits based on this technology were distributed to border forces across 40 countries in Africa and Asia. The results were immediate. In Kenya, evidence recovered using one kit led to 15 arrests, including five police officers, and the seizure of 11 elephant tusks. For the first time, ivory was not just proof of a crime; it was evidence of who committed it. A white variant of the powder is now being used to recover prints from rhino horn and pangolin scales. The powders are low-cost, field-deployable, and can be used in locations where DNA testing isn’t feasible.

There were only a few days le before the rice harvest, the livelihood of most villagers in the area. But the night before, wild elephants had largely destroyed the local farmer's rice field in Sherpur, Bangladesh on 8 April, 2022.

BY MATTEO

JIN, JIYAN, AZADÎ - WOMAN, LIFE, FREEDOM, 2025,

"I arrived here a year ago. I had many problems in my life. I lived with my husband in Heseke. The comrades suggested I come here, and I decided to. The relationships among women are beautiful; I love everything here. I hope to be reborn here, with a clear mind, and to live in peace – here it is possible." Amal in Jinwar is an eco-feminist village founded during the Syrian war as a refuge for women. The village, powered in part by solar energy, was built collectively and inaugurated in 2018.

EVERY CRIME LEAVES A TRACE, 2025, WILDLIFE CRIME LAB, INSTITUTE OF ZOOLOGY (IOZ), LONDON, UK

On the first glance this may appear to be a underwater photograph of a floating green sea turtle (Chelonia mydas). But can you spot the human hand print? The image demonstrates a method for securing forensic evidence that can help to catch poachers and animal traffickers. Special fluorescent powder dyes, photographed under ultraviolet light, reveal hand and fingerprints, blood and other bodily fluids, gunpowder residue, and more. Wildlife forensic expert Dr. Alexandra Thomas and Louise Gibson from the Wildlife Crime and Forensics Unit are developing such methods to assist law enforcement. Six of the world's seven sea turtle species are classified as threatened, endangered, or critically endangered due to human persecution, habitat destruction, or marine pollution.

Local divers are preparing to install artificial reef structures at a coral restoration site in Jemeluk, Bali. The initiative, led by the NGO Perkumpulan Pemandu Penyelam Amed (P3A), aims to support reef recovery in areas affected by unsustainable fishing practices and coral loss.

the Derbyshire Peak District

w Lodges sleep 2 - 8 people

w Perfect for couples, families & celebrations

w Hot tubs available

w Pet friendly

w Health & fitness centre

w Restaurant & bar

w Woodland location

w Visit the Peak District

w Activities for all ages

w Soft play centre

w Mini golf, tennis & games room

w Cycle hire & nature trails

GO WITH the flow

As the Henley Festival returns this month, Absolutely takes a deeper dive into the many attractions found in the beautiful town

The return of the Henley Festival this month once again puts Henley-onThames in the spotlight. From 8th–12th July, the black-tie riverside event transforms the Thames into one of Britain’s most glamorous outdoor venues, with floating stages, fireworks, jazz, comedy and headline music performances drawing visitors from across the country. Yet while the festival o ers a dazzling introduction to the town – and later in this issue you can read more as Absolutely goes behind the scenes – Henley’s appeal runs far deeper than five nights of summer celebration.

Set on one of the prettiest stretches of the River Thames, Henley-on-Thames blends English market-town charm with

an unexpectedly cosmopolitan energy. It is a place where rowing traditions meet boutique shopping, where historic coaching inns sit beside wine bars and contemporary galleries, and where a riverside stroll can quickly become an entire afternoon. Best known internationally for the Henley Royal Regatta, the town has quietly evolved into one of the south-east’s most stylish weekend destinations.

A BRIEF HISTORY

Henley’s story is inseparable from the river. The town developed as a crossing point on the Thames during the Middle Ages and was formally established in the 12th-century. By the 13th-century it had become an important market town, benefitting from trade routes between London and the west country.

Its fortunes accelerated when the original bridge across the Thames was constructed, turning Henley into a key stop for travellers and merchants. During the coaching era of the 18th-century, the town flourished with inns, taverns and riverside businesses catering to people journeying between London and Oxford. Many of the elegant Georgian facades visible today date from this prosperous period.

The river itself ultimately shaped Henley’s modern identity. Rowing became firmly associated with the town in the 19thcentury, culminating in the creation of the Henley Royal Regatta in 1839. Today the regatta remains one of the world’s most prestigious rowing events and has helped cement Henley’s reputation internationally.

But Henley is not trapped in nostalgia. In recent decades it has become known for festivals, food, culture and the arts. Alongside the regatta and the summer festival, the town hosts the Henley Literary Festival every autumn, attracting leading authors, broadcasters and cultural figures.

WHAT TO SEE AND DO

Any visit to Henley should begin with the river. The Thames Path through the

town is one of the most scenic sections of the national trail, lined with willow trees, rowing clubs and elegant boats drifting past. The stretch around Mill Meadows is especially beautiful in summer, when picnics spill onto the grass and rowing crews practise on the water. The bridge itself is one of Henley’s defining landmarks. Built in the 18th-century from warm stone, it connects Oxfordshire and Berkshire while o ering classic views along the river.

Henley’s rowing heritage is explored brilliantly at the River & Rowing Museum. Modern and interactive rather than dusty and traditional, the museum covers everything from Olympic rowing to the ecology of the Thames. There is also a permanent exhibition dedicated to author Kenneth Grahame, creator of The Wind in the Willows

Henley’s compact centre is ideal for wandering. Hart Street and Bell Street are filled with independent boutiques, interiors stores, delis and galleries. Unlike many market towns, Henley has retained a

distinctly local feel, balancing recognisable brands with family-run businesses and specialist retailers. The monthly farmers’ market is particularly good for regional produce, artisan cheeses and baked goods.

Boat trips remain one of the best ways to experience Henley. Traditional launches drift slowly along the Thames past grand riverside homes and rowing landmarks. Visitors can also hire self-drive boats, paddleboards or kayaks during the warmer months.

For something more leisurely, riverside picnics are practically a local pastime. On sunny weekends the atmosphere can feel more Riviera than rural Oxfordshire.

Henley sits at the edge of the Chiltern Hills, giving visitors easy access to walking trails, woodlands and rolling countryside. Nearby villages such as Hambleden and Turville o er postcard-perfect scenes of brick cottages, village greens and traditional pubs. A short drive away, Stonor Park combines a historic house, deer park and sweeping grounds.

GEORGE HARRISON OF THE BEATLES HAD LINKS TO HENLEY
In Henley you can enjoy everything from elevated British cooking to riverside cocktails

WHERE TO EAT AND DRINK

Henley’s dining scene has become one of its strongest attractions, with everything from elevated British cooking to riverside cocktails.

For a refined dinner, Luscombes Restaurant is one of the town’s standout

choices. Tucked away on Bell Street, it delivers polished modern European cooking in an intimate setting that feels quietly sophisticated rather than showy.

Those seeking something more ambitious should book Orwells Restaurant just outside town in Shiplake. Widely regarded as one of Oxfordshire’s best restaurants, it has built a reputation for inventive British tasting menus and exceptional service.

For relaxed riverside dining, Coppa Club Henley remains consistently popular. Its bright interiors and terrace make it ideal for brunch, cocktails or long lunches after a walk by the Thames.

Henley also punches above its weight for international cuisine. Bijan’s Restaurant serves excellent Persian food in the heart of town, while Banana Tree Henley o ers vibrant pan-Asian dishes that have become a local favourite.

Pub culture remains central to Henley life and there are several excellent options. Bird in Hand is a classic British pub with a loyal following and strong food o ering, while Row Barge has one of the prettiest locations near the river. For drinks later in the evening, Magoos delivers lively cocktail-bar energy, while Jacobini o ers a more relaxed wine-bar atmosphere.

Outside town, gin lovers should make time for The Henley Distillery, where tastings and tours showcase locally produced spirits in a beautiful countryside setting.

Five things you may not know about

Henley

1. Henley once had an important silk industry Before rowing became its defining identity, Henley had a thriving silk and lace trade. In the 18th and 19th centuries the town supported workshops and small factories producing textiles that were sold across southern England. The industry eventually declined but helped shape Henley’s commercial prosperity long before tourism arrived.

2. George Harrison had strong local ties Beatle George Harrison spent significant time in the Henley area and became part of the wider local social scene around Friar Park, his extraordinary Victorian Gothic estate nearby. The property remains one of the region’s most famous private homes.

3. There is a hidden network of rowing tunnels beneath the regatta enclosure Long-time regatta insiders know about a series of service tunnels and access routes beneath parts of the riverside enclosure infrastructure. They are rarely seen by ordinary visitors, but help manage logistics during the world-famous event each summer.

4. Henley inspired literary worlds beyond The Wind in the Willows While Kenneth Grahame’s association with the Thames is well known, the landscapes around Henley have also inspired detective dramas, period films and television adaptations for decades. Nearby villages regularly appear on screen because they remain remarkably unchanged.

5. The town has a surprisingly strong music legacy Henley’s festival reputation extends beyond its famous July event. Over the years the town has quietly attracted major musicians, producers and industry figures who prefer its combination of countryside privacy and London accessibility. The nearby Rewind Festival South has further strengthened Henley’s reputation as an unlikely music hub.

ORWELLS
BANANA TREE

WANTED

Do

GLOBAL perspective

How Tom Butler captures the soul of the world’s great cities

From the bustling streets of London and New York to the colourful coastlines of Cornwall and beyond, Tom Butler has established himself as one of Britain’s leading contemporary artists. Exhibiting through DeMontfort Fine Art galleries across the UK, his work has earned a devoted following among collectors who are drawn to his ability to capture the spirit and individuality of the world’s most iconic places. Here, Tom shares the inspiration behind his work, his creative process, and the enduring fascination with the places that continue to shape his artistic journey.

A WORLD BUILT FROM PAPER, TEXT AND MEMORY

Fieldwork remains integral to Tom’s practice. By photographing, sketching, and collecting local collage paraphernalia in the places travelled to, he absorbs the atmosphere and characteristics; subconscious details that re-emerge in the finished work. Incorporating text and a typographic aesthetic into his mixed media pieces could be traced back to studying the likes of A.M Cassandre the 1930s French poster artist at college. Later, he was also inspired whilst on several French holidays by seeing faded text from old hand painted adverts on the sides of buildings, sparking a creative direction.

TOM WITH DAME KELLY HOLMES

What makes Tom’s cityscapes particularly engaging is the way they invite viewers to explore. A crossword puzzle may become a building façade, fragments of vintage typography become the DNA of streets and rooftops; layers of collage creating unexpected visual connections. The result is artwork that rewards repeated viewing, revealing quirky, often humorous details over time.

THE CITYSCAPE SPECIALIST

While many artists paint cities, Tom interprets them. His celebrated collections focus on some of the world’s most loved urban destinations, including London, New York, Paris and Venice. Rather than producing straightforward representations, he captures the feeling of a city; the movement of tra c, the glow of evening lights, the bustle of busy streets and the memories attached to familiar landmarks.

London remains one of his most enduring subjects. Drawn to the capital’s unique blend of historic architecture and modern development, Tom continually finds new perspectives within the city. His New York pieces pulse with energy and ambition, while Paris-inspired works celebrate elegance and artistic heritage. Venice, another recurring source of inspiration, allows Tom to explore atmosphere,

reflection and architectural beauty through his signature mixed-media technique.

THE ARTIST BEHIND THE CITYSCAPES

Behind every Tom Butler artwork is an artist driven by craftsmanship and a desire to continually push creative boundaries. A first-class honours graduate in Illustration, Tom has spent years refining a distinctive artistic process that combines drawing, painting, collage and found materials. Working intuitively, he builds each composition layer by layer, allowing colours, textures and unexpected details to emerge naturally throughout the creative journey. For Tom, experimentation remains at the heart of his practice. “Being challenged daily and discovering new and exciting ways of pushing boundaries keeps me motivated,” he says.

MIDNIGHT TOWER: A NEW ICON FOR LONDON

One of Tom’s most ambitious recent originals is Midnight Tower, a striking celebration of London’s ever-evolving skyline. Inspired by an evening spent overlooking the capital from Principal Tower, the work captures the moment the city transitions from day to night, as thousands of lights begin to illuminate the streets below.

Layered with Tom’s trademark collage elements, typography and intricate detail, the piece reflects both the energy and elegance of modern London. Rich textures and carefully constructed visual layers draw the viewer across the composition, creating a dynamic portrait of the city after dark.

TOM BUTLER X: TURNING PERSONAL STORIES INTO ART

Beyond his celebrated city and sea-scapes, Tom has developed a new and very unique type of commission: Tom Butler X, the ultimate gift for loved ones. Drawing on the places, memories and milestones that have shaped a person’s life, Tom creates bespoke works that embed personal narratives within intricate compositions. He says: “At the heart of the concept is a simple idea – to o er a new form

of 'portraiture' that transcends the parameters of traditional homage. Imagine being presented with a surprise painting of the place you love most in the world – then as you move in for a closer look, you start to realise that all the details hidden within are all about you or your life. Milestone moments, special dates, nicknames, maybe a cherished pet in a car window – or even a miniature you woven in somewhere. The possibilities are endless!”

One recent Tom Butler X commission was created as a complete surprise for Dame Kelly Holmes. Working closely with those who know her best, Tom meticulously collated collage inclusions to use in the finished piece – fragments that have defined Dame Kelly and her remarkable journey. Included were references to her Olympic triumphs, military career, charitable work and personal milestones, woven seamlessly into a London landmark setting.

“When the artwork was unexpectedly presented to Dame Kelly, the reward for countless weeks of hard work was memorable – we both felt emotional,” Tom recalls. "It was almost a visual This Is Your Life moment. She couldn't thank me enough.”

For Tom, few things compare to seeing someone connect with his work. Tom Butler X elevates that experience, transforming art into something deeply personal.

DISCOVER MORE

For those wishing to explore the world of Tom Butler in greater depth, his o cial website o ers a comprehensive insight into both his artistic journey and his latest collections. Visitors can browse a selection of original artworks, hand-embellished limited editions and new releases, while gaining a greater understanding of the inspiration, techniques and creative processes.

tombutlerartist.com

TOM WITH MIDNIGHT TOWER

BOLD STOIRES BEAUTIFULLY MADE...

That’s

entertainment

The Founding Artistic Director and CEO of Reading Rep Theatre writes about why they are ready to welcome and entertain all

A“Challenging barriers is the foundation of our work”

new season at Reading Rep is an invitation to experience theatre that feels bold, unexpected and alive. This year’s programme brings together reimagined classics, striking new perspectives and stories that speak powerfully to contemporary audiences –work designed to provoke conversation, spark curiosity and stay with audiences long after they leave the theatre.

At Reading Rep, we believe theatre should belong to everyone. But for too long, access to the arts hasn’t been equal, in who feels welcome, whose stories are centred, and which artists are given the space to lead. Challenging those barriers is not an add-on to our work; it is the foundation of it. And it is the thread running through this season.

This year’s programme is rooted in reinvention. We are drawn to stories that feel familiar, then asking what happens when they are seen from a new angle. Dracula continues our passion for

transforming literary classics into bold contemporary theatre. A dark and seductive retelling created in collaboration with local Bracknell company Blackeyed Theatre that promises both spectacle and unease. Opening doors also means creating pathways for audiences. We want more people across Reading to experience theatre for the first time and to feel that Reading Rep belongs to them. Our revival of A Christmas Carol plays a special role in that mission. It has become a festive tradition for the town: a warm, welcoming production that invites audiences of all ages into the magic of live theatre through a story they already know and love.

That spirit of rediscovery continues with The Importance of Being Oscar. Following sell-out performances and widespread acclaim, this dazzling production returns with wit, glamour and a fresh perspective on Oscar Wilde’s life and legacy – a reminder that even the most celebrated voices can still surprise us.

Championing artists is equally important to us. The Turn of the Screw brings together a haunting new adaptation by acclaimed playwright Morgan Lloyd Malcolm with direction from Reading-based artist Nicky Allpress, creating space for new creative partnerships and distinctive voices to thrive.

Whether you are returning to Reading Rep or discovering us for the first time, this season is an invitation: to see familiar stories di erently, to experience theatre in new ways and to be part of something shared. We would love to welcome you next season.

readingrep.com

CREDIT: HARR YELLETSON
CREDIT: HHARRY ELLETSON
A CHRISTMAS CAROL
RABBIT ON THE RUN
DRACULA

BUCKS

August 15/16 & October 17/18th th

HAPPY holidays

Agreeing on child arrangements over the holidays

It is always better to agree child arrangements for the summer with your former partner or spouse directly (unless there are safeguarding concerns or it is impossible to have direct communication with the other parent), since your children will feel more comfortable knowing that the arrangements have been agreed rather than imposed by an anonymous third person, such as a judge. B P Collins’ family team o ers key advice on how to reach an agreement. Keep the children’s best interests at the forefront of your conversations. It may be challenging to engage with your former spouse or partner, but your separation a ects your children’s lives and (save for any safeguarding concerns) they will thrive having a close, loving relationship with both parents and seeing you both regularly.

Keep the children's best interests at the forefront

You may find it helpful to meet in a neutral space to discuss arrangements – or if that isn’t possible use email, WhatsApp, or an app like ‘Our Family Wizard’ that facilitates communication and monitors language used by both parties. It is important to keep your language impartial and open. Make suggestions, not demands. You could also consider suggesting that a mutual friend is also present as it can often be helpful to have an independent perspective.

Think carefully about the day-to-day arrangements and handovers including timing and cost of travel, your plans for telephone or video calls and schedules for trips abroad. Remember that you are likely to need your former spouse/partner’s consent to take your children out of England and Wales and, if that is not possible, permission from the court. Allow for some flexibility in arrangements. You may need to accommodate both of your work schedules and annual leave and that of any other relevant person –such as a new partner or child minder.

Think about creating a calendar or parenting plan showing your agreed arrangements and explain it in an ageappropriate way to your children. Do listen to their views and allow them to express their feelings. However, remember that the decisions should be yours and not your children’s.

Show your children that you can work together. Take a positive and enthusiastic interest in the activities the children do with their other parent as this puts the children first. If you need to change arrangements, let the other parent know with as much notice as possible. Unless there is an emergency or unforeseen circumstances, you should not change arrangements frequently or separately as this can cause distrust and is likely to be confusing to your children.

Contact B P Collins’ family team to explore your options at enquiries@bpcollins.co.uk or call 01753 889995, and find out more at bpcollins.co.uk

Swimming in QUALITY & STYLE

LIFETIME STRUCTURAL WARRANTY

We are increasingly spending our private lives in our homes rediscovering how much of a pleasure it is to spend time with family and friends.

A pool is an attractive extension of your living areathe ultimate way to enjoy your free time and enhance your lifestyle and health.

LIFETIME STRUCTURAL OSMOSIS WARRANTY

Choose from a wide range of designs and sizes with a comprehensive package that leaves nothing to be desired. A state-of-the-art product with a quick hassle-free installation. Your pool will not only enrich your family’s life, but also increase the value of your home. The speed and ease of installation will impress. Short lead times as most models are in stock.

SPECIAL SUMMER

inside this section:

HENLEY FESTIVAL p42

SUMMER EVENTS p44

FAMILY DAYS OUT p50

EXPLORA III p54

UK BREAK p60

SUNNY OUTLOOK

Summer is here, bringing a season of unforgettable experiences. From vibrant festivals and family-friendly adventures across Berkshire and Buckinghamshire, to inspiring holiday escapes, discover the very best ways to make the most of longer days.

RAISER CURTAIN

Kicking o our special look at local festivals, Suzanne Yeates, Festival Programme Director at Henley Festival , explains what makes this extravaganza so unique

Q What is it about the Henley Festival Floating Stage that makes artists – and audiences – describe it as one of the UK’s most magical live music settings?

A The location of the Floating Stage adjacent to the Thames riverbank, with the backdrop of Henley’s beautiful town, makes for a quintessentially English setting. With the seating area so close to the stage, it is the most intimate of concert venues, and the many boats that are attracted to the river at Festival time adds to the magical setting.

Q Henley Festival is known as the UK’s only black-tie music and arts festival. How does the formal dress code actually change the atmosphere compared with a traditional summer festival?

A Henley Festival’s black-tie dress code complements the elegant riverside setting. It adds to the theatricality and fun of the occasion, the audience love the opportunity of dressing up and feel they are attending a summer party by the river!

Q With artists ranging from Boy George & Culture Club and Sugababes to Ezra

Collective and Lulu appearing this year, how do you curate a line-up that feels eclectic but still distinctly “Henley”?

A The key thing is to create a line-up to complement our audience profile and to be cross generational. It is a challenge every year as the artists you might want are not available, but it is amazing how it somehow comes together in the end. It takes 4-5 months to plan!

Q Who on the bill are you particularly looking forward to seeing?

A Ezra Collective is one of the most exciting contemporary jazz bands. Winner of the Mercury Music Prize last year and Brit Award winning, they are so exciting to watch and listen to.

Q Henley Festival blends music, comedy, visual arts, fireworks and fine dining all in one riverside experience. Do audiences now expect festivals to be more immersive and multi-disciplinary?

A I am not sure they necessarily do, but it is what makes Henley Festival stand out from all the others – it is a totally unique experience.

Q The Festival’s RISE programme has become a major part of the event’s identity – what are some of the success stories that best show its impact since launching in 2022?

A We have expanded the Festival’s charitable RISE initiative, to o er opportunities not only to performing talent, but now to visual artists and technical production trainees. Every year, we select at least one RISE performer to return the following year to be part of the performance programme in the Bedouin venue. A couple of our RISE performers have been taken on by agents. A student on sound work experience with us has been o ered employment by the Festival’s sound company,

PHOTO: GARRY JONES
PHOTO: HARVEY WILLIAMS-FAIRLEY
We always o er guests something they won't have seen elsewhere

RG Jones. We have also launched a RISE CLUB with a group of founding members with an interest to progress the work of RISE.

Q How important is it that emerging RISE artists share the same festival environment as globally recognised acts like Boy George and Sugababes?

A Henley Festival o ers a fantastic opportunity for them to be on the same Festival bill as headline names. This improves their own standing in the business, and is useful for their self promotion. They also have the experience of watching the headline performances and observing the way in which they prepare for their Floating Stage show, from the crew load in, the sound check through to the evening’s performance.

Q This year’s comedy line-up includes everyone from Alan Davies to Julian Clary. How important is comedy to the overall Henley Festival experience?

A Comedy is a key art form at Henley, and we only wish we had more performance time and suitable venues to programme more comedians. This year’s comedy includes some high profile names. We hope our next development would be to support some emerging comedy talent working alongside these well established names.

Q Henley Festival seems to attract both loyal returning guests and first-timers every year. What tends to surprise newcomers most once

they arrive on the riverside?

A The stunning riverbank setting, the elegance of the enclosure and the guests, combined with the quirky nature of many of the acts that greet them.

Q From black-tie glamour and floatingstage performances to sculpture gardens and family-friendly Playdate events, Henley Festival feels deliberately unlike any other UK festival. Is that uniqueness something you actively protect as the event grows?

A Absolutely, as it sets us apart from so many other festivals. It is the reason we have so many returning customers, and hopefully will continue to do so. In addition to the headline and venue specific shows, we aim to programme fun and interactive experiences across the enclosure, always o ering guests something they won’t have seen elsewhere! There are very few other events nationally and internationally that o er quite such a diverse programme of art and music, in such a fabulous location.

The Henley Festival runs from 8-12 July. Find out more at henley-festival.co.uk

NIAH MCGIFF
PHOTO: GARRY JONES PHOTOGRAPHY
BOY GEORGE & CULTURE CLUB

Summer festivals

Whether you are looking to rock out or find an event perfect for all the family, Berkshire and Buckinghamshire have plenty of options for fun in the sun

SUMMER EVENING SERIES

2, 9 AND 23 JULY

newburyracecourse.co.uk

Newbury Racecourse’s Summer Evening Series returns with three themed Thursday events that combine horse racing, live entertainment and festival-style socialising. The series opens with The 70s Disco, celebrating classic dancefloor favourites and retro party vibes. The following week brings The Wild Wild West, transforming the racecourse with country music, bourbon bars and an afterparty hosted by award-winning country DJ Rattlesnake Johnny. The finale, The Beach Club, delivers Ibiza-inspired energy with cocktails, beach décor and Balearic sounds. Visitors can expect competitive racing throughout the evening followed by themed entertainment, food vendors, bars and DJs keeping the party going.

magazines

FI.FEST

10-11 JULY

fifest.co.uk

Fi.Fest returns to Fifield near Maidenhead with a family-friendly weekend that blends live music, entertainment and community spirit. Saturday is headlined by indie favourites The Fratellis, who will bring festival anthems including Chelsea Dagger and Whistle for the Choir to the main stage. Pop star Pixie Lott also joins the bill, while Friday features Liberty X, Rick Parfitt Jr and the RPJ Band, plus a high-energy set from DJ Woody Cook. Supporting artists include The Amy Winehouse Band, MacBusted, The Beatles Dub Club and Sweet Female Attitude. Beyond the main stage, visitors can enjoy tribute acts inspired by Taylor Swift, Chappell Roan and Eminem, alongside family attractions in an expanded Kids

Zone featuring a climbing wall and Wild West-themed activities. With camping options, street food vendors, bars and entertainment for all ages, Fi.Fest continues to establish itself as one of Berkshire’s most popular summer festivals.

STOWAWAY FESTIVAL

31 JULY-2 AUGUST

stowawayfestival.co.uk

Born from a backyard gathering between friends, Stowaway Festival has grown into a three-day escape, deep in the Buckinghamshire countryside. Explore a hidden world of ancient woodland, open fields, and shimmering lakes. What started as a DIY party has evolved into a celebration of sound, creativity, and connection. They keep things intimate, independent, and a little bit wild – staying true to the spirit

that started it all. With a genre-blurring line-up, secret sets, and free activities for kids and families, Stowaway is about more than music – it’s a space to explore, unwind, and lose yourself in good company.

Now entering its fifth year, one of the standout attractions for 2026 is legendary electronic pioneer Nightmares on Wax, whose genre-defying blend of soul, hip-hop, dub and downtempo grooves promises to be a major festival highlight.

REGGAE LAND

31 JULY-2 AUGUST reggaeland.co.uk

Reggae Land returns to Milton Keynes Bowl for its biggest edition yet, bringing together more than 120 artists across seven stages for a three-day celebration of reggae, dancehall and Caribbean culture. Since relocating to the National Bowl, the festival has become one of Europe’s leading events dedicated to the genre.

The 2026 line-up is led by global stars Burna Boy, Vybz Kartel, Shenseea and Shaggy, with further appearances from Beenie Man, Morgan Heritage, Tarrus Riley, Barrington Levy, Konshens, Mr Vegas and Super Cat.

Beyond the music, visitors can explore Caribbean food villages, rum bars, market stalls, museum spaces and immersive cultural experiences. The atmosphere is as important as the performances, with colourful décor, community spirit and non-stop entertainment creating a genuine celebration of Caribbean heritage and contemporary music.

DIASPORA CALLING!

7 AUGUST

diasporacalling.com

Making its UK debut at Milton Keynes National Bowl, Diaspora Calling! arrives as a major celebration of African diaspora culture, music and creativity. The inaugural edition is headlined by the iconic Ms. Lauryn Hill in her only confirmed UK performance of 2026. Joining her are fellow Fugees legend Wyclef Jean alongside Zion Marley and YG Marley, bringing together generations of influential musical talent.

Originally launched in 2016, Diaspora Calling! is more than a concert; it is a cultural platform showcasing shared histories, artistic expression and community. Festivalgoers can expect a vibrant atmosphere filled with live performances, visual arts, cultural programming and powerful storytelling.

ELECTRIC PARADISE

8 AUGUST

electric-paradise.co.uk

Electric Paradise is another new launch at Milton Keynes National Bowl, a largescale celebration of disco, funk, soul and house music. Designed as a feel-good summer gathering, the festival brings together some of the most influential names in dance and popular music for a day packed with nostalgia, energy and world-class performances.

Headliners include the incomparable Grace Jones, disco legend Candi Staton, reggae-pop favourites UB40, funk pioneers

Kool & The Gang and Sister Sledge featuring Kathy Sledge. Dance music fans can also look forward to sets from Armand Van Helden, Roger Sanchez and Dimitri From Paris. Across multiple stages, audiences can move between live bands, DJ performances and classic singalong moments. Combined with high-end production, impressive staging and the iconic Bowl setting, Electric Paradise is designed to appeal to several generations of music lovers looking for a vibrant festival atmosphere.

ROYAL WINDSOR LIVE

13-15 AUGUST

yoursummerlive.co.uk/windsor Royal Windsor Live combines top-tier live music with the unique setting of Royal

NEWBURY SUMMER SERIES
NIGHTMARES ON WAX, PHOTO: OLLIE TRENCHARD
PIXIE LOTT, PHOTO: MOEEZ

Windsor Racecourse. On 13th August, skapop legends Madness bring their catalogue of beloved hits to Windsor for an evening packed with energy, brass-driven anthems and crowd-pleasing singalongs. The following night sees chart-topping boyband Five headline a nostalgic celebration of 1990s and 2000s pop, supported by The Wanted 2.0 and additional special guests. Then, on 15th August, is Summertime Live, headlined by Tinie Tempah.

The open-air setting creates a relaxed summer atmosphere, while the combination of racing, entertainment, food and drinks makes the event appeal to both music fans and casual visitors.

READING FESTIVAL

27-30 AUGUST

readingfestival.com

Reading Festival remains one of the UK’s most influential music events and returns for another huge Bank Holiday weekend in 2026. This year’s headline line-up makes history by featuring an exclusively British and Irish top bill for the first time in 25 years, led by Charli xcx, Chase & Status, Dave, Florence + The Machine, Fontaines D.C. and RAYE. Across the site, fans can also catch performances from Skepta, Kneecap, Role Model, Sombr, Jade, Josh Baker, Kettama and many more emerging artists.

Known for its ability to showcase both global superstars and future headline acts, Reading continues to set trends within the UK festival scene. Multiple stages, largescale production, extensive food and drink options and a lively campsite atmosphere combine to create a full weekend experience.

FOUND FESTIVAL

28-30 AUGUST

foundfestival.uk

Found Festival returns to the beautiful Claydon Estate for a carefully curated weekend that blends music,

comedy, wellness, creativity and family entertainment in an intimate setting. Created by the family behind Towersey, the event is deliberately small in capacity, giving festivalgoers the chance to enjoy a relaxed atmosphere while still accessing a programme that rivals much larger events.

Music highlights include Oxford folk favourites Stornoway, Americana heroes The Felice Brothers and Celtic innovators Elephant Sessions. Comedy fans can look forward to appearances from Shappi Khorsandi and Kiri Pritchard-McClean, alongside live podcast recordings. Away from the stages, visitors can take part in yoga, meditation, sound baths, dance workshops and large-scale art projects, while families can enjoy circus skills, storytelling and the much-loved Midnight Playground. Silent discos, lantern processions and lakeside fire performances add to the night-time fun.

WOKINGHAM FESTIVAL

29-31 AUGUST

wokinghamfestival.co.uk

Wokingham Festival returns over the August Bank Holiday weekend with three days of live music, family entertainment and community celebration at Cantley Park. The festival is known for championing both local talent and established performers, with more than 40 artists appearing across two alternating stages. The event places a strong emphasis on accessibility and inclusivity, making it an ideal choice for families looking for a relaxed festival experience. Alongside the music, visitors can enjoy a wide range of food stalls, craft vendors and activities for younger attendees. A popular real ale bar o ers specialist beers, ciders and perries alongside cocktails and soft drinks. This is friendly, a ordable and community-driven.

FIVE STAR AT ROYAL WINDSOR LIVE
DEBBIE SLEDGE PHOTO: LADIES OF SOUL BY SET VEXY PRODUCTIONS
FOUND FESTIVAL

Stage

IS SE T

HeritageLive Festivals returns to Englefield Estate with the soundtrack to the summer

Berkshire’s picturesque Englefield Estate will once again become one of the UK’s most atmospheric outdoor music destinations next summer as HeritageLive Festivals returns with a four-day programme of headline performances from some of Britain’s best-loved acts.

ALI CAMPBELL

Running from 23–26 July, the festival series combines world-class live music with the backdrop of one of England’s most beautiful historic estates, continuing a tradition that has previously welcomed artists including Hozier, The Beach Boys, Madness, Elbow and The Jacksons.

The festivities begin on Thursday 23 July with electronic pioneers Faithless, who are celebrating their 30th anniversary. The iconic dance act, famed for era-defining tracks such as Insomnia, Salva Mea and God Is a DJ, remains one of the most influential names in British electronic music. They will be joined by Leftfield (DJ set) and Tricky.

On Friday 24 July, Richard Ashcroft takes to the stage. The two-time Ivor Novello Award winner and former Verve frontman will perform a catalogue that spans solo successes and enduring Britpop classics, including Bittersweet Symphony, The Drugs Don’t Work and Lucky Man He will be joined by special guests Shed Seven, Tom Meighan and The Kairos.

The weekend continues on Saturday 25 July with Ministry of Sound Classical, the acclaimed live production that reimagines dance music’s biggest anthems through a 30-piece orchestra, DJs and vocalists. Special guests include Example, Roger Sanchez, Tall Paul, Seb Fontaine and Utah Saints, promising a celebration of club culture under the stars.

Englefield Estate is one of the UK's most atmospheric outdoor music destinations

Closing the festival on Sunday 26 July is UB40 Featuring Ali Campbell. With more than 70 million records sold worldwide and over four decades of chart-topping hits, the reggae legends will bring favourites such as Red Red Wine, Kingston Town and (I Can’t Help) Falling In Love With You to Berkshire. Support comes from Bitty McLean, Gentleman’s Dub Club, General Levy, Bushman and Channel One Soundsystem.

Staged at Englefield Estate, Reading, HeritageLive Festivals has built a reputation for pairing major artists with some of England’s most significant heritage locations. Tickets, including VIP packages, are on sale now, o ering music lovers the chance to enjoy a memorable midsummer weekend in one of the country’s most scenic outdoor settings.

heritagelive.net

GAME GENERATION

Why summer in Berkshire and Buckinghamshire throws up entertainment for all the family

Few counties are better suited to summer days out than Berkshire and Buckinghamshire. They combine rolling countryside, grand estates, riverside scenery, market towns, family attractions and some of the country’s most impressive historic landmarks. Whether the perfect summer day means exploring royal history, picnicking beside a river, wandering through ancient woodland, discovering picturesque villages or entertaining children during the school holidays, these neighbouring counties o er an exceptional variety of experiences within a relatively compact area.

A summer visit to Berkshire almost inevitably begins in Windsor, one of England’s most famous destinations. The town combines royal heritage with a

relaxed riverside atmosphere that comes into its own during the warmer months. Windsor Castle dominates the skyline and provides an extraordinary glimpse into nearly a thousand years of history, while the surrounding streets are filled with cafés, restaurants and independent shops. On a sunny day, one of the greatest pleasures is simply strolling along the Long Walk in Windsor Great Park, where wide-open views stretch towards the castle and ancient trees provide welcome shade. The park itself feels vast enough to escape the crowds, with deer roaming across the landscape and countless spots suitable for a picnic. The River Thames is another defining feature of Berkshire’s summer appeal. The riverside towns of Maidenhead, Cookham and Reading each o er their own character, but few places capture the essence of an English summer quite like Henley-on-Thames. Famous

worldwide for its rowing regatta, Henley remains attractive long after the racing crews have departed. Visitors can hire boats, enjoy waterside walks, browse boutique shops or simply watch the river tra c pass by. The combination of elegant architecture, green spaces and tranquil water creates an atmosphere that encourages visitors to slow down and savour the day.

Families seeking excitement often head towards Ascot and Bracknell, where some of Berkshire’s best-known attractions are located. Legoland Windsor remains one of Britain’s most popular family destinations, o ering rides, interactive experiences and themed areas that keep children entertained for hours. During summer, the colourful landscaping and outdoor attractions are particularly enjoyable. Nearby, Swinley Forest provides a di erent kind of adventure, with walking trails,

There is an exceptional variety of experiences within a relatively compact area

cycling routes and woodland play areas that encourage families to spend time outdoors. Nature lovers are spoiled for choice across Berkshire. Dinton Pastures Country Park near Wokingham o ers lakes, meadows and woodland paths that are ideal for gentle summer walks. Paddleboarding, kayaking and birdwatching add to its appeal, while large open spaces make it a favourite for picnics. Further west, the North Wessex Downs provide some of the county’s most beautiful scenery. The chalk hills and quiet lanes reveal a more rural side of Berkshire, where visitors can explore traditional villages and enjoy panoramic views across the countryside.

One of Berkshire’s hidden strengths is the variety of gardens that reach their peak during summer. The Savill Garden, located within Windsor Great Park, showcases beautifully maintained planting schemes,

colourful flower displays and peaceful walking routes. Meanwhile, Basildon Park o ers elegant Georgian architecture surrounded by landscaped grounds that are especially attractive on warm days. Combining heritage with natural beauty, such locations appeal equally to keen gardeners, photographers and casual visitors. Crossing into Buckinghamshire introduces a landscape that feels subtly di erent yet equally rewarding. The county is renowned for its picturesque villages, many of which seem almost untouched by time. Places such as Turville, Hambleden and Great Missenden are quintessentially English, with flint cottages, village greens and winding country lanes. During summer, flowers spill from gardens and pub terraces fill with visitors enjoying long afternoons outdoors. These villages are ideal destinations for

ROALD DAHL MUSEUM

CHINNOR & PRINCES RISBOROUGH RAILWAY THERE’S ALWAYS

Enjoy a leisurely heritage train ride alongside the Chiltern Hills.

Arrive at Princes Risborough by Chiltern Railways - or come to Chinnor by car for free parking. Then relax in your comfortable seat and enjoy the lovely scenery whilst the steam drifts lazily past your window - watch out for the local wildlife and Red Kites often whirling overhead on the approximately one-hour return journey. For time tables and fares information please see website.

leisurely exploration and often serve as gateways to the wider Chiltern Hills.

The Chilterns are undoubtedly Buckinghamshire’s greatest natural asset. Designated for their outstanding beauty, these rolling hills provide countless opportunities for walking, cycling and sightseeing. Summer reveals the landscape at its finest, with wildflower meadows, ancient woodland and sweeping viewpoints creating an ever-changing backdrop. Coombe Hill near Wendover o ers some of the most spectacular views in the region, making it a popular destination for walkers and photographers alike. The sense of openness and tranquillity is remarkable considering the county’s proximity to London.

For visitors interested in heritage, Buckinghamshire o ers an abundance of remarkable sites. Waddesdon Manor is among the most impressive. Built in the style of a French château, it combines magnificent architecture with extensive gardens and grounds. Summer is arguably the best time to visit, when colourful planting schemes, outdoor sculptures and woodland walks can all be enjoyed at their peak. The estate frequently hosts seasonal events, adding further appeal for families and returning visitors.

Another standout destination is Stowe Gardens. Widely regarded as one of Britain’s finest landscape gardens, Stowe o ers a unique combination of lakes, temples, monuments and carefully designed vistas. Exploring the grounds feels less like visiting a formal garden and more like embarking on a journey through a living work of art. Summer allows visitors to fully appreciate the scale and beauty of the landscape while enjoying long hours of daylight.

Buckinghamshire is also rich in literary and cultural connections. Great Missenden is closely associated with Roald Dahl, and the village attracts

Bekonscot is perfect for children to explore and get curious

families eager to explore the surroundings that inspired many of his stories. The local museum provides fascinating insights into his life and work, while the surrounding countryside o ers plenty of opportunities for walks and exploration. It is a destination that combines education and entertainment in equal measure.

For families, Buckinghamshire o ers attractions that appeal across generations. If you are looking for something to keep everyone entertained this summer, there is lots going on at Bekonscot Model Village & Railway. Established in 1929 and set in 1.5 acres of manicured gardens, it is the perfect day out for adventurers young and old. Bekonscot is a great accessible outdoor experience and a perfect opportunity for children to explore and get curious. Step into a miniature world and, during your next visit, wander through their miniature village scenes, marvel at the extensive Gauge 1 model railway and watch the trains whizz by, enjoy Greg Chapman’s magic shows (on selected dates – see more at bekonscot.co.uk), explore the Football World Cup exhibition, enjoy a ride on the 7 1/4" narrow gauge light railway and relax

with some tasty seasonal treats from the tearoom after a busy day of discovery.

Water also plays an important role in Buckinghamshire’s summer appeal. The Grand Union Canal passes through several attractive locations, providing peaceful walking and cycling routes. Marlow, situated on the Thames, combines riverside beauty with a vibrant food scene and attractive high street. Summer evenings beside the water are especially memorable, with rowing boats gliding past and visitors gathering at cafés and restaurants overlooking the river.

The greatest luxury of summer in these counties is the freedom to choose between activity and relaxation. Adventure parks, cycling trails and watersports are available for those seeking excitement, while gardens, stately homes and quiet riverside walks o er a slower pace.

The blend of history, scenery and family-friendly attractions ensures there is always something new to discover. Whether visiting for a weekend or enjoying a longer stay, Berkshire and Buckinghamshire consistently prove themselves among the finest places in England for memorable summer days out.

BEKONSCOT MODEL VILLAGE
ROWING ON THE THAMES

Ocean LIVING

Explora Journeys prepares to launch EXPLORA III in July, featuring a new collaboration with acclaimed architect and designer Patricia Urquiola, which is redefining luxury at sea

There is a growing movement in luxury travel away from excess and towards experience. Today’s a uent travellers are less interested in gilded grandeur and more drawn to spaces that feel personal, authentic and deeply considered. It is a philosophy that has shaped everything from boutique hotels and private residences to the latest generation of luxury yachts. Now it is making waves across the world of ocean travel.

When EXPLORA III launches in July, the newest vessel from luxury lifestyle brand Explora Journeys will introduce a fresh interpretation of what it means to feel at home at sea. At the heart of that vision is an exclusive collaboration with celebrated architect and designer Patricia Urquiola, whose newly conceived Owner’s Residence promises to bring a distinctly residential sensibility to one of the most exclusive addresses afloat.

The arrival of EXPLORA III is one of the most anticipated launches in luxury cruising this year. Following a Mediterranean prelude voyage in July and a maiden journey from Barcelona to Lisbon in early August,

the ship will visit Southampton before continuing its inaugural season through Northern Europe, Iceland and Greenland. For British travellers, its August call o ers an early opportunity to glimpse the future direction of luxury ocean travel.

For Patricia, whose work spans architecture, interiors and product design, the commission represented something far more nuanced than creating a lavish suite. The Spanish-born designer, who has collaborated with some of the world’s most respected design houses and hospitality brands, approached the project through the lens of emotion and connection.

Rather than competing with the surrounding seascape, her design allows the ocean to become the central character. Positioned at the stern of the ship on Deck 7, the residence opens onto uninterrupted views across the water, with oversized windows framing constantly changing horizons like living works of art. It is a design strategy that aligns perfectly with Explora Journeys' philosophy of fostering what it calls an "Ocean State of Mind" – a slower, more mindful way of experiencing travel through a deeper connection with the sea.

The scale of the residence is undeniably impressive. Covering 280 square metres in total, including a remarkable 125-squaremetre private terrace spanning the width of the vessel, it ranks among the largest and most exclusive accommodations available anywhere at sea. Yet despite its generous proportions, the design emphasis is on intimacy rather than spectacle.

Patricia has described the residence as a protective nest, shaped by Mediterranean influences and conceived as a place that moves in harmony with the rhythms of the ocean. Earthy colours, warm neutrals and tactile natural materials establish an atmosphere that feels calm and reassuring. Bronze accents catch shifting daylight, while Cipollino and Travertino marble introduce layers of warmth and texture. Ribbed woods create

THE DESIGN ALLOWS THE OCEAN TO BECOME THE CENTRAL CHARACTER

gentle waves of movement throughout the interiors, echoing the changing patterns of the sea beyond the glass.

This emphasis on materiality has long been a hallmark of Patricia’s work. Across residential projects, luxury hotels and furniture collections, she has consistently explored how texture and craftsmanship can influence emotional wellbeing. On EXPLORA III, those ideas are translated into an environment where every surface has been selected not only for its appearance, but for the way it responds to natural light throughout the day.

The result is an interior that feels remarkably grounded for a setting surrounded by water.

Furniture plays an equally important role in establishing the residence’s character. A curated collection from leading Italian design brands including Cassina, Moroso and Kettal reinforces the project’s residential credentials. Many of the pieces were designed by Patricia herself, bringing a personal signature to the space without overwhelming it.

In the living area, sculptural sofas and elegant dining furniture create inviting zones for relaxation and entertaining, while carefully chosen lighting introduces warmth and softness after sunset.

PATRICIA URQUIOLA
OWNER'S RESIDENCE
OWNER'S RESIDENCE BATHROOM

The bedroom continues the narrative of understated luxury. Here, a bespoke king-sized bed dressed in fine linens becomes the focal point, complemented by a spacious dressing area and a marbleclad bathroom complete with double vanity, rain shower, bathtub and private steam room. Every detail has been designed to encourage guests to unwind, reconnect and settle into the slower pace that ocean travel naturally invites.

Perhaps most striking is the fluidity between indoor and outdoor living. A continuous sculpted marble wall treatment extends through the residence, subtly guiding movement towards the expansive terrace. Outside, guests can soak in a private whirlpool, dine alfresco or simply watch the horizon unfold from a collection of beautifully appointed lounge furnishings. The boundary between architecture and landscape feels intentionally blurred.

It is this sense of seamless living that increasingly defines modern luxury. Across the hospitality world, travellers are seeking spaces that feel less like temporary accommodation and more like extensions of their own lifestyle. The Owner’s Residence captures that shift perfectly, o ering the comfort and familiarity of a private home combined with the freedom of exploring some of the world’s most remote and spectacular destinations.

The launch of EXPLORA III also reflects the broader ambitions of Explora Journeys itself. Since entering the market, the brand has positioned itself as a contemporary alternative within luxury cruising, combining European sophistication, spacious accommodation and immersive itineraries. Every suite onboard faces the ocean, while the emphasis on wellness, gastronomy and intuitive service aims to attract a new generation of travellers who may never previously have considered a cruise holiday.

Patricia’s involvement signals the growing convergence between the worlds of high design and luxury travel.

Increasingly, travellers are choosing destinations, hotels and experiences not simply for where they are, but for how they make them feel. Design has become an essential part of the journey itself.

As EXPLORA III prepares to arrive in UK waters this summer, it brings with it more than a new level of luxury accommodation. It o ers a compelling glimpse into the future of life at sea –one where comfort, craftsmanship and emotional connection matter just as much as the destinations beyond the horizon.

For discerning travellers seeking the ultimate home away from home, the future may well be floating on the ocean.

Explore the Explora III

Experience a journey to stunning fjords, colourful coastlines and Nordic delights

DEPARTURE PORT

Southampton 17th August

RETURN PORT

Copenhagen 25th August

From vibrant Southampton, you will be able to indulge in a day of luxury at sea as you glide into Mandal, where Norway’s southern sun shines on golden beaches and white-washed houses. You continue your Norwegian odyssey with Sandnes, the gateway to Stavanger’s multi-coloured streets, then Olden’s dramatic ords and glaciers. In Bergen, sample seafood delicacies and view scenic peaks, then take a breathtaking rail journey through the beauty of Flåm. For the lively finale, enjoy the joyful welcome of Copenhagen.

Discover more at explorajourneys.com

THE CONSERVATORY POOL & BAR
CREMA CAFE

ENJOY THE experience

The founder of TRIPLA on why your holiday shouldn’t be hard work

To me, true luxury is when everything on the holiday flows

We’ve all been there. Ten-tabs deep in-flight options, hotel reviews, and “must-see” lists. Why does organising time away so often feel like a job in itself? We sat down with Carsten Lund, founder of TRIPLA, to hear why he believes travel should feel e ortless, and how his own experiences have inspired a di erent approach.

Q Carsten, you’ve spent a lifetime travelling. What stands out most from those experiences?

A I’ve been lucky to see the world through both a luxury and practical lens, from barefoot escapes on private islands to cultural weekends in Europe, and even multi-generational cruises or villas. And what always stands out is how much detail matters. The transfer that’s waiting without fuss or the restaurant that actually lives up to its promise. It’s these little things that turn a good trip into a truly memorable one.

Q Many of us know the stress of planning holidays. What do you think makes it so challenging?

A Time, mostly. People are busy, and while travel should be restorative, organising it often isn’t. I’ve seen clients arrive exhausted before their holiday even begins because they’ve spent weeks trying to piece it all together online. One family I worked with wanted a milestone birthday in Tuscany. They’d been overwhelmed by villa choices and didn’t know which were genuinely right for them. We stepped in, found a villa with space for grandparents, teenagers, and young children, complete with a private chef for a celebratory meal

and a private wine tasting. For them, it turned from a logistical headache into a celebration they’ll never forget.

Q When we were chatting before this interview, you said luxury is about “ease.” What does that mean to you?

A To me, true luxury is when everything flows. That doesn’t always mean extravagant, but it does mean thoughtful. A wellness retreat in the Alps where transfers, spa treatments, and mountain hikes are seamlessly coordinated. Or a short city break where the flights, hotel, and a hard-to-get dinner reservation are already sorted. We do work with hightouch experiences, but it’s not about the price tag, it’s about removing stress and creating something that feels personal.

Q In your experience as a traveller and industry professional, have you noticed travel needs changing in recent years?

A Very much so. People are no longer just looking for a nice hotel or a beautiful view, they often want something deeper, something that resonates. I’ve noticed a real shift towards travel that feels meaningful. For some, that means behind-the-scenes cultural access; meeting local artisans, exploring places tourists don’t usually see. For others, it’s culinary journeys, connecting with a region through its food and wine. And increasingly, it’s about restoration: wellness retreats, mindful escapes, and time to simply switch o in a way daily life doesn’t allow. Travel has become less about ticking o a destination and more about creating experiences that inspire, enrich, and stay with you long after you’ve returned home.

Q With travel uncertainty on the rise, how can travellers be sure their money is safe?

A At TRIPLA, protection isn’t an add-on – it’s the foundation of everything we do. All flightinclusive holidays are fully ATOL protected, and every client payment is held securely in Trust by NatWest Bank and the Travel Trust Association. This means client money is safeguarded from the moment they book, even in the unlikely event that a supplier or TRIPLA were to fail. In a landscape where reassurance matters, TRIPLA ensures every journey is 100% financially secure.

Q What’s the best way to start planning a trip with TRIPLA?

A Everything begins with getting to know you. When clients connect with us, it gives us a sense of their travel style and helps us start shaping ideas that are genuinely personal. Joining our mailing list also keeps you in the loop with tailored inspiration, updates and occasional o ers, including the chance to win a £500 travel voucher. It’s a simple first step toward creating a journey designed entirely around you.

Q And finally, what do you hope clients feel when they travel with TRIPLA?

A Peace of mind, really. That feeling of being looked after so they can just enjoy the experience. Whether it’s a river cruise with private excursions, a birthday in Tuscany, or a quick Parisian escape between board meetings, I want them to feel it was designed just for them. And that they never had to worry about the details.

Visit hellotripla.com/absolutely, WhatsApp 07822 034871 or call 020 3026 9936 for more

CARSTEN LUND

Garden ESCAPE

A leafy Earl’s Court retreat bringing calm, comfort and character

In a city that rarely slows down, finding a genuine sense of escape in London can feel like a luxury in itself. Yet tucked away behind the bustle of Earl’s Court is a hotel that o ers exactly that: a pocket of calm where London’s energy softens, gardens take centre stage and lingering a little longer feels entirely natural.

London may be one of the world’s great city-break destinations, but choosing the right base can make all the di erence. With a trip planned to the Eventim Apollo for a live screening of Indiana Jones and the Raiders of the Lost Ark accompanied by a full orchestra, Earl’s Court proved the ideal location, o ering excellent transport connections via the Circle, District and Piccadilly lines. What we hadn’t anticipated was finding a destination that would make us rethink leaving the hotel at all.

Nestled on a quiet residential street

just moments from the station, Templeton Garden feels worlds away from the capital’s relentless pace. The neighbourhood has long attracted notable residents, from literary figures to film-makers, and the hotel pays homage to that heritage through its sense of understated elegance and connection to nature. At its heart lies a beautifully landscaped garden – a rarity in this part of London and one that immediately sets the tone for a more relaxed stay. Even viewed through rainspeckled windows during our visit, it provided a welcome sense of tranquillity.

Inside, the design strikes a careful balance between contemporary luxury and classic English charm. The 156 rooms and suites have been thoughtfully conceived, with natural textures, muted tones and refined detailing creating an atmosphere that feels both sophisticated and welcoming. Our Junior Suite was

Templeton Garden feels worlds away from the capital's relentless pace
THE GARDENS, PHOTO BY JAMES MCDONALD
A PEPPERCORN PALOMA

particularly impressive. A generous fourposter bed dominated the room, while earthy hues and elegant finishes lent it a distinctly residential feel. The spacious bathroom, complete with freestanding bath, separate shower and Le Labo amenities, reinforced the sense that no detail had been overlooked. Complimentary cheese and biscuits waiting on arrival provided an especially thoughtful touch.

As evening arrived, we headed to Sprout, the hotel’s intimate cocktail bar. There is a confidence to the space that avoids any hint of pretension. The drinks menu is inventive without becoming inaccessible, with each cocktail built around a defining ingredient or visual flourish. Our raspberry margaritas struck the perfect balance between creativity and drinkability, delivering plenty of personality while remaining reassuringly familiar. It’s the sort of neighbourhood bar many Londoners would be delighted to have on their doorstep. Fortunately, dinner required little more than a short stroll across the corridor to Pippin’s, Templeton Garden’s restaurant. Overlooking the gardens, the dining room o ers a calm and elegant setting, while the kitchen focuses on seasonal

British ingredients elevated with a light contemporary touch. The menu encourages sharing and conversation, but equally rewards those happy to settle in for a leisurely meal of their own choosing.

To begin, padrón peppers proved considerably more generous than their modest menu description suggested, while a classic shrimp cocktail arrived beautifully presented and disappeared almost as quickly. For mains, the beer-battered haddock was everything this British staple should be – crisp, delicate and perfectly judged, accompanied by chunky chips and mint-crushed peas that felt comfortingly familiar while maintaining a refined edge.

Across the table, the market fish of the day, a beautifully cooked Coley served in a white wine sauce, showcased the kitchen’s ability to let quality ingredients speak for themselves. Seasonal asparagus and a fresh summer salad completed the picture.

Dessert continued the strong showing.

A generously portioned matcha Basque cheesecake paired with honey ice cream delivered rich flavour and a striking finish, while simpler scoops of ice cream o ered a lighter conclusion. Throughout the meal, service was attentive without becoming intrusive, with thoughtful wine recommendations – including a glass of Nyetimber Classic Cuvée and a refreshing rosé from Léoube –complementing the menu beautifully. What lingers most about Templeton Garden is not any one feature, but the

feeling it creates. The gardens, the thoughtful interiors, the inviting food and drink o ering – all combine to create a hotel that feels less like a stopover and more like a destination in its own right. And so, in a city celebrated for movement, Templeton Garden o ers something increasingly valuable: a reason to pause. The perfect London escape, it proves that sometimes the best part of a city break is finding somewhere you’re reluctant to leave.

miirohotels.com/templetongarden

SPROUT BAR, PHOTO BY ANTON RODRIGUEZ
THE GARDEN SUITE, PHOTO BY JAMES MCDONALD
PIPPIN'S, PHOTO BY ANTON RODRIGUEZ

Summer OF LOVE

Begin your journey to forever at Wasing Park this season

Wasing Park is a beautifully restored farm hamlet surrounded by tranquil gardens, ancient woodlands and sweeping countryside views. Combining timeless charm with contemporary elegance, the exclusive-use venue o ers an unforgettable setting for weddings of every style and season.

Situated at the venue are 26 stylishly appointed bedrooms sleeping up to 64 guests. Each room o ers bespoke design with absolute luxury, set within an elegant historic setting. Highlights include the unique Grade II-listed Granary perched proudly on its staddle stones, the fairytale Dovecote, the Smithy, and the romantic Honeymoon Suite, each o ering its own distinctive charm and character.

Discover an enchanting choice of three stunning ceremony spaces; the picturesque

parish Church of St. Nicholas, the idyllic Victorian Summerhouse embellished with an intricate hand-painted mural, perfect for outdoor weddings and the characterful Garden Room with its rustic oak beams, aged brickwork and contemporary walls of glass bi-fold doors allowing the outdoors in.

At the heart of the estate is a deep commitment to sustainability, reflected in its exquisite seasonal estate-to-plate dining. Couples can enjoy the finest locally sourced cuisine, including a thoughtfully curated noseto-tail wedding breakfast menu featuring beef from the Estate’s on-site organic farm. Celebrate in style in the award-winning Castle Barn, a stunning space with soft red brick walls and distinctive arrow slits, o ering a blank canvas to personalise your wedding and bring your unique vision to life. A floating stretch tent over the terrace allows for al fresco evening dining all year round, while the outdoor kitchen adds theatre as chefs prepare exquisite dishes over the fire pit and wood-fired oven.

Widely regarded as one of the UK’s finest wedding venues, Wasing Park now o ers bespoke 2-to-3-day wedding experiences that create a destination feel within the UK. Couples can enjoy extended celebrations with a host of unique activities, from welcome dinners and lakeside yoga to enchanting moonlit performances and cocktail classes set amidst the Estate’s stunning grounds. Think ale trails and garden games, Pimm’s-filled picnics in the woodlands, or even a family-and-friends cricket match at Wasing’s Cricket Pavilion, all providing the perfect backdrop for creating lasting memories.

Throughout summer 2026, couples are invited to book a personal showround to explore the grounds, meet the team and start bringing the wedding of their dreams to life.

To arrange a visit, call 0118 907 0199 or visit wasing.co.uk/book-a-visit

PHOTO: STUDIO
ROUGE PHOTOGRAPHY

DE VERE

WOKEFIELD ESTATE

Nestled in 250 acres of picturesque, idyllic Berkshire countryside, De Vere Wokefield Estate is a wedding venue with heritage, elegance and romance.

This country estate is home to a Grade II listed Mansion House which has been thoughtfully restored to its former glory following a £20 million refurbishment. The Mansion House o ers wedding couples the chance to have the fairy-tale wedding of their dreams with the option of exclusive use, dry hire and outdoor ceremonies. The Lincoln Suite is perfect for your civil ceremony o ering dual aspect views over the lawns and an abundance of natural light, whilst the Terrace Suite, grand and glorious, is the ideal space for your wedding breakfast and evening reception. If the weather is fair, say your vows under the eaves of the Wedding Pavilion outside on the lawns with the glorious Mansion House providing a picturesque backdrop. Eighty seven luxury bedrooms, including 12 suites, are located in the Mansion House o ering your guests their own slice of decadence and peace once the celebrations have ended. A further 222 bedrooms are available to book in Wokefield Place. devere.co.uk/wokefield-estate/weddings

SOPWELL HOUSE

Sopwell House is an enchanting countryside wedding venue o ering comprehensive packages and bespoke services tailored to each couple’s vision. Set within 12 acres of private gardens, the elegant 18th-century manor features stylish restaurants, a vibrant cocktail bar, and 126 recently renovated guestrooms, including luxurious suites and 16 exclusive Mews Suites.

The secluded Mews, once a stable block, is nestled within botanical gardens and centred around a striking infinity hydrotherapy pool. Accessible through private gates, it provides a romantic retreat for newlyweds or a tranquil hideaway for the wider wedding party.

Couples can enjoy world-class relaxation at the award-winning Cottonmill Spa, inspired by global wellness destinations and designed to rejuvenate both before and after the wedding. The grounds o er picturesque backdrops for ceremonies and photography, including manicured lawns, a koi pond, arched bridge, and a licensed gazebo for outdoor weddings. With 15 versatile event spaces accommodating up to 300 guests, Sopwell House caters to both intimate and grand celebrations. A dedicated wedding coordinator ensures every detail is carefully planned, from private entrances to tailored menus. Bespoke packages, guest rates, and dry hire options are also available, ensuring a truly personalised and memorable wedding experience. sopwellhouse.co.uk

BODLEIAN LIBRARIES

At the heart of Oxford, this world-renowned institution o ers an extraordinary collection of historic spaces, where centuries of scholarship and architectural beauty create an atmosphere unlike any other.

Exchange vows beneath soaring vaulted ceilings, dine amongst medieval history, and celebrate surrounded by some of the most exquisite heritage interiors in Britain. From the magnificent Divinity School to the awe-inspiring Duke Humfrey’s Library, each setting is rich in detail, history and timeless elegance.

Renowned for impeccable service, the Bodleian’s expert events team ensures every element is flawlessly delivered, allowing couples to create a celebration that feels both personal and truly exceptional. For those seeking a wedding defined by history, beauty and unforgettable moments, the Bodleian Libraries o er a setting of rare distinction. bodleian.ox.ac.uk

SOUTH FARM

Your wedding day at South Farm begins in the serenity of the Apple Shed. Quietly removed from the celebrations to come, this bespoke, beautifully appointed space is designed for unhurried morning preparation. Gather with your nearest and dearest at the dedicated hair and makeup bar, sink into plush sofas, slip away to the private changing room for your allimportant reveal, and keep the celebratory bubbly chilled in your own private kitchen.

As the day unfolds, South Farm transforms into an enchanting summer paradise. Set within 20 acres of glorious, sun-dappled seasonal grounds, the countryside venue o ers the ultimate flexibility for your ceremony. Exchange your vows on the beautifully kept lawns under the brilliant summer sky, or move inside to the romantic, historic barns.

The celebration flows into the courtyard, where a vibrant outdoor bar serves refreshing reception drinks as guests wander through organic kitchen gardens, past idyllic ponds, and through to meet the resident miniature donkeys, pygmy goats, and a menagerie of rare-breed animals beyond. Rustic charm, a solar-powered field-to-fork ethos, and timeless romance combine to create a summer wedding day that feels entirely, beautifully your own. south-farm.co.uk

FOOD & DRINK

WHAT TO DRINK

GRAPE news

Wine recommendations for the month

TASTING

NOTES

The latest launches and news from across the county

Azevedo Loureiro-Alvarinho, Vinho Verde 2025

 £10.95

Delicately fragrant, smartly dressed blend of the region's best-known grapes, loureiro and alvarinho, with little or no Vinho Verde spritz. The Loureiro brings an attractive citrus-blossom character and the alvarinho a delicious creamy peach quality.

Familie Mantler Dry Rosé, Niederösterreich 2025

£9.50

The fresh air of the rolling Austrian hills is captured in this crisp, dry and refreshing pale rosé. This delicate pale-pink has notes of strawberry and raspberry fruit on the nose. The palate is uncomplicated, vibrant and focused, with deliciously mouth-watering zestiness and an apricot twist.

Ponte da Boga P Mencía, Ribeira Sacra 2024

 £12.50

A perfumed, peppery and fruit-forward red with all the hallmarks of the mencía grape, crunchy sour cherry and blackcurrant mingle with floral and spicy notes of violet and black liquorice. This is a fresh and vibrant red for lovers of pinot noir, grenache or gamay.

Since it was founded back in 1874, The Wine Society has dared to do business a little differently. Bringing together a community united by a shared love of wine, The Society is a co-operative and owned by its members. This means there is no requirement to pump profit into annual dividends or bonuses for shareholders – all profits go back into the business.

The Wine Society welcomes all wine lovers. Become a member today and receive £20 off toward your first order. thewinesociety.com

Taste of Berkshire

MONKEY ISLAND ESTATE

Dining at Monkey Island Estate is always a delight; the surroundings are refined yet intimate and informal, and steeped in history. The cuisine is a delectable modern take on British classics, with produce freshly sourced from the gardens and surrounding countryside. Choose to dine in the elegant main dining room or on the terrace with views of the River Thames.

monkeyislandestate.co.uk

Need for feed

This summer, Silverstone and the British Grand Prix is hosting some of the biggest names from the UK’s restaurant scene. The acclaimed chefs will serve up unique street food in their own signature styles to guests at Octane Terrace, a premium al fresco experience over the Formula 1® Pirelli British Grand Prix weekend on 3-5 July. silverstone.co.uk

Social spirit

PREMIUM COUNTRY PUBS

TAKE THREE Summer drinks

VILLEMARIN PICPOUL

Everybody loves Picpoul de Pinet, the perfect summer wine, and Ormarine Villemarin Picpoul is a Majestic favourite, £12.50. majestic.co.uk

With summer on its way, Premium Country Pubs across Berkshire and Buckinghamshire have unveiled a summer cocktail collection. Inspired by longer, lighter days and the social spirit of the British summer, the collection showcases a mix of bright, fresh fruit and reimagined classics. premiumcountrypubcollection.co.uk

HUGO SPRITZ

Black Lines has devised a ready mixed Hugo Spritz for summer and it's a refreshing treat with elderflower, citrus and a hint of gin along with lightly sparkling wine. blacklinesdrinks.com

This July and August, The Alchemist Oxford is helping graduates celebrate in style with a complimentary Cosmic Oyster for every guest at the table when booking – a theatrical mini cocktail served in a shell to kick-start the celebrations.

Bero's alcohol-free beers are the best ones we've tasted, and the brand is owned by Tom Holland. We like the Pils best, but the IPA's a close contender. berobrewing.com

SIREN CRAFT BREW

Siren Craft Brew’s flagship Reading town centre bar turned two in May. With 28 lines of incredible beer – from Siren’s own range to an array of guest beers – there's something for everyone at RG1, including a varied wine list and sensational cocktails, as well as soft drinks and Siren's own Sparkling Hopwater. thealchemistbars.com sirencraftbrew.com

Smooth Operator

Copper Rivet's Masthouse Single Malt is Kent distilling at its most ambitious. Naturally sweet and beautifully smooth, with vanilla and to ee on the nose and a nutty, peppery finish. Try it as a highball with green apple and soda, £43. bbr.com

Soak It Up

Bathtub Gin arrives bold, perfumed, and ready for summer. Warmly spiced with juniper, orange peel, and cardamom at its heart, it is as happy in a classic G&T as it is in something more adventurous. Either way, pour generously, £34.

majestic.co.uk

Caribbean Soul

Kromanti's Tamarind Rum is bold, balanced, and botanically infused. Each sip reveals a carnival of zesty tamarind, white pepper and cinnamon. Try it with ginger beer and a squeeze of lime for the summer cocktail you didn't know you needed, £32. masterofmalt.com

season SPIRIT OF THE

Five bottles to pour all summer long

WILD WEST

Zacal's Manso Sahuayo Mezcal is the wildcard your summer needs. Crafted from semi-wild Maguey grown in the highland volcanic soils of Michoacán, it delivers almond sweetness, tangy citrus, and subtle smokiness. Sip over ice or mix with watermelon juice, £67. masterofmalt.com

Liquid Gold

Pleasant Land's Amaretto Liqueur is handcrafted with locally sourced apricots and aged in Léoville Barton red wine casks. Smooth, nutty, and gently fruity. Sip over ice with an orange twist or pour over vanilla ice cream. Summer sorted, £35. thewhiskyexchange.com

Natalia Suta is a WSET-certified wine writer and educator with a knack for making wine accessible and fun. When she is not writing, she’s busy curating wine experiences and offering consultancy to help others discover the joy of wine. Follow Natalia on Instagram @_winerocks_

FASHION Something NEW

BERRY’S JEWELLERS

For effortless summer elegance, the Nouveau Collection from Berry’s Jewellers captures the season’s love of light, movement and understated luxury. Crafted in 18ct yellow or white gold, its graduating diamonds create a striking Art Deco-inspired silhouette that catches the sunlight beautifully. Versatile enough for day or evening wear, this striking collection will add a radiant finishing touch to any summer look. Discover the collection at your nearest Berry’s boutique or at berrysjewellers.co.uk

City and

sea

Hansine’s HS26: Tropica is a refined edit that blurs the line between resortwear and everyday elegance

£140 aspiga.com

victoriabeckhambeauty.com

Pauline Pegasus Homes resident

BEAUTY

NOTES

The latest in luxury makeup and skincare

CITY SKIN

TEOXANE

Teoxane Urban Shield SPF30 is built around urban ageing. It’s triple shield protects from UVA/ UVB rays, pollution and oxidative stress – not just sun damage, but also dullness, pigmentation and barrier stress from city life, £60. teoxane.com

REVIEW

The Longevity test, via the Lucie App

ACTIVE

INGREDIENT

HOTEL, MIKE

We are loving Hotel, Mike’s hydrating hand and body wash with notes of cut grass, spiced pepper, and marine air. The new, female-founded bath and bodycare brand blends highperformance skincare with a playful, modern approach to sustainability, £26. hotelmike.co.uk

GET THE GLOW

BARBARA STURM

The new skincare-infused Everything Bronzing Drops are designed for e ortless, everyday radiance, delivering a natural, sun-kissed bronze while hydrating and smoothing the complexion. Rooted in Dr. Sturm’s science-driven approach to glow, this next-generation bronzing-skincare hybrid perfects, nourishes and illuminates in one step, £125. en.drsturm.com

Are you curious to find out your biological age? Not your chronological age. This is the age your body really thinks it is, as a result of everything you’ve ever done to it. It’s a bit of a daunting prospect, like getting your exam results on a test you forgot to revise for. But happily the process is easy enough, and thanks to the fabulous Lucie App, I am sitting in the comfort of my own home for the duration.

Lucie is a clever app that connects experts in the worlds of beauty, wellness, fitnesss and medicine with clients in London and the Cotswolds. It works with E ect doctors, whose mobile team are here to give me a verdict on my longevity – but first I’m hooked up to an IV drip to boost my vitamin levels, and treated to a small fingerprick test to calculate my iron. The longevity test focuses on breath, creating a metabolic blueprint by assesing my cardio-respiratory fitness and my fat-burning e ciency. This happens through a gas mask-type apparatus that’s strapped tightly to my face for 15 minutes (while the IV is in my arm) and I am told to just relax. Results are almost immediate, and a full report arrives in my inbox outlining my various scores and advice on how to improve them. And my age? I’m going well. Three years down on my actual years. I’ll take that.

EDITOR’S PICK

VICHY Mineral 89 72H Moisture Boosting Daily Fluid SPF50+, £26 sephora.com

GREEN PEOPLE

AUGUSTINUS BADER The Solar Shield SPF50, £120 augustinusbader.com

GREEN PEOPLE

Scent-free facial sun cream, £30 greenpeople.co.uk

SKEYNDOR Age Photo Defence – Daywear Protective Emulsion SPF50, £66.67 skeyndor.uk

MECCA COSMETICA To Save Face SPF50+ Superscreen, £35 meccacosmetica.com

EDITOR’S PICK

SUN SAFE

Scent-free sun cream SPF50+, £30 greenpeople.co.uk Protect yourself with these

NUXE Sun Mist Fresh 30SPF, £27 nuxe.com

GREEN PEOPLE Scent-free sun cream, £33.50 greenpeople.co.uk

BELIF Super Drops hydrating sun serum, £22 harrods.com

BLUE LAGOON Mineral Mask, £80 uk.skinscience.bluelagoon.com

ZO SKIN HEALTH

ZO Sunscreen + Powder Broad Spectrum SPF30, £59 skin65.co.uk

CHITO CARE

Body lotion, £49 chitocare.co.uk

GENTLE CARE

Lip balm, £18 uk.gentle-care.com

BLUE LAGOON BL+ eye serum, £140 uk.skinscience. bluelagoon.com

TEOXANE Urban Shield SPF30, £60 teoxane.co.uk

SKIN SCIENCE

BELIF

Super Drops Sun Serum 50+, £22 harrods.com

ESK Enlighten Gold, £77 eskcare.com

High tech skincare for summer

EDITOR’S PICK

IMAGE SKINCARE Daily Prevention protect and refresh mist, £52 imageskincare.co.uk

IMAGE SKINCARE I Mask hydrating hydrogel sheet mask, £48 imageskincare.co.uk

5 seater hot tubs starting at £5,750, with a range of saunas also available

Hydro Therapy

Proven to aid some suffering with arthritis, rheumatism, diabetes, backache, stress, poor circulation, high blood pressure, cellulite…. more info available on website.

PROTECT AND THRIVE

Enhance your hair's natural texture with Innersense's

Air Dry Styling Cream

Innersense Organic Beauty introduces Air Dry Styling Cream, a lightweight styling essential designed to bring ease, softness and polish to modern hair routines. Developed for all hair textures and patterns, Innersense’s Air Dry Styling Cream supports natural movement while helping hair feel smooth, hydrated and protected in changing environments.

Created with both professional stylists and ingredient conscious consumers in mind, the formula reflects a growing shift toward lower maintenance styling routines that still deliver refined results. Innersense’s Air Dry Styling Cream is designed to enhance the hair’s natural texture rather than reshape it, allowing waves, curls, coils and straight styles to feel e ortless, touchable and intentional.

The multi tasking cream o ers soft hold and lightweight definition while helping to minimise frizz and support long lasting smoothness. Clinically proven to provide 72 hour frizz control, even in humidity, the formula also delivers heat protection up to 230°C alongside defence against UV exposure and environmental stressors. Hair feels protected without heaviness or residue, making it suitable for everyday styling across a variety of techniques and routines.

Innersense’s Air Dry Styling Cream performs whether hair is air dried naturally, di used or styled with heat tools. Stylists can use it to refine texture, smooth the cuticle, refresh second day hair or create polished finishes with flexible hold. The versatility of the formula allows it to move seamlessly between blow dries, natural styling and soft lived in finishes while helping reduce the need for multiple styling products behind the chair.

At the heart of the formula is a blend of clean, hair caring ingredients selected

for both performance and hair wellness. Algin, derived from algae, creates flexible structure while helping to lock in hydration and smooth the hair’s surface. Amino acids help support hair strength and moisture retention while enhancing softness and manageability. Baobab oil, rich in essential fatty acids and vitamins, nourishes the hair and helps improve shine and resilience.

Innersense’s commitment to clean chemistry is reflected throughout the formula. Air Dry Styling Cream is made without silicones, synthetic polymers or heavy film forming ingredients, allowing the product to rinse clean while maintaining a lightweight feel on the hair. The result is smooth, touchable styling support that complements the long term integrity of the hair.

“HAIR FEELS PROTECTED WITHOUT HEAVINESS OR RESIDUE”

The sensory experience is equally intentional. The lightweight cream texture distributes easily through damp or dry hair and leaves styles feeling soft, natural and breathable. A subtle lavender sage fragrance brings a calming element to the styling experience while aligning with the brand’s wellness inspired approach to beauty.

As salon clients continue to seek products that support healthier styling habits and simplified routines, Innersense’s Air Dry Styling Cream o ers a modern approach to everyday styling. Thoughtfully formulated and stylist approved, it delivers flexible performance, clean ingredient credibility and e ortless texture enhancement in one versatile product.

INTERIORS

PLOT LIKE NO OTHER

The story of a collection of three highly individual properties located in a small farm estate close to Little Chalfont

Snells Farm provides a collection of three highly individual family homes located in a small farm estate, tucked away yet conveniently positioned within 0.5 miles from Little Chalfont village centre and station.

Snells Farmhouse is a handsome Grade II listed Georgian farmhouse which has been thoughtfully enlarged and sympathetically restored with enormous care and attention. The result is beautifully balanced period elegance which perfectly suits the demands of modern family life, featuring five bedrooms, seven reception rooms and two bathrooms.

Snells Farm Barn is a classically beautiful, exceptionally well crafted timber clad barn conversion which has been sumptuously restored throughout. The deceptive footprint with in excess of 3,300 sqft of accommodation o ers character and charm whilst providing an extremely versatile layout.

Snells Grange is a brand new Grangeinspired family home set within a generous plot in excess of 1/3 acre. Snells Farm Grange has been meticulously designed to evoke the warm feeling of a character home, whilst providing a contemporary design and finish of the very highest standard. Built with a brick and flint façade incorporating black timber cladding and hand made clay roof tiles, the property is perfectly in keeping with its surroundings, and boasts four bedrooms, two reception rooms and three bathrooms.

“We found a derelict swimming pool in the back garden”

What’s all the more remarkable is all three have been renovated, revamped and redesigned by Anthony and Christina Hawkins. With all three properties now up for sale – to buy altogether, or individually –the two tell Absolutely about a monumental labour of love, little touches that have a big impact, and leaving it all behind.

Q What was it about Snells Farm in 2013 that made you feel it was an opportunity too special to walk away from?

CHRISTINA: When we first saw the farm we were filled with pure excitement. The property had been in a sorry state for many years and we were sure we could inject some real life back into it. But rather than be daunted by the prospect, we knew our previous experience of renovating Grade II listed buildings was such that we could return the farm and its outbuildings to their former glory.

Q When you first arrived, how bad was the condition of the estate?

CHRISTINA: The grounds were overrun

and there were hedges that had grown into monsters – so much so that we found a derelict swimming pool in the back garden that even the estate agents hadn’t discovered. There were copious amounts of well-established weeds and brambles around the buildings and some were even growing in the farmhouse itself! We spent many weekends trying to clear the gardens with a mixture of chainsaws, strimmers and lawn mowers – if only to make them passable for the renovation.

Fortunately we weren’t under any strict deadlines and – whilst there were many pressure points – we were confident we could take on each part of the renovation and get the result we hoped for.

Q You come from a hotel/restaurants and printing/advertising background – how does that influence the way you approach renovating and designing homes?

ANTHONY: The main influence was our approach to project management. In our working lives we both used to plan projects by splitting them into achievable

tasks with set timescales. From this we were able to not only plan the tradesmen needed for each part of the renovation, but also the materials required. Having worked closely with designers to achieve restaurant refurbishments on time and on budget Christina was very good at managing the associated costs.

Q You’ve said you like ‘putting the heart back into older properties’. What does that mean to you in practice?

CHRISTINA: Giving the building some soul, so when you walk in the atmosphere wraps around you without realising it. Replacing roofs, rewiring and plumbing are obviously essential for making a house habitable – but to put the heart back into a building needs careful consideration. Each feature or room needs thorough planning and research prior to carrying out the works. As an example, the exposing of the oak beams, cleaning the clay floor tiles, relining the chimney and replacing the wood fired stove were all elements on the farmhouse inglenook fireplace which restored its rightful position in the heart of the kitchen.

Q Which elements were the hardest to rescue, and which discoveries

were the most rewarding?

ANTHONY: The exposed beams had been given many, many coats of black gloss paint throughout the last 200 years. We set about bringing these back to the original state by using a process which employed dry ice fired at the paint (not sand blasting) in order to remove the layers without damaging the beams. This was a lengthy and costly procedure, but so rewarding when we saw the end result. The leaded windows were also in a very poor state of repair and after a lot of research we set about taking them all out and sending them to a specialist. It was amazing to give them a new lease of life and they now have at least another 100 years ahead of them. Away from the buildings themselves, one of the most rewarding discoveries was the peace and quiet of the farm – especially given it’s only a short walk to the underground station and all the shops and schools in Little Chalfont. The visiting wildlife ranges from roe deer, muntjac deer, foxes and bats to many types of owls and birdlife. We currently have wild mallard ducks on the farmhouse pond who are making good use of the duck house and hospitality!

Q How did you balance preserving the historic character of the farmhouse and barn while still making them work for modern family life?

ANTHONY: We considered how we would like to use the properties and the flow of each room, whilst maintaining good

“A rewarding discovery was the peace and quiet of the farm”

communication with the local historical listed building o cers – who had some good ideas and solutions. We were able to bring in new technologies such as underfloor heating and low energy lighting which will see the properties into the next century.

Q You’ve now lived in all three buildings in di erent forms. How does the personality and atmosphere of each one di er?

CHRISTINA: It’s the decorative aspects – i.e. the paint choices and up-to-date lighting solutions – that allow each property to shine. The farmhouse is the more traditional of the three and has a warm and welcoming atmosphere. There’s a wealth of exposed beams and fireplaces that give it a cosy feel, whilst the contemporary glass extension at the back floods the downstairs with natural light. The barn has a renovated oak timber frame combined with contemporary sleek steel glazing, giving a modern and airy feel. The newly built grange has the most modern feel of all – the design means that each room flows seamlessly into the next and the internal glazing allows each space to be used individually or joined as a whole.

Q What have been your favourite spaces to live in day-to-day across the estate?

ANTHONY: The farmhouse has its own dedicated cinema room which was a huge success for our children when they were growing up – and also for many memorable sports events. The grounds of the farmhouse also have a folly which was great during the pandemic. One side is open to the elements and has a log burner and TV in it, which made it a fantastic place to meet.

The kitchen in the barn meanwhile is based on a famous bar in London’s West End which employs a lot of decorative ribbed glass and a fabulous silver bar – it has been the scene of many great family occasions.

Q After more than a decade transforming the estate, does it finally feel ‘finished’?

ANTHONY: It does finally feel finished. We’ve enjoyed all the time we’ve spent carrying out the renovations, but also the happy times here with family and friends.

Q Do you feel your approach to renovation changed or evolved between the first project and the last?

CHRISTINA: We have become bolder in the design and colour choices, as well as the employment of technology – for example the air source heat pump in the grange or the hard wired Sonos system which is in virtually every room and bathroom in the barn.

Q Which details or design choices are you proudest of because visitors often don’t immediately notice them?

CHRISTINA: One detail is the use of low level lighting in the flooring and skirting boards. They are all on sensors which only come on in the evening when you enter a corridor or bathroom. It is not only aesthetically pleasing, but also energy e cient. You only really notice these when you stay overnight. The four outdoor seating and entertaining spaces around the barn are also not all evident when you first visit – but they create individual areas at di erent times of day and during di erent seasons. The covered seating area to the front is great when you want shade in the summer, but also in the spring and autumn when you need to dodge a rain shower!

Q You’re now leaving to move back to London. How emotional is it to step away from this chapter of your life?

ANTHONY: We have treated the farm well and it has treated us well. We like to think the next owners will enjoy their time just as much as we have. It will of course be sad to leave, but we believe you are only the custodians of a house for a period of time. There’s a new chapter waiting for us. We see it as ‘right sizing’ as opposed to downsizing. Who knows, we may find another period property that needs renovating!

To purchase the whole plot, a guide price of £6,500,000 has been quoted. Individually, The Farmhouse is £2,950,000, The Grange is £1,500,000 and The Barn £1,950,000. For more details, contact Savills Amersham on 01494 725636

SLEEP EASY THIS

summer

How Jensen Beds ensures sleep that makes your day

Jensen Beds has been creating premium beds in Norway since 1947, combining Scandinavian craftsmanship, innovative sleep technology and timeless design to deliver exceptional comfort. Deeply rooted in Norwegian heritage, the brand is known for its dedication to quality, attention to detail and the belief that great sleep is essential to everyday wellbeing – helping you wake up fully rested, every morning.

MADE IN NORWAY

Just outside Oslo, along the shores of the Drammen Fjord, lies the small coastal town of Svelvik – home to Jensen Beds for generations. Here, skilled craftsmanship and a strong design tradition continue to shape every product. Each bed is handmade in Norway using carefully selected materials and advanced comfort technology, ensuring both durability and a refined sleeping experience. Every Jensen bed is backed by a 25-year guarantee against frame or spring breakage, reflecting the brand’s commitment to long-lasting quality.

GET YOUR BEDROOM READY FOR THE SUMMER SEASON

As the warmer months approach, Jensen introduces one of its most innovative sleep technologies: Jensen TempSmart™. Designed to help maintain an optimal sleeping temperature throughout the night, TempSmart™ creates a more balanced and comfortable sleep environment, even during warm summer nights. Jensen TempSmart™ products are sold separately and are an easy and a ordable way to upgrade your sleep experience. If you find yourself tossing and turning during the night, it is often because your body temperature is either too high or too low. The right duvet, pillow and bed linen is therefore important for a good night’s sleep.

NOT TOO HOT, NOT TOO COLD

The advanced temperature-regulating materials of Jensen TempSmart™ absorb, store and release excess body heat when needed, helping to reduce overheating and chilling during sleep. The result is a more stable sleeping climate and improved comfort through the night.

FRIENDLY TO NATURE – AND YOU

Jensen beds are made in Norway using only materials, production methods and suppliers that live up to their highly set expectations. To prove their sincerity they work with leading sustainability labels, such as the Forest Stewardship Council (FSC). It makes us all sleep better.

RE-THINKING AND RE-USING

The planet demands us to be smarter when it comes to the use of resources. And beds are no exception. Working with circular design, Jensen extends the life cycle of their beds and accessories, without compromising their quality. Their aim is always to make beds that stand the test of time, while constantly working to reduce their footprint.

EXPERIENCE JENSEN IN CHELSEA HARBOUR

For those wanting to experience Norwegian sleep comfort first-hand, Jensen Beds can be discovered at the showroom in Chelsea Harbour Design Centre, London. Located among some of the world’s leading interior and design brands, the

Jensen Beds offers a more stable sleeping climate and improved comfort through the night

showroom o ers visitors the opportunity to explore the full collection of Norwegianmade beds, experience the quality of the materials and receive expert guidance in creating the perfect sleep sanctuary.

117 Design Centre South, First Floor Chelsea Harbour, Lots Road, SW10 0XE 020 3914 1262

jensen-beds.com/uk

GOING THE EXTRA

MILE

Exploring a greener way to live in the heart of Berkshire

In a housing market increasingly focused on sustainability, energy e ciency and quality of life, 59 Nine Mile Ride in Finchampstead stands out as a development that successfully brings all three together. With just two homes remaining, this exclusive collection of four detached eco homes o ers buyers the opportunity to enjoy modern countryside living without compromising on environmental responsibility.

Set within the sought-after Berkshire village of Finchampstead, these thoughtfully designed four and five-bedroom homes are nestled amongst mature woodland, creating a peaceful and private setting while remaining close to everyday amenities. Residents benefit from local shops, healthcare facilities, schools and nurseries, while the nearby California Country Park provides over 100 acres

Buyers can enjoy modern countryside living

habitats and hedgehog highways, creating a development that supports local wildlife as well as its residents. Electric vehicle charging points and solar energy generation further reinforce the project’s forwardthinking approach to sustainable living.

of woodland, lakes and walking trails just moments from the doorstep.

What truly sets 59 Nine Mile Ride apart is its commitment to sustainable living. These timber-framed homes have been constructed with advanced insulation and airtight building techniques designed to maximise energy e ciency and reduce running costs. Each property features air source heat pumps, underfloor heating, mechanical ventilation with heat recovery (MVHR) systems and photovoltaic solar panels, helping homeowners reduce their environmental footprint while enjoying year-round comfort. The development is also predicted to achieve an EPC rating of A+, placing it among the most energye cient new homes available in the region.

The eco credentials extend beyond energy performance. Biodiversity has been carefully considered through the inclusion of bat boxes, bat bricks, insect hotels, beetle

Beyond the homes themselves, the surrounding area o ers an enviable lifestyle. Residents can enjoy relaxation at Nirvana Spa, outdoor activities at Horseshoe Lake, and scenic walks across Finchampstead Ridges. The vibrant market town of Wokingham, consistently recognised as one of the UK’s most desirable places to live, is just a short drive away, while Reading, Bracknell and London are all easily accessible via excellent road and rail connections.

For families, the location is equally attractive, with a wide selection of highly regarded schools nearby, including Wellington College and several well-rated primary and preparatory schools.

At a time when buyers are increasingly seeking homes that combine luxury, e ciency and environmental responsibility, 59 Nine Mile Ride delivers on every front. These are not simply houses built for today, but homes designed for a better tomorrow, o ering a rare opportunity to embrace sustainable living in one of Berkshire’s most desirable village settings.

59ninemileride.com

Want a kitchen built for your busy lifestyle ?

When it comes to kitchens, you’ll nd your perfect t at Kutchenhaus.

Designed to suit your home and lifestyle, we offer quality German engineered kitchens in a wide range of traditional and contemporary styles. We’re part of nobilia – Europe’s largest kitchen manufacturer. Which means you can rest assured that with Kutchenhaus, your plans are in the best possible hands.

After all, we are rated ‘Excellent’ on Trustpilot.

So, arrange a free design consultation at our showroom and let us show you the possibilities –creating a bespoke layout at what we’re sure you’ll nd to be a surprisingly affordable price.

Discover yours at Kutchenhaus

Wokingham

7B Elms Walk, Wokingham, RG40 2FE

T: 01183 047 457

BOOK YOUR DESIGN CONSULTATION

CULT FURNITURE

GRAHAM & GREEN

SCHPLENDID

Lombard carver chair, £149 cultfurniture.com

Lionel sofa, from £2,260 schplendid.com EDITOR’S

Yellow Apero pitcher, £42 grahamandgreen.co.uk FERROLUCE

Tata table lamp, £262.71 mohd.it

Summer outdoor stool, £99 peppermillinteriors.com

POOKY

Leela wall light, £100 pooky.com

DAR LIGHTING

Chrissy table lamp, £66 darlighting.co.uk

LOAF
Nestins accent chair, £995 loaf.com COX & COX
rechargeable Luna dome lamp, £20 coxandcox.co.uk
PEUGEOT Appolia baking dishes, from £29.99 peugeot-saveurs.com
LIGNE ROSET Saparella outdoor sofa, from £1,281 ariashop.co.uk

Afterthesuccessfullaunchof59NineMileRidelastyear,JoHe Developmentsareproudtorelease59aand59bNineMileRide,twofive bedroomEcoHomesbuiltbylocalhousebuilder,AndersonContractors Limited.NestledinthepicturesqueBerkshirecountryside,thehomesare withinwalkingdistancetolocalshops,doctor’s,dentist’s,schools,and nurseries,alongwithdirectaccesstothebeautifulCalifornia CountryPark.

Thoughtfullydesignedwithahigh-qualityspecification,eachhome featurespremiumkitchenappliancesandstylishfinishesforaturn-key experience.A10-yearCheckmatewarrantyprovidesaddedpeaceof mindandlastingassurance.

Thisexclusivecollectionofjust15brandnewthreeandfour-bedroomfamilyhomesisembracedbymaturetrees andenjoyspeacefulviewsovertherollingallotmentlandscape.Here,contemporarydesignblendseffortlessly withthewarmthoftraditionalvillagelife,createdaserene,stylishsettingthatfeelsbothconnectedand delightfullysecluded.

CRAFTED to last

A century-old business continues creating handcrafted furniture for iconic locations nationwide, writes the current owner

Inever expected to end up owning a teak furniture business. In fact, it happened almost entirely by accident. Back in 2003, I was simply looking for fencing materials for my farm. I had an old wartime bomb crater in one of my fields that needed securing, and while searching for a wire strainer – or a “monkey strainer” as we call it in the North East – I stumbled across stacks of beautiful teak timber. Curiosity got the better of me. One conversation led to another, and before I knew it, I had met the managing director and bought the company.

It’s a decision my wife has never quite forgiven me for. Then again, this was the same household that unexpectedly acquired four Hereford cows one afternoon, so perhaps she wasn’t entirely surprised.

The business itself has a much longer history. Founded in 1923 as F. Peart & Son, it has remained proudly based in Hartlepool for more than a century. When I took over, I threw myself into creating a future for the company, investing in websites, exhibitions and trade shows, from Gardeners’ World to SALTEX and Leisure Industry Week. Looking back, I probably spent far too much money trying

Sustainability has always mattered to me

to work out how to get where I wanted to be, but I’ve never lost sight of the goal.

Today, we continue to craft handmade outdoor furniture from our Hartlepool workshop, using only the finest teak, oak, iroko and British sweet chestnut. Sustainability has always mattered to me. Timber is one of the world’s most beautiful natural materials, and I believe it deserves to be treated with respect. Fortunately, our craftsmen share that same passion.

Over the years, our furniture has found homes in some remarkable places. We’ve worked with organisations including the National Trust and supplied benches and seating for iconic parks and gardens across the UK and beyond. Our pieces can be found in botanic gardens, golf clubs and public spaces from London to the Channel Islands, as well as in France and Germany. We’ve even created commemorative benches marking historic moments, including the signing of Magna Carta in St Albans, alongside tributes to figures such as Charles Darwin in Bristol Botanic Garden. For me, though, the greatest satisfaction comes from knowing that every piece begins the same way: with skilled hands, exceptional timber and a family business that still proudly calls Hartlepool home.

To find out more about Teak Garden Furniture, call 01429 890808 or visit teakgardenfurniture.co.uk

EDUCATION

PREPARED FOR

Learning FOR FUN

Worried about keeping the children busy over the summer? Here are the spots where the days will fly by – and keep the little ones’ brains ticking over

Summer holidays are often a balancing act for parents. Keeping children entertained for six weeks is challenging enough, but many families also like the idea of days out that o er something more than rides, soft play and ice cream. Fortunately, Berkshire and Buckinghamshire are home to a wealth of attractions where children can have fun while discovering history, science, nature and culture along the way. One of the most fascinating places to begin is the Living Rainforest near Newbury. Home to hundreds of tropical plants and exotic animals, it recreates the conditions of some of the world’s most important rainforest environments under glass. As children wander through the humid pathways, they can encounter colourful birds, reptiles, butterflies and free-roaming mammals while learning about ecosystems, biodiversity and conservation. Educational displays explain the importance of rainforests to the planet, making it an experience that combines adventure with environmental awareness. Not far away, the Nature Discovery Centre at Thatcham o ers a completely di erent kind of learning experience. Set beside a large lake and nature reserve, it encourages children to engage directly with the natural world. Families can follow wildlife trails, take part in seasonal activities and visit interactive exhibits that explain local habitats and species. During the summer months there are often opportunities to spot dragonflies, butterflies and water birds, helping

youngsters develop a greater appreciation for British wildlife without ever feeling like they are sitting in a classroom.

For children fascinated by transport and engineering, Didcot Railway Centre provides an absorbing day out. Although technically just across the county boundary in Oxfordshire, it is easily reached and remains a favourite with local families. The site preserves the golden age of the Great Western Railway and allows visitors to explore restored steam locomotives, signal boxes and historic carriages.

History becomes far more engaging when children can experience it first hand, which is why Highclere Castle is such a rewarding destination. Known to many as the setting for the television drama Downton Abbey, the estate also contains centuries of fascinating history. Younger visitors can learn about Victorian life, aristocratic households and the remarkable story of the fifth Earl of Carnarvon, who helped discover the tomb of Tutankhamun. The extensive grounds provide

Children are encouraged to experiment, test ideas and learn plenty through play

space to explore, while exhibitions connected to ancient Egypt often prove particularly popular with curious young minds.

In Buckinghamshire, Bletchley Park o ers one of the most important educational experiences in the region. This former wartime codebreaking centre played a crucial role during the Second World War and is where mathematicians, linguists and engineers worked to decipher enemy communications. Children can discover the origins of modern computing, learn about secret intelligence operations and try their hand at puzzles and codebreaking activities. The site presents complex historical events in a wonderfully accessible way.

Another excellent destination is the Buckinghamshire Railway Centre at Quainton. Combining history, engineering and handson exploration, it allows children to climb aboard historic trains, inspect restored locomotives and learn how railways shaped everyday life. The museum’s interactive approach helps bring the past alive, while special events throughout the summer often include demonstrations, miniature railways and family activities designed specifically for younger audiences.

For a more scientific experience, the Look Out Discovery Centre in Bracknell remains

a hidden gem for many families. The centre features dozens of interactive exhibits covering subjects such as physics, engineering, light, sound and the natural world. Rather than reading information panels, children are encouraged to experiment, test ideas and learn through play. Whether launching objects, investigating forces or solving puzzles, they gain a practical understanding of scientific concepts while having enormous fun.

Animal lovers, meanwhile, will find plenty to enjoy at Odds Farm Park near Beaconsfield. Although often viewed primarily as a family attraction, it also provides valuable opportunities for children to learn about farming, animal care and food production. Meeting farm animals, watching demonstrations and discovering how farms operate helps youngsters understand where food comes from and the role agriculture continues to play in everyday life.

These experiences prove that education does not need to stop when school finishes for the summer. In fact, some of the most memorable lessons are learned while wandering through a country park, stepping aboard a historic train or uncovering secrets from the past. Across both counties, families will find countless opportunities to entertain, inspire and educate in equal measure.

DIDCOT RAILWAY
THE BEE SHOW AT ODDS FARM PARK
HIGHCLERE CASTLE

Your Place IS HERE

Discover how Claires Court’s unique educational pathway shapes confident young people, now backed by a secure and ambitious future

Sthe Nursery School to the Juniors site this September. This purposeful move provides a safe, seamless foundation class experience where the youngest early learners can play, grow, and naturally transition into fulltime schooling alongside Junior pupils.

At Claires Court, they treat every child as an individual, purposefully stretching their capabilities and supporting their personal wellbeing. To further recognise regional talent and reward high potential, competitive scholarships providing up to 50% fee remission are now actively available across major transition points in Years 3, 5, 7, and 12.

et across three vibrant sites in Maidenhead, Claires Court is an allthrough independent school built around strong values. Their ‘Diamond Model’ of education provides a proven, tailored blend of academic focus and social growth. Boys and girls start their journey co-educationally in Nursery and Juniors, separate into single-sex environments for their crucial Senior School years and come back together for a fully co-educational Sixth Form. The benefits of a co-educational community are never lost, as pupils routinely mix for shared day trips, arts events, and socials beyond the classroom. This year brings major milestones that reinforce Claires Court’s commitment to educational excellence. Following their integration into the LTC Education Group in February, Claires Court enters a stable, secure, and well-resourced future. This strong backing allows them to continually invest in pupils' learning environments – most notably through the upcoming relocation of

Life here extends far beyond the traditional classroom walls with Maidenhead as their campus. Claires Court o ers a diverse co-curricular programme of music, drama, outdoor learning, and a strong sporting pedigree. They pair inclusive participation with elite athletic pathways. Their Henleywinning rowing programme, integrated from Year 8 with Maidenhead Boat Club, o ers premier Thames-side coaching, while their rugby pathway thrives via partnership with Bath Rugby Club. From competitive arenas to creative clubs and field trips, pupils build lifelong resilience, teamwork, and leadership.

Whether your child is taking their very first steps in early years or preparing to springboard into higher education and future careers, Claires Court o ers the ultimate environment to thrive. The best way to truly appreciate the warm, supportive community is to see it in action.

Book your private tour or register for upcoming Open Events at clairescourt.com

EDUCATION NEWS

The latest from schools across the county

Green fingers

Students in the Pre-Prep at St George’s School Windsor Castle demonstrated their love of nature last month, winning the prestigious Ken Mackintosh Shield at the Royal Windsor Flower Show. Awarded to the school gaining the highest number of points across two school gardening challenges, the shield aims to inspire and educate children in all aspects of horticulture. Thanks to the efforts of the students during an a erschool club led by Teaching Assistant Jayne Robbens, St George’s won first place in the Rooted in Nature Wheelbarrow Challenge in addition to second place in the Peter Seabrook Great Potato Challenge. In addition to success in the competition classes, the school were also present at the show for the third year running, hosting the St George’s School Windsor Castle Wellbeing Tipi. Throughout the day, teachers from St George’s led free nature and wellbeing-inspired workshops, inviting the show’s youngest guests to try mindful activities such as sewing, beading, clay modelling and steel tongue drumming. stgwindsor.org

Head start

Alice Fletcher is the new Head of Heatherton School, starting in the role back in April. With experience in several Prep Schools, including international postings in Dubai and Australia, Alice’s expertise will retain the warm atmosphere and vibrant academic culture that make Heatherton such a special place to be. With personal experience learning in an all-girls environment, Alice’s vision for Heatherton’s single-sex educational future is robust and rooted in the desire to bring every girl the confidence and skills to flourish.

“I am a strong believer in all-girls education,” Alice says, “and I very much felt a strong fit with Heatherton as soon as I walked in, as a school with so much going on inside. I think girls flourish in

Design standards

The 2026 RIBA South Awards have been announced and one of the winning projects was a new 70-bed co-educational sixth-form boarding house for Berkshire’s Wellington College. Woodland Quad was designed for a clearing within a pine woodland, previously considered a “back-of-house” area of the school estate, which is now anything but. They are a masterclass in connecting with their surroundings, offering students and selected teachers the rare experience of living in spaces that feel part of a forest. The plan, elevational composition, elegant brick detailing, and woodland setting recall the Finnish master architect Alvar Aalto. Internally, the architects have created spaces that are homely and welcoming, o en fun, and never institutional. All enjoy fantastic daylighting, thanks to a variety of generously sized windows. Boys’ and girls’ accommodation are provided separately in each of the two wings. wellingtoncollege.org.uk

an environment where they are free to be themselves, and at Heatherton, the girls are confident to do well because they are known, heard and understood. The Berkhamsted Schools Group have got such a strong reputation, and I’m excited to be a part of that: to have that support, expertise and resources and to be part of something bigger.” berkhamsted.com/heatherton

The Windsor Brasserie

A new culinary destination has opened at Fairmont Windsor Park

Fairmont Windsor Park has unveiled its most exciting new dining concept to date:

The Windsor Brasserie, a contemporary restaurant and bar set within one of the UK’s most luxurious countryside hotels. Positioned at the heart of the five-star estate and surrounded by 40 acres of landscaped parkland bordering Windsor Great Park, the new opening promises to bring a fresh energy to the region’s dining scene.

Designed as a modern European brasserie with a strong sense of theatre, The Windsor Brasserie combines ingredient-led cooking with bold flavours, live-fire techniques and engaging tableside experiences. At its centre is an open kitchen showcasing a charcoal robata grill, while a raw bar provides an elegant introduction to the menu. Diners can also expect classic dishes finished tableside, including steak tartare, alongside a roaming dessert trolley that adds a touch of old-school glamour to the experience.

Leading the culinary vision is Executive Head Chef Siddhharth Krishna, whose approach blends traditional brasserie foundations with contemporary creativity. “The idea was to create a modern brasserie, steeped in tradition, but more expressive in its execution,” he explains. “We have combined open fire cooking alongside an ingredientled approach. It’s all about taking something familiar and making it unexpected.”

That philosophy is evident throughout the menu. Highlights include aged beef cured with koji, which introduces a deep umami character balanced by pickled elderflower and horseradish. Elsewhere, hand-dived scallops are transformed into a playful scallop carbonara, featuring cured egg yolk, pecorino and black pepper. Vegetables

fairmont-windsorpark.com why everyone is talking about…

receive equal attention, with dishes such as salt-baked celeriac served with tru e whey demonstrating the kitchen’s thoughtful and technically accomplished approach.

Beyond the food, The Windsor Brasserie is designed as a social destination. A central bar anchors the space, o ering an extensive Champagne list alongside premium whiskies and a sophisticated cocktail programme. The atmosphere is intended to evolve throughout the day, from leisurely lunches and celebratory dinners to late-evening drinks.

The opening further strengthens Fairmont Windsor Park’s reputation as a leading food and beverage destination. Guests can combine a meal with a stay in the hotel’s recently launched treehouse suites, experience the acclaimed spa and wellness facilities, or visit the only Macallan tasting room outside Scotland. The Windsor Brasserie looks set to become one of the most talkedabout restaurant openings of the year.

Turn static files into dynamic content formats.

Create a flipbook
Absolutely Buckinghamshire July 2026 by ABSOLUTELY Magazines - Issuu