
THURSDAY 18TH SEPTEMBER 2025
The Jockey Club would like to thank our Group Partners for their support in 2025
















![]()

THURSDAY 18TH SEPTEMBER 2025
The Jockey Club would like to thank our Group Partners for their support in 2025
















Race Conditions can be found at the end of this racecard
CHAIRMAN
Richard Fuller
COMMITTEE
Simon Burgoyne, Fred Dashwood, Hayley Moore, Rishi Persad, Simon Tufnell, Mary Plowden, Eva Mariscotti
GENERAL MANAGER
Simon Durrant
ASSISTANT GENERAL MANAGER
Beverley Frith
OWNERS &TRAINERS LIAISON
Mimi Ashworth
CLERK OFTHE COURSE & REGIONAL HEAD OF RACING
Brian Clifford – 07880 784484
HEAD GROUNDSMAN
Steve Gudge - 07778 813826
STEWARDS
Thomas Evetts (Chief Steward)
William Barlow (Stewards’ Panel Chair)
Milly Bersey, Margaret Groves, Fergus Sweeney
STARTERS
Robert Supple
Sam Avis
JUDGE
Emily Jones
CLERK OF THE SCALES
Robert Cuthbert
VETERINARY OFFICER
Amy Hawthorn
VETERINARY SURGEONS
Simon Knapp, C.V.O., B.Sc., B.Vet.Med., M.R.C.V.S.
Clive Hamblin, B.Vet.Med., M.R.C.V.S.
Jamie Knapp, B.V.S.C., M.R.C.V.S.
Alfie Ireland, B.V.S.C., M.R.C.V.S.
Andrew Hamilton, M.V.B, Cert.A.V.P. (ESO) (EL), M.R.C.V.S.
Martin Watson, C.V.O., B.V.M.S., M.R.C.V.S.
Alex Weller BSc(Hons), BVetMed M.R.C.V.S.
MEDICAL OFFICERS
Dr Lucy Free, Dr Rob Cullen
Dr Peter Johnson, Dr Mark Gorvin
Dr Graeme Robertson, Dr Amy Lambert, Dr Rizwan Ghani, Dr Ramy Saker, Dr John Heathcock, Dr Linsey Whitley
EQUINE WELFARE
AND INTEGRITY OFFICERS
Peter Double, Darren Stone, Christine Hannaford, Vince McKevitt
COMMENTATOR
John Hunt
BETTING RING MANAGER
Andrew Boardley
DESIGNATED SAFEGUARDING LEAD
Simon Durrant
DEPUTY SAFEGUARDING LEADS
Brian Clifford, Beverley Frith
2 KALPANA (GB) (50) 121231 3 8-10 (7)
B f Study of Man (IRE) - Zero Gravity P. J. McDonald
Juddmonte Andrew Balding, Kingsclere
Juddmonte Farms Ltd Juddmonte Farms Inc
12 13 14
TIMEFORM VIEW Having been unraced at 2 yrs, made it 3 wins from 6 starts this year with a ready success in 5-runner Listed race at Hamilton (11.1f,goodtofirm,5/6)50daysagoby41/2lengthsfromGod’sWindow.Capableofbetterstillasshegoesbackupintrip
Aquick wayto see a horse’s past performance.These are its recent finishing positions.
Look out for Letters:
C = Has won at this course
D = Has won over this distance
CD = Has won over this distance at this course
BF = Was a beaten favourite
MORE INFORMATION ON THE FORM
- = New racing season
/ = Missed racing season
P = Was pulled-up and didn’t finish the race
F = Horse fell
U = Rider unseated
R = Horse refused to race
CO = The horse was forced out of a race by a loose horse
B = Horse was brought down
S = Horse slipped
r = The horse ran around a jump or took the wrong course in a flat race
d = Disqualified
Bold form
figures = performance in allweather (Flat) or Pointto-Point (Jump) races
Select your horse. Note their name and saddlecloth number
Choose your bet. ‘To win’ or ‘each-way’ are popular types of bet.
‘To win’ is for your horse to come first.
‘Each-way’ is for your horse to come first or to be placed. It’s two bets, so ‘£2 each-way’ = £4 total bet.
How the experts rate the horse’s chances:
2. BHA rating = the higher the number, the better the horse.
3. Timeform view and TFR rating
Look out for the summary of leading course trainers before each race
5. JOCKEYS
Listen out for any jockeys who are having a successful day.
OTHER USEFUL DETAILS
6. Owner’s colours worn by the Jockey
7. Saddlecloth number
8. Horse’s name
9. Days since the horse last run
10. Horse’s age
11. Jockey’s weight (stone and Ibs)
12. The horse’s breeding – father (sire) and mother (dam)
13. Horse’s owner
14. Horse’s breeder
15. Birthplace of horse (outside GB)
16. Draw – position of the horse in the starting stalls
Decide the amount – or stake – you are comfortable to bet.
Place your bet. There are different places to bet on course; The Tote, racecourse bookmakers, betting shop or online. Each option offers a different experience.
Collect. Once ‘Weighed-in’ has been announced, present your betting slip and collect any winnings.


















THE UNIBET ZERO% MISSION/ BRITISH STALLION STUDS EBF
NOVICE STAKES (CLASS 4) (GBB RACE)
for novice two yrs old x Total prize fund £11000
Owners Prize Money 1st £4694, 2nd £2346, 3rd £1174, 4th £586. (PenaltyValue £5940)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): A Balding (96 wins from 600 runners, 16%) runs HEADING TRAINER-IN-FORM (LAST 14 DAYS): A Balding (13 wins from 68 runners, 19%) runs HEADING LONGESTTRAVELLERS:LUXAETERNAtrained byK PDe Foy, LORDBRITAINtrained byI Mohammed, MRKEBLEtrained by J &TGosden, LEONEALATOtrained byCAppleby, BASEDtrained by WKnight, WARDLAWtrained bySirM Prescott, DOUBLEEAGLEtrained byG Boughey, WISETANCKtrained byLSouza, all Newmarket, 85 miles.
1 LORD BRITAIN (GB) (29) 51 CD
Br B c Universal (IRE) - Time To Strike (IRE)



Tommie Jakes (5) J
O Mr Abdulla Al Mansoori Ismail Mohammed, Newmarket T
B Rabbah Bloodstock Limited Dubai Racing Club S TIMEFORMVIEWTwice-racedwinnerWon9-runnernoviceatthisC&D(33/1)29daysago,wellpositioned.Thatformlooks prettymodestandhe’sprobablyworthtakingonunderapenalty
2 BASED (IRE) (-) 9-4 (1)
Br B c Oasis Dream - La Dorotea (IRE) Hollie Doyle J
O Mr Abdulla Al Mansoori William Knight, Newmarket T
B Deerfield Farm
TIMEFORMVIEWFoaledFebruary3.65,000gnsyearling,OasisDreamcolt.Closelyrelatedtousefulwinnerupto11/4mWithoutRevenge andhalf-brotherto3winners,includinguseful6fwinnerSoDarnHot Onetonoteinthebetting.
3 DOUBLE EAGLE (IRE) (22) 55
(10)
Br B c Dark Angel (IRE) - Golden Line (IRE) Jack Doughty J
O Teme Valley George Boughey, Newmarket T
B Niall Kelly & P.J. Malone George Boughey Racing Ltd, Star Sports Bet S
TIMEFORMVIEWTwice-raced maiden. Fifth of11 in novice (15/2) atthis course (8f) 22 days ago. Probablymore one for handicapsinduecourse.
4 HEADING (USA) (-)
TFRHHIII BHA-
9-4 (8)
Br B c Starspangledbanner (AUS) - Celtic Sea (SAF) Oisin Murphy J
O Gainesway Ventures Sc
B Gainesway Thoroughbreds Ltd
Andrew Balding, Kingsclere T
TIMEFORMVIEWFoaledMarch11.Starspangledbannercolt.Dam5f-1mwinner(multipleGrade1winnerinSouthAfrica). Noteworthynewcomerfromaleadingyardandthebettingwillbeinformative.
5 LEONE ALATO (GB) (21) 34 BF
Br B c St Mark’s Basilica (FR) - Love Is You (IRE)
TFRHHHII BHA-
9-4 (6)
William Buick J
O Godolphin Charlie Appleby, Newmarket T
B Godolphin Emirates Fly Better S TIMEFORMVIEWTwice-racedmaiden.Fourthof13inmaidenatNewbury(6.5f,goodtofirm,6/4)21daysago.Wellworth anotherchanceinviewofNewmarketdebutpromise. TFRHHHHI BHA-
6 LUX AETERNA (GB) (-)
Br B c Sergei Prokofiev (CAN) - Sassy Dresser
O Amo Racing Limited
B Chasemore Farm
(5)
David Egan J
Kevin Philippart de Foy, Newmarket T
Sports Invest UK Ltd, KPF Racing Ltd S TIMEFORMVIEWFoaledJanuary20.90,000gnsyearling.Half-brotherto6fwinnerRegalGem.Damunracedoutofusefulwinner upto7f(includingat2yrs)TheGoldCheongsam(stayed1m).Interestingtoseewhatthemarkethastosay. TFRHHHII BHA-
7 MR KEBLE (GB) (20) 0
Br B c Too Darn Hot - The Black Princess (FR)
O Mr R. J. H. Geffen
B Mr R. J. H. Geffen
9-4 (3)
Tyler Heard J
John & Thady Gosden, Newmarket T
Tote S TIMEFORMVIEWOnce-racedmaiden.Lastof10inmaidenatSandown(7f,soft,11/1)ondebut20daysago.Ingoodhands andcanbeexpectedtoleavethatformwellbehind. TFRHHHII BHA-
8 SENOR CAMPANARO (IRE) (19) 04
Br B c Palace Pier - Axana (GER)
O Laurence Bellman, Phil Booth & Woodhurst
B Kildaragh Stud & Silver Sands B/Stck
9-4 (4)
George Downing J
Ed Walker, Upper Lambourn T
Tote S TIMEFORMVIEWTwice-racedmaiden.22/1,fourthof7innoviceatChester(7.6f,firm)19daysago,slowlyaway.Needsto raisehisgame. TFRHHIII BHA-
Br B c Kingman - Nimble Thimble (USA)
9-4 (2)
Sean Levey J
O Juddmonte Harry Charlton, Beckhampton T
B Juddmonte Farms Ltd Juddmonte Farms Inc S
TIMEFORM VIEW Once-raced maiden. 9/1, last of 10 in novice at Newbury (7f, good to firm) on debut 33 days ago Thiswell-bredcoltissurelycapableofbetter,butitcouldbethathe’smoreofalong-termprospect. TFRHHIII BHA-
0
9-4 (7)
Br B c Oasis Dream - Madame Tantzy Rhys Clutterbuck J
O Mrs R. F. Johnson Houghton Eve Johnson Houghton, Blewbury T
B Mrs R. F. Johnson Houghton ABM Catering Limited S
TIMEFORM VIEW Once-raced maiden. Last of 11 in novice (10/1) at Salisbury (6f, good) on debut 36 days ago, veryslowlyaway.Otherspreferred. TFRHIIII BHA-
Br B c Liam’s Map (USA) - Woodfin (USA)
9-4 (11)
Luke Morris J
O Mr Ian Banwell Sir Mark Prescott Bt, Newmarket T
B St George Farm LLC
TIMEFORM VIEW Foaled February 19 Liam’s Map colt. Dam, US 9f winner, half-sister to US winner up to 1 1/2m (includingGrade3)ClosingRangeoutofuseful2-y-o6fwinnerSubeen.Entitledtocomeonfortherun. TFRHIIII BHA-
12 WEDONTTELLLIES (IRE) (15) 03
Br Ch c No Nay Never (USA) - Single (FR)
9-4 (12)
Finley Marsh J
O Mr A. Whelan Richard Hughes, Upper Lambourn T
B Lynch Bages & Camas Park Stud
TIMEFORMVIEWPromising type.Third of11 in novice atthis course (6f, 11/2) 15 days ago, faring best ofthose held up Shouldhavemoretoofferandneedsconsideringbackupto7f
Br B c Kodi Bear (IRE) - Chisana
9-4 (14)
Darragh Keenan J
O Mr Lee Yuk Lun Alan Lemos De Souza, Newmarket T
B Awbeg Stud Unlimited Class1Personnel S
TIMEFORMVIEWFoaledApril18.€42,000foal,£43,000yearling,€55,0002-y-o,KodiBearcolt.Half-brotherto7fwinnerMatharu. Damtwice-racedhalf-sistertoverysmart6f-1mwinnerSayif Likelytocomeonfortherun.
Br B f Palace Pier - Prance (IRE)
HIIII BHA-
8-13 (13)
Nicola Currie J
O Mr K. Doyle Ollie Sangster, Marlborough T
B Newbyth Stud
TIMEFORM VIEW Once-raced maiden. Seventh of 9 in maiden (28/1) at Wolverhampton (7.2f) on debut 16 days ago, slowlyaway.Anotherwhomaybeseeninabetterlightinhandicapslateron.
TFRHHIII BHA-
DECLARED RUNNERS 14 2024: CONSOLIDATION 2 9 7 Hector Crouch 4-5 (Ralph Beckett) 13 ran Tongue Strap worn by No 1.
Stewards Note:
STATION BAR: Following its run on 13/8/2025 it was reported that the horse was slowly away
PRANCY PEER: Following its run on 2/9/2025 it was reported that the horse suffered interference early-on.
Probable S.P’s: 11-4 Leone Alato (GB), 4-1 Wedonttelllies (IRE), 8-1 Heading (USA), 11-1 Lord Britain (GB), 12-1 Lux Aeterna (GB), 14-1 Mr Keble (GB), 16-1 Based (IRE), 22-1 Double Eagle (IRE), 28-1 Slight of Foot (GB), 33-1 Prancy Peer (GB), 40-1 Senor Campanaro (IRE), Wardlaw (USA), 50-1 Wisetanck (IRE), 66-1 Station Bar (GB)
ItwasastrongNewburynoviceinwhichWEDONTTELLLIESfinisheddownthefieldondebutlastmonth and he duly stepped up on that when third in an 11-runner contest here recently, leaving the strong impression that there is better to come. The No Nay Never colt gets the nod ahead of Godolphin’s Leone Alato, who was safely held last time but remains of interest given the promise of his Newmarket debut third. Heading could be the pick ofthe newcomers ahead of Based and Lux Aeterna.










for three yrs old and upwards, x Total prize fund £6000
Owners Prize Money 1st £2477, 2nd £1239, 3rd £619, 4th £310, 5th £155. (PenaltyValue £3140.40)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): T Carroll
(21 wins from 393 runners, 5%) runs MASTER MILAN
TRAINER-IN-FORM (LAST 14 DAYS): T Carroll (5 wins from 40 runners, 12%) runs MASTER MILAN
LONGESTTRAVELLER: REIGNMAN trained by D Loughnane, Tern Hill, 166 miles.


1 VALKYRJA (GB) (107) 6/05-60 4 9-9 (2)
Br B f Night of Thunder (IRE) - Chili Dip Fred Daly (7) J
O Mr F. Michael Matt Crawley, Newmarket T
B Mr A. Parker & New England Stud Satinsilk Ltd S
TIMEFORM VIEW Lightly-raced maiden. 13/2, eighth of 10 in handicap at Wolverhampton (8.6f), having run of race Off107daysandshecouldhaveaparttoplayhereoffa3lblowermark.
2 REIGNMAN (GB) (9) 006360 4 9-6 (11)
Br B g Massaat (IRE) - Flirtinaskirt Hollie Doyle J
O Mr Philip Wilkins & Partner David Loughnane, Tern Hill T
B Philip Wilkins Dave Loughnane Racing S
TIMEFORMVIEWCheekpieces on for1sttime, last of7 in handicap (12/1) at Ffos Las (10f, heavy) 9 days ago. Claims judged on handicapdebutthirdhereinJuly,butwhetherhe’llbeabletoreproducethatformremainstobeseen. TFRHHIII BHA52(-2)
3 D DAY MAJOR WINTER (GB) (37) 002020 3 9-4 (6)
Br B g Ulysses (IRE) - Where I Be
David Egan J
O Mr D. A. Olver Ross Burdon, Newmarket T
B Mr C. A. Cyzer RB Racing Syndicate, Kwiff - Spryme Ltd S
TIMEFORMVIEWEighthof10inhandicapatLingfield(10f,goodtofirm,5/1)37daysago.Wellheldbothpreviousstartson theAWandhopespinnedonthefirst-timehoodmakingthedifferencehere. TFRHHHII BHA54
4 VILLALOBOS (IRE) (48) 023045 CD 6 9-4 (5)
Br B g Footstepsinthesand - Swift Acclaim (IRE) Finley Marsh J
O Mr P T Newell
Simon Hodgson, Hook T
B Mrs Alison Lewis TIMEFORMVIEWC&Dwinner.10/1,fifthof8inhandicapatBath(10.2f,goodtofirm)48daysago.Backdownintripand blinkerson1sttime.Meritsconsideration.
TFRHHHII BHA50
5 PRIMA DIVA (GB) (23) 005166 D 3 9-2 (7)
Br B f Bated Breath - Merry Diva Olivia Tubb (5) J
O Fillies First
Jonathan Portman, Upper Lambourn T
B Jeremy Green and Sons Pump Technology Limited S TIMEFORMVIEWWinneratWindsorinJune.33/1,sixthof9inhandicapatLingfield(8f,AW)23daysago.Othersmake moreappealforwinpurposes.
6 MISTER KNOCKOUT (GB) (15) 340-650
Br B g Rumble Inthejungle (IRE) - Drawing
O Mr S Gardiner
9-2 (8)
Millie Wonnacott (5) J
Gary Brown, Swindon T
B Norman Court Stud TIMEFORMVIEW40/1 andtongue strap on for1sttime, first run since leaving David Evanswhen last of10 in handicap atLingfield(12f,AW)15daysago Significantlybackdownintripandhe’sreadilypassedover. TFRHIIII BHA52
7 ALYARA (GB) (7) 000020 D 7 9-1 (1)
Br Br m Cable Bay (IRE) - Norway Cross Tyler Heard J
O Lynn Cullimore Pete Ponting Joe Ponting Joe Ponting, Wotton-Under-Edge T
B Bartisan Racing Ltd
TIMEFORM VIEW Thirteen runs since last win in 2024. Last of 13 in handicap at Chelmsford City (7f, 28/1) 7 days ago. Goodsecondatthesamecourseonpenultimatestartandshe’sinwithashout.
8 REEL POWER (GB) (45) 030-000 D
9-0 (10)
Br B g Highland Reel (IRE) - Ensaya (IRE) Paddy Bradley J
O Mick Wright and Partners
B Richard Milner (Shropshire) Ltd
Paddy Butler, Lewes T
TIMEFORMVIEW200/1,lastof7inhandicapatLingfield(8f,AW)45daysagoandit’seasyenoughtolookelsewhere.
9 ISLAND OCEAN (GB) (15) 0-603
Br B f Zoustar (AUS) - Fire Orchid Luke Morris J
O Mr Donald M. Kerr Heather Main, Wantage T
B Overbury Stallions & Conduit Farm Stud Tote S
TIMEFORMVIEW14/1andcheekpiecesonfor1sttime,fifthof7inhandicapatthiscourse(7f)15daysago Wastoolitupintheheadgear onthatoccasionandshewillhaveaseriouschanceifabletogetbackontrackwithoutthecheekpieces. TFRHHHHH BHA49
10 MASTER MILAN (GB) (21) 00-00P 3 8-11 (4)
Br Ch g Universal (IRE) - Harlequin Girl Jack Doughty J
O J Tomkins & H Williams Tony Carroll, Cropthorne T
B Cranford Bloodstock UK Ltd racehorse-ownership.com S
TIMEFORMVIEWLightly-racedmaiden.PulledupinminoreventatChelmsfordCity(10f,80/1)21daysago,possiblyamiss. Hardtofancy. TFRHIIII BHA47
11 EAGER PUCCINI (GB) (99) 00-000 3 8-10 (3)
Br B g Bated Breath - Madame Butterfly (IRE)
Darragh Keenan J
O Chris Page & partners Julia & Shelley Birkett, Newmarket T
B Mr Mohammed Musaad Alsalem Birkett Racing S
TIMEFORM VIEW Lightly-raced maiden. 11/2 and cheekpieces on for 1st time, tenth of 11 in minor event at Yarmouth (8f,good)whenlastseeninJune.Opposable.
12 DOCTOR DAUILA (IRE) (20) 020056
Br Gr f Dream Ahead (USA) - Slope
O Pierce Gerard Molony
3 8-10 (12)
Josephine Gordon J
David Evans, Abergavenny T
B Pierce Molony Emma Evans Racing Ltd S TIMEFORM VIEW 17/2, sixth of 8 in minor event at Ffos Las (8f, soft) 20 days ago, doing too much too soon. Placepossibilities.
DECLARED RUNNERS 12
44
2024: NO CORRESPONDING RACE LASTYEAR
Hood worn first time by No 3. Blinkers worn first time by No 4. Sheepskin Cheek Pieces worn first time by No 1. Blinkers worn by No 7. Visor worn by No 8, 12. Sheepskin Cheek Pieces worn by No 2, 10
Stewards Note:
MISTER KNOCKOUT: Following its run on 3/9/2025 it was reported that the horse was never travelling.
MASTER MILAN: Following its run on 28/8/2025 it was reported that the horse stopped quickly
Probable S.P’s: 9-2 Villalobos (IRE), 5-1 Island Ocean (GB), 13-2 D Day Major Winter (GB), 7-1 Valkyrja (GB), 8-1 Alyara (GB), 11-1 Doctor Dauila (IRE), 12-1 Prima Diva (GB), 14-1 Reignman (GB), 16-1 Eager Puccini (GB), 50-1 Mister Knockout (GB), 150-1 Reel Power (GB), 200-1 Master Milan (GB)
The cheekpieces experiment failed to work for ISLAND OCEAN here recently, but there’s a good chance that she’ll get back on track now eased in class/the weights with the headgear omitted. Valkyrja, who sports first-time cheekpieces herself, will be a threat if she puts her best foot forward, while Villalobos, another sporting headgear for the first time, is third choice ahead of Alyara and D Day Major Winter.




for three yrs old and upwards x Total prize fund £6000
Owners Prize Money 1st £2477, 2nd £1239, 3rd £619, 4th £310, 5th £155. (PenaltyValue £3140.40)Weights raised 1lb and paragraphs 27to 31 ofthe Weights and Handicapping Code compliedwithwhere applicable.
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): J Butler (42 wins from 465 runners, 9%) runs ENCIRCLE TRAINER-IN-FORM (LAST 14 DAYS): T Carroll (5 wins from 40 runners, 12%) runs KENTO
WEIGHTWATCHER: KENTO won off a handicap mark of 54, his rating is now down 6lb to 48.
LONGESTTRAVELLER: JUSTCALLMETREVA trained by J Evans, Kinnersley, 151 miles.


1 NIGHTARC (GB) (190) 000-052 D 6 9-9 (8)
Br B g Twilight Son - Gymnaste (IRE) Paddy Bradley J
O Mr B. R. Johnson Brett Johnson, Epsom T
B Cheveley Park Stud Limited
TIMEFORMVIEWThirteenrunssincelastwinin2023.Creditablesecondof12inhandicap(13/2)atWolverhampton(8.6f), nomatchforwinner Off6months(geldedintheinterim)andhe’sastrongeach-waycandidate
2 ENCIRCLE (IRE) (7) 600050 4 9-7 (11)
Br B f Ten Sovereigns (IRE) - Turning Top (IRE)
Sean Levey J
O Mr Abdullateef Al Zeer John Butler, Newmarket T
B Chelston Ireland TIMEFORMVIEWBit belowform eighth of13 in handicap at Chelmsford City(7f, 15/2) 7 days ago, nevernearer. Oneto considernowmovingbackupintrip
3 ENGLISH LADY (IRE) (23) 060403
3 9-5 (4)
Br B f Inns of Court (IRE) - English Queen Jefferson Smith J
O Radlett Racing
B McCracken Farms
Dean Ivory, Radlett T
Dean Ivory Racing Ltd S TIMEFORMVIEW10/1andhoodedfor1sttime,creditablethirdof11inhandicapatLingfield(8f,AW)23daysago.Expected tobebangthereoffa1lblowermark. TFRHHHHI BHA54
4 KENTO (GB) (19) 000330
Br Gr g Kuroshio (AUS) - Jillolini
4 9-3 (5)
Jack Doughty J
O LPOG 22 Tony Carroll, Cropthorne T
B D. R. Botterill & E. Boumans racehorse-ownership.com S TIMEFORMVIEWOnewinfrom21Flatruns.20/1,respectableeighthof14inminoreventatLingfield(7f,AW)19daysago. Otherslookstronger TFRHHIII BHA48
5 TOBY’S TIME (IRE) (12) 05-0200
3 9-3 (10)
Br B g Coulsty (IRE) - Sharp Applause (IRE) Joe Leavy J
O M J Refrigeration Transport Ltd Mark Loughnane, Kidderminster T
B David Byrne
TIMEFORMVIEWLast of11 in handicap (9/1) atWolverhampton (8.6f) 12 days ago, not ideally placed.Tongue strap on 1sttimeandpossibilitiesjudgedonhisimprovedsecondattheaforementionedcourseinJuly TFRHHHII BHA52
6 AL SHABAB (FR) (14) 000403 4 9-2 (1)
Br B g Saxon Warrior (JPN) - Pink Paint (FR)
O Nick Shutts & Partner
Josephine Gordon J
David Evans, Abergavenny T
B Woodslane Farm LLC Emma Evans Racing Ltd S
TIMEFORM VIEW Remains a maiden after 24 Flat runs. Creditable third of 13 in handicap (13/2) at Southwell (8.1f) 14daysago Repeatofthatwouldputhiminthepicture. TFRHHHII BHA47
7 MY BOY HARRY (GB) (7) 345503 3 9-1 (6)
Br B g Massaat (IRE) - Malmostosa Luke Morris J
O Mr R. A. Popely Jim & Suzi Best, Lewes T
B Hever Stud Farm Ltd
TIMEFORMVIEWCreditable third of13 in handicap at Chelmsford City (7f, 6/1) 7 days ago, running on. Promises to be suitedbythisstepuptoamileandhe’sakeyplayer.
8 AIM FOR THE BULL (IRE) (16) 244342
Br Ch g Showcasing - Ultimate Aim
TFRHHHII BHA50(-1)
3 9-0 (9)
Rob Hornby J
O Ms Denise Tibbett Mike Murphy, Westoning T
B David John Brown & Whistbury Manor Stud
TIMEFORMVIEW5/2 andvisored for1sttime, creditable second of6 in handicap at Chepstow(7.1f, heavy) 16 days ago. Likelytogiveanothergoodaccount.
TFRHHHII BHA49
9 REBEL COVE (IRE) (15) 433056
Br B f Ribchester (IRE) - Siren’s Cove
4 9-0 (2)
Finley Marsh J
O Mr C. E. Weare Simon Hodgson, Hook T
B Ballinvana House Stud
TIMEFORM VIEW 12/1, sixth of 8 in handicap at Bath (11.6f, heavy) 15 days ago Significantly back down in trip and cheekpiecesbackon.Vulnerableforwinpurposes. TFRHHIII BHA43
10 POKE THE BEAR (IRE) (338) 050606- 3 8-11 (7)
Br B g Eqtidaar (IRE) - Anaakeed
Aidan Keeley J
O Miss Hayley Burton Hayley Burton, Newmarket T
B Oristown Stud Tote S
TIMEFORMVIEW12/1,sixthof7innurseryatYarmouth(7f,soft),slowlyaway Off11monthsaheadofthisstabledebutand it’sprobablybesttolookelsewhere. TFRHIIII BHA46
11 JUSTCALLMETREVA (GB) (72) 00-00 3 8-10 (3)
Br B f Music Master - Di Matteo Rose Dawes (5) J
O Peter Clarke Racing Partners
B Mr Graham Anstiss
James Evans, Kinnersley T
The Little Jet Company Ltd S TIMEFORMVIEWLightly-racedmaiden.40/1,ninthof10inhandicapatLingfield(9f,good)72daysago Hardtowarmto TFRHIIII BHA43
3 8-10 (12)
Br B f Land Force (IRE) - Fille de Reve Rhys Clutterbuck J
O Mrs Daphne Finch Rachel Cook & John Bridger, Liphook T
B Danny Fantom Racing Tote S TIMEFORMVIEWLightly-raced maiden.Thirteenth of14 in minorevent at Lingfield (7f,AW, 150/1) 19 days ago Big step forwardneededonthishandicapdebut. TFRHIIII BHA33
DECLARED RUNNERS 12 2024: (See Div 1)
Tongue Strap worn first time by No 5. Hood worn by No 3. Visor worn by No 4, 8. Tongue Strap worn by No 6. Sheepskin Cheek Pieces worn by No 9. Running for the first time since Gelding No 1. Running for the first time since Wind Surgery No 10 Stewards Note:
ENCIRCLE: Following its run on 11/9/2025 it was reported that the horse anticipated the start.
Probable S.P’s: 4-1 Aim ForThe Bull (IRE), 9-2 My Boy Harry (GB), 11-2 English Lady (IRE), 6-1 Al Shabab (FR), 7-1 Night Arc (GB), 11-1 Encircle (IRE), 12-1 Toby’s Time (IRE), 22-1 Rebel Cove (IRE), 28-1 Kento (GB), 66-1 Poke The Bear (IRE), 100-1 Justcallmetreva (GB), 300-1 Keith’s Star (GB)
The vote goes to ENCIRCLE, who lost all chance at the start at Chelmsford last week and is better judged on a fairly encouraging debut fifth for this yard at the same course in August. English Lady has to be feared on the back of a creditable effort in the first-time hood (retained) at Lingfield, while Al Shabab and My Boy Harry are others to consider


5)
for three yrs old x Total prize fund £8000
Owners Prize Money 1st £3303, 2nd £1652, 3rd £826, 4th £413, 5th £206. (PenaltyValue £4187.20)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): J Butler
(42 wins from 465 runners, 9%) runs FINAL NIGHT TRAINER-IN-FORM (LAST 14 DAYS): S & E Crisford (5 wins from 30 runners, 17%) runs KNICKERBOCKER LONGESTTRAVELLER: GOODNIGHT IRENE trained by D Loughnane, Tern Hill, 166 miles.



1 AL WASEELA (IRE) (117) 161-4
Br B f Siyouni (FR) - You’re Back (USA)
Sean Dylan Bowen J
O Mr Ziad A. Galadari Ollie Sangster, Marlborough T
B Rabbah Bloodstock Limited
TIMEFORMVIEWLatestwin at Nottingham inApril. 11/10, sixth of9 in handicap atWindsor(8.1f, good)when last seen inMay.Cheekpiecesbackonandshewillbeaseriousplayerifabletogetbackontrack.
2 KNICKERBOCKER (FR) (112) 0-20 9-9 (5)
Br B f Le Havre (IRE) - Lady Katanga
Josephine Gordon J
O Rabbah Racing Simon & Ed Crisford, Newmarket T
B Mr Ecurie De Cachene
TIMEFORMVIEWThrice-racedmaiden.17/2,tenthof11inmaidenatLingfield(10f,AW),faltering.Off112daysaheadofthis handicapdebutandstepforwardneeded.
3 SAYTARR (GB) (2) 20-3215 9-9 (3)
Br B g Mehmas (IRE) - Baarrij (IRE) James Doyle J
O T.A.C Partners Charlie Fellowes, Newmarket T
B Godolphin Fitzdares S
TIMEFORMVIEWWinner at Lingfield in August. 5/1, respectable fifth of 12 in handicap at Yarmouth (7f, good to soft) 2daysago Notsurethatthisstepuptoamilewillbeinhisfavour
4 FROSTMAGIC (IRE) (14) 213055 9-8 (4)
Br B g Frosted (USA) - Magical Crown (USA)
Tommie Jakes (5) J
O Mr Abdulla Al Mansoori Ismail Mohammed, Newmarket T
B Rabbah Bloodstock Limited Dubai Racing Club S
TIMEFORMVIEWLatestwinatSouthwellinJune.Visoredfor1sttime,goodfifthof11inhandicap(18/1)atSouthwell(8.1f) 14daysago Blinkerson1sttimeandnotwithouteach-wayhope.
TFRHHHII BHA69
5 DOVEY MOON (GB) (24) 451541 D 9-8 (6)
Br B g Massaat (IRE) - Song To The Moon (IRE)
Fred Daly (7) J
O Mr R. Kent David Evans, Abergavenny T
B Mickley Stud & Mr Tony Jones Emma Evans Racing Ltd S TIMEFORMVIEWCareerbestwhenwinning15-runnerhandicap(11/1)atChepstow(8.1f,good)24daysago.5lbrisemay notbeenoughtostophim.
TFRHHHHI BHA69
6 GREY PHOENIX (IRE) (120) 4-444 9-7 (9)
Br Gr f Phoenix of Spain (IRE) - Syann (IRE)
Hollie Doyle J
O Foxtrot Racing Grey Phoenix Dr Richard Newland & Jamie Insole, Droitwich T
B Lynn Lodge Stud Foxtrot Racing Syndicates S TIMEFORMVIEWLightly-racedmaiden.Fourthof5innoviceatBrighton(8f,good,8/1)inMay.Absentsince,butmarkfor thishandicapdebutlooksfairandshe’sonetoconsider
7 OPENING BAT (GB) (24) 0-41333 CD
TFRHHHII BHA68
(1)
Br Ch g Bated Breath - Ronaldsay Oisin Murphy J
O Mrs R J McCreery and Mr Richard Craddock Harry Charlton, Beckhampton T
B Stowell Hill Partners & David Ludlow Tattersalls S
TIMEFORMVIEWC&Dwinner.WinnerhereinMay.Creditablethirdof9inhandicap(7/2)atSouthwell(7.1f)24daysago, faringbestofthoseheldup Cheekpieceson1sttimeandhehastoentercalculations.
8
Br B g Calyx - Fern (IRE)
BHA68
Finley Marsh J
O Mr Eamon Kelly Richard Hughes, Upper Lambourn T
B Ms Alice Fitzgerald
Agetur (UK) Ltd S TIMEFORMVIEWC&Dwinner.Lastof8inhandicap(40/1)atFfosLas(6f,good)44daysago.Significantlybackupintrip andothersarrivehereinbetterform.
9 GOODNIGHT IRENE (IRE) (323) 050- 8-13 (2)
Br B f No Nay Never (USA) - Step Sequence
O Lets Be Lucky Partnership
B Lynch Bages Ltd
Laura Pearson J
David Loughnane, Tern Hill T
Dave Loughnane Racing S
TIMEFORMVIEWThrice-racedmaiden.Ninthof11innovice(50/1)atthiscourse(7f).Off10monthsaheadofthishandicap/ yarddebutandsignificantstepforwardneeded.
TFRHIIII BHA60
10 FINAL NIGHT (GB) (23) 000024 BF 8-13 (8)
Br B g Muhaarar - Night Lily (IRE)
O Mr K. Snell
B Mr K. Snell
Sean Levey J
John Butler, Newmarket T
TIMEFORM VIEW 9/4, respectable fourth of 9 in handicap at Lingfield (8f, AW) 23 days ago Looks vulnerable for winpurposes. TFRHHIII BHA60
DECLARED RUNNERS 10
2024: NO CORRESPONDING RACE LASTYEAR Blinkers worn first time by No 4. Sheepskin Cheek Pieces worn first time by No. 7. Hood worn by No 6. Sheepskin Cheek Pieces worn by No 1. Stewards Note:
ALWASEELA: Following its run on 24/5/2025 it was reported that the trainer could not explain the poor run.
FINAL NIGHT: Following its run on 26/8/2025 it was reported that the horse reared and was slowly away.
Probable S.P’s: 4-1 Opening Bat (GB), 9-2 Al Waseela (IRE), Dovey Moon (GB), 15-2 Saytarr (GB), 10-1 Grey Phoenix (IRE), 12-1 Frostmagic (IRE), Final Night (GB), 14-1 Knickerbocker (FR), 40-1 Spirit Lead Me (IRE), 50-1 Goodnight Irene (IRE)
Though disappointingwhen last seen atWindsorin May,ALWASEELAhadtaken a step forward when scoring at Nottingham a month earlier and it would be no surprise to see her get back on track following a break. Dovey Moon improved when notching his second success at Chepstow last time and will be a threat if reproducing that form back on the all-weather Opening Bat is also high on the shortlist, while handicap debutante Grey Phoenix needs a second look, too.















































for novice two yrs old x Total prize fund £30000
Owners Prize Money 1st £12189, 2nd £6096, 3rd £3048, 4th £1524, 5th £762. (PenaltyValue £15462)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): A Balding (96 wins from 600 runners, 16%) runs ALLEGRESSE TRAINER-IN-FORM (LAST 14 DAYS): A Balding (13 wins from 68 runners, 19%) runs ALLEGRESSE LONGESTTRAVELLERS: HE’S WALIIM trained by J Tate & HENRY LAWSON trained by C Appleby, both Newmarket, 85 miles.
1 HE’S WALIIM (GB) (19) 16
Br B c Too Darn Hot - Phiz (GER)


James Doyle J
O Mr Jaber Abdullah James Tate, Newmarket T
B Minster Stud
TIMEFORMVIEWTooDarnHotcoltwhocreatedagoodimpressionwhena6-lengthwinneronhisBeverleydebut(7.5f,goodtofirm)lastmonth. WeakenedoutofitonsoftgroundintheSolarioStakes3weeksagobutwellworthanotherchancebackdowninclass. TFRHHHHI BHA89
2 ALLEGRESSE (GB) (30) (4lb) 21 CD 9-6 (3)
Br B c Oasis Dream - A Legacy Oisin Murphy J
O Mick and Janice Mariscotti Andrew Balding, Kingsclere T
B Miss K. Rausing Kingsclere Stud S
TIMEFORMVIEW36,000gnsyearling,OasisDreamcolt.Dammaidenhalf-sistertoverysmartwinnerupto14.5fEldarEldarovoutofsmart11/4m/11f winnerAllAtSea.ConfirmeddebutpromisewheneasilylandedtheoddsinC&Dnoviceandlooksausefulprospect. TFRHHHHH BHA3 HENRY LAWSON (IRE) (42) 3
9-4 (5)
Br Ch g Australia - Poetic Charm William Buick J
O Godolphin Charlie Appleby, Newmarket T
B Godolphin Emirates Fly Better S TIMEFORMVIEWAustraliagelding.Half-brothertouseful2-y-o7f/1mwinnerMusicalAct.15/2,shapedlikeastayerwhenclose thirdof4inmaidenatSandown(8f,good)ondebut42daysago Maywelldobetterandnottakenlightly TFRHHHHI BHA-
4 KINGOFTHECARNIVAL (FR) (-) 9-4 (2)
Br B c Victor Ludorum - Do It In Rio (FR) Hollie Doyle J
O Primavera Archie Watson, Upper Lambourn T
B Mr W. Neumann, Earl Haras Du Logis & Mr Archie Watson Racing Ltd S TIMEFORMVIEWFoaledFebruary2.€40,000yearling,€85,0002-y-o,VictorLudorumcolt.Half-brothertoFrench2-y-o9fwinnerStefLeMagnifique. Dam5f/6fwinner(includingat2yrs)inGermany,AustriaandFrance.Needstobeaboveaveragetomakeawinningdebutinthis. TFRHHIII BHA-
5 MISS PRETTY (GB) (38) (6lb) 1 C 8-13 (1)
5 MISS 8-13
Br B f Masar (IRE) - Lamorna J
O In The Mix Racing Edward Smyth-Osbourne, Upper Lambourn T
B Elaine Chivers Elaine Chivers Consultancy Services Ltd S
TIMEFORMVIEWMasarfilly.Dammaidenoutoflightly-racedhalf-sisterto2000GuineaswinnerFootstepsinthesand.9/1,won12-runnermaiden atthiscourse(7f)ondebut38daysago,cominghomewellonceshegotthehangofthings.Willstayandshouldimprove TFRHHHII BHA-
DECLARED RUNNERS 5 2024: AVIATION TIME (IRE) 2 9 3 George Rooke 4-6 (Richard Hughes) 9 ran
Probable S.P’s: 13-8 Allegresse (GB), 3-1 He’s Waliim (GB), 7-2 Henry Lawson (IRE), 16-1 Kingofthecarnival (FR)
ALLEGRESSE looked useful when forging clear over C&D last month and is the one to beat on these terms. It’s easy to forgive He’s Waliim’s effort in the Solario so he’s well worth another chance, while Henry Lawson showed plenty in a Sandown maiden with a good history

The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.
The Great British Bonus (GBB) offers multiple bonuses of up to £20,000 per eligible race for
fillies and mares.


5f (2yo) Glamorous Spirit (IRE) (28/11/2008)
5f A Momentofmadness (07/04/2018)
6f (2yo) Invincible Army (IRE) (09/09/2017)
6f Trinityelitedotcom (IRE) (29/03/2014)
7f (2yo) Elsaakb (USA) (08/11/2017)
7f Sirius Prospect (USA) (20/11/2014)
1m (2yo) Queen Gamrah (30/10/2019)
1m Western Aristocrat (USA) (15/09/2011)
1m 2f Ply (25/09/2017)
1m 3f Forbidden Plant (30/03/2019)
1m 4f Spring of Fame (USA) (07/11/2012)
2m Colour Vision (FR) (02/05/2012)
FILLIES’ NOVICE STAKES (CLASS 4) (GBB RACE)
for novice two yrs old fillies x Total prize fund £11000
Owners Prize Money 1st £4694, 2nd £2346, 3rd £1174, 4th £586. (PenaltyValue £5940)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): C Appleby (81 wins from 240 runners, 34%) runs VALDORCIA TRAINER-IN-FORM (LAST 14 DAYS): G Scott (5 wins from 32 runners, 16%) runs MOONLIGHT MIRAGE LONGESTTRAVELLER: BLEANNE trained by S Hodgson, Hook, 133 miles.



1 MOONLIGHT MIRAGE (GB) (12) 41
Br B f Acclamation - Concessions
Darragh Keenan J
O Victorious Forever George Scott, Newmarket T
B Victorious Racing Limited George Scott Racing, Oliver St Lawrence Bloodstock Limited S TIMEFORM VIEW Stepped up on debut to win 8-runner novice at Wolverhampton (5.1f) 12 days ago Open to furtherprogress.
2 BAREFOOT BEACH (IRE) (-)
Br B f Kodi Bear (IRE) - Sunset Dream (IRE)
Sean Levey J
O Ian Wight and Partner Richard Hannon, Marlborough T
B Rathbarry Stud Tote S
TIMEFORMVIEWFoaledFebruary20.£38,000yearling,KodiBearfilly.Sisterto9fwinnerKilleaneyBearandhalf-sisterto 2-y-o7fwinnerNightcliff Dam,7f/1mwinner,half-sistertouseful6fwinnerFlashGordon. TFRHHHII BHA-
3 BESSIE WALLIS (IRE) (21) 0 9-2 (1)
Br B f Starspangledbanner (AUS) - Royal Dynasty David Egan J
O Quantum Leap Racing XIII
David Menuisier, Pulborough T
B Equispirit Shinco Racing Limited S
TIMEFORM VIEW £70,000 yearling, Starspangledbanner filly. Dam 5f-7f winner. Eighth of 11 in maiden at Newbury (6f,goodtofirm,28/1)ondebut21daysago TFRHIIII BHA-
4 BINTOLA (GB) (21) 6 9-2 (10)
Br B f Sea The Stars (IRE) - Best Terms Oisin Murphy J
O Salhia Stud Limited
B W. & R. Barnett Ltd
Harry Charlton, Beckhampton T
TIMEFORMVIEWSeaTheStarsfilly.625,000gnsyearling.Sistertousefulwinnersupto11/2mStarTerms(2-y-o7fwinner)andRainbowSky(2-y-o1mwinner) andhalf-sistertoseveralwinners.Hooded,sixthof11inmaidenatNewbury(25/1)ondebut21daysago Shouldprogress. TFRHHHII BHA-
5 BLEANNE (GB) (-)
Br B f Sergei Prokofiev (CAN) - Barnezet (GR)
9-2 (3)
Finley Marsh J
O Mr Robin Blunt Simon Hodgson, Hook T
B Robin Blunt
TIMEFORMVIEWFoaledFebruary17.SergeiProkofievfilly.Half-sistertoseveralwinners,includinguseful2-y-o6fwinner Rajarand2-y-o6fwinnerAjrar Dam5fwinner TFRHIIII
6 HEATED MOMENT (GB) (21) 50
Br B f Too Darn Hot - Shada (IRE)
-
9-2 (9)
Nicola Currie J
O Lord Lloyd Webber,A Rosen & B V Sangster Ollie Sangster, Marlborough T
B Saeed Al Qassimi Tote S
TIMEFORMVIEWShowedplentytoworkonwhenfifthof10inmaidenatNewburybutdisappointedinsimilareventover thistripthere3weeksago TFRHHIII BHA-
7 KHAFAR (IRE) (21) 2
Br B f Dubawi (IRE) - Alandalos
(2)
James Doyle J
O Shadwell Estate Company Ltd Charles Hills, Lambourn T
B Shadwell Estate Company Limited
TIMEFORMVIEWDubawifilly.Dam,1mwinnerwhostayed11/4m,sistertoverysmartwinnerupto1mMutasaabeqoutof1000GuineasandCoronationStakes winnerGhanaati.12/1,secondof11inmaidenatNewbury(6f,goodtofirm)ondebut21daysago,runningon.Shouldhavemoretooffer
BHA-
8 MARIE OF LORRAINE (GB) (-) 9-2 (7)
Br B f Earthlight (IRE) - Anna of Lorraine Joe Leavy J
O Cheveley Park Stud Clive Cox, Hungerford T
B Cheveley Park Stud Limited Cheveley Park Stud Limited S TIMEFORMVIEWFoaledFebruary25.Earthlightfilly.Half-sistertouseful6fwinnerDiligently.Dam,6fwinner,half-sisterto verysmartwinnerupto1mAudienceoutofuseful6f-7fwinnerLadyship
BHA-
Br B f Coulsty (IRE) - Laurel Wreath
O Valmont
9-2 (4)
Rob Hornby J
Clive Cox, Hungerford T
B Diomed Bloodstock Ltd Clive Cox Racing Limited S TIMEFORMVIEW42,000gnsyearling,Coulstyfilly Half-sisterto2-y-o6fwinnerPriapos.Dam,5.7f/6fwinner,half-sistertosmartmultiple5f winnerGlobalApplause.Fifthof11inmaiden(15/2)atNewbury(6f,goodtofirm)ondebut21daysago.Likelytoimprove. TFRHHHII BHA-
Br B f Oasis Dream - Vercelli
O Godolphin
9-2 (8)
William Buick J
Charlie Appleby, Newmarket T
B Godolphin Emirates Fly Better S TIMEFORMVIEWFoaledMarch8.OasisDreamfillyHalf-sisterto7fwinnerVerseofLove Damonce-racedhalf-sistertohigh-class9.5f/11/4mwinner (inFrance/Australia)Aviliusoutofusefulwinnerupto11/2m(2-y-o1mwinner)Alessandria.Highlyrespectedondebut. TFRHHHHI BHA-
DECLARED RUNNERS 10 2024: MAGICALTRAIL 2 9 9 William Buick 4-9 (Charlie Appleby) 8 ran Hood worn by No 4.
Stewards Note:
BINTOLA: Following its run on 28/8/2025 it was reported that the horse was slowly away HEATED MOMENT: Following its run on 28/8/2025 it was reported that the horse hung left-handed.
Probable S.P’s: 7-2 Valdorcia (IRE), 4-1 Moonlight Mirage (GB), Khafar (IRE), 15-2 Running Hot (IRE), 10-1 Barefoot Beach (IRE), 16-1 Bintola (GB), Marie of Lorraine (GB), 33-1 Heated Moment (GB), 50-1 Bessie Wallis (IRE), 150-1 Bleanne (GB)
KHAFAR was beaten only by a useful prospect when starting out in a Newbury maiden 3 weeks ago and the 7lb she receives from penalised winner Moonlight Mirage may prove decisive. Valdorcia is another to consider for a stable with an excellent record with newcomers.

The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.
The Great British Bonus (GBB) offers multiple bonuses of up to £20,000 per eligible race for British-bred fillies and mares.

Find out more about today’s race sponsor at unibet.co.uk
The team at Kempton recognise how important you are to our business
Our Customer Promise is that we are committed to delivering the best experience we can for you by:
Being welcoming and friendly
Treating you with respect
Being flexible to your needs
Being committed to consistently delivering quality & value
Providing clear and relevant information in a timely and appropriate manner
Encouraging and valuing your feedback to help us improve your experience
All we ask is that if you feel like we haven’t delivered on this promise or would like to offer us any feedback on your experience, please do let us know by emailing us at: London.CustomerRelations@thejockeyclub.co.uk









































































for three yrs old and upwards x Total prize fund £8000
Owners Prize Money 1st £3303, 2nd £1652, 3rd £826, 4th £413, 5th £206. (PenaltyValue £4187.20)Weights raised 1lb and paragraphs 27to 31 ofthe Weights and Handicapping Code compliedwithwhere applicable.
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): E Walker
(36 wins from 263 runners, 14%) runs NAVALANCHE TRAINER-IN-FORM (LAST 14 DAYS): E Walker
(7 wins from 42 runners, 17%) runs NAVALANCHE LONGESTTRAVELLER: SEE THE GREEN trained by S Hosie, Sherborne, 115 miles.



1 CAPONE (GER) (43) 30-2P63 D
(6)
Br Br g Nathaniel (IRE) - Codera (GER) Ben Ffrench Davis (5) J
O Maximum Racing and D ffrench Davis Dominic Ffrench Davis, Lambourn T
B Stiftung Gestut Fahrhof High View Racing Ltd S
TIMEFORMVIEWNecksecondinsimilareventatthisC&DinMay.Thirdof6inhandicapatthisC&D(28/1)43daysago,ranbetter thanforawhilebutwasoutpacedearlyinstraightbeforepluggingon.Lookscapableofgoingclose.
2 SEE THE GREEN (GB) (56) 106-506 4 9-10 (3)
Br B g Postponed (IRE) - Clarentine Tyrese Cameron (7) J
O See The Green Partners Syd Hosie, Sherborne T
B Bluehills Racing Ltd
TIMEFORMVIEWFairformontheFlatandsimilarleveloverhurdles,notdisgracedinthatsphere13daysago.
3 ST MAWES (IRE) (22) 63-405 3 9-8 (7)
Br B g Wootton Bassett - Fallen Lady (IRE) Oisin Murphy J
O Mr Julian Reed Emma Lavelle, Marlborough T
B Westerberg Hatherden Horse Transport S
TIMEFORMVIEWLightly-racedgeldingwhofinishedfifthof6inhandicapatKemptonPark(18/1)22daysagoinfirst-timevisor, slowlyintostrideandoutpaced.Stepupintripforthisassignmentwhichmaysuit. TFRHHHII BHA70
4 ROGUE EMPIRE (GB) (14) 0-463 3 9-2 (8)
Br B g Time Test - Magic Meg (IRE) Finley Marsh J
O The Idle B’S Roger Teal, Lambourn T
B The Magic Meg Partnership racehorse-ownership.com S TIMEFORM VIEW Very much had the run of the race up in trip when third of 7 on handicap debut at Lingfield (12/1) 14daysago,settingslowpaceandkeepingonafterheaded2fout.Needstoconfirmthatform. TFRHHHII BHA64
5 SYDNEY SEABREEZE (FR) (15) 520040 4 9-0 (1)
Br B g Cloth of Stars (IRE) - Nicole (FR) Hollie Doyle J
O Mrs C. Campbell S. P. C. Woods, Newmarket T
B S.C.E.A. Haras Du Hoguenet et al Brook Stud Bloodstock Ltd S TIMEFORMVIEWBetteronAW,including2ndof9atLingfieldover16f.Lastof8inhandicapatBath(14f)onsoftturf(18/1) 15daysago,runningpoorlywithhood.ReturnstopreferredAWsurfacewithhoodremoved. TFRHHHHI BHA53
6 NAVALANCHE (GB) (20) 50-6400 3 8-13 (4)
Br B g Nathaniel (IRE) - Sauvalanche
O Thurloe Thoroughbreds LV
George Downing J
Ed Walker, Upper Lambourn T
B Beswick Brothers Bloodstock Osborne Studio Gallery S TIMEFORMVIEWShapedasthoughwouldbesuitedbylongertripswhen4thatHaydockinMaybutfinished12thof13in handicapatSalisbury(9/1)20daysago,takingkeenholdandmakingnoimpression.Upintripagain. TFRHHHII BHA61
7 WARRIOR KING (IRE) (36) 0650 3 8-12 (9)
Br B g Saxon Warrior (JPN) - Saadatt Sean Levey J
O O.T.I. Racing, Paul Inglett & Partner Harry Charlton, Beckhampton T
B Jim Bradley Tattersalls S TIMEFORMVIEWModest form in novice races before finishing last of 7 in handicap at Ffos Las (5/1) 36 days ago with cheekpieces.ReturnstoAWwithcheekpiecesremovedandtriessignificantstepupintrip TFRHHHII BHA60
8 BEDFORD (GB) (100) 003 3 8-8 (5)
Br Ch g Earthlight (IRE) - Masarah (IRE) Luke Morris J
O Mr J. Law Alan King, Barbury Castle T
B Rabbah Bloodstock Limited Goodwin Racing Ltd S TIMEFORM VIEW Shown limited ability in three starts, last beaten 21 1/2 lengths when third of 3 at Salisbury (33/1) 100daysago Makeshandicapdebutafterwindsurgery TFRHHHII BHA56
9 WITCH HAZEL (GB) (17) 4600
Br Ch f Masar (IRE) - Brogan Jack Doughty J
O Chasemore Farm Jim Boyle, Epsom T
B Chasemore Farm Chasemore Farm LLP S
TIMEFORMVIEWModestAWmaidenformandfarednobetterwhenninthof10inhandicapdebutonturfatWindsor(11f) at18/117daysago.Significantstepupintripcouldsuitbetter.
DECLARED RUNNERS 9
TFRHHHII BHA56(-1)
2024: NO CORRESPONDING RACE LASTYEAR
Hood worn by No 8. Visor worn by No 2, 3. Sheepskin Cheek Pieces worn by No 5.
Running for the first time since Wind Surgery No 8.
Probable S.P’s: 11-2 St Mawes (IRE), Rogue Empire (GB), 6-1 Capone (GER), Warrior King (IRE), 15-2 Navalanche (GB), 11-1 Sydney Seabreeze (FR), Bedford (GB), 12-1 See The Green (GB), Witch Hazel (GB)
CAPONE looks well placed to go close having finished a neck second in a similar event at this C&D in May and took a step back in the right direction when third here 6weeksago SydneySeabreezereturnstohispreferredAWsurfaceafterdisappointing on turf, while Rogue Empire showed promise when third on handicap debut but needs to confirm that form.
TIMEFORM PREDICTION: 1.CAPONE (GER) 2.SYDNEY SEABREEZE (FR) 3.ROGUE EMPIRE








for three yrs old and upwards x Total prize fund £8000
Owners Prize Money 1st £3303, 2nd £1652, 3rd £826, 4th £413, 5th £206. (PenaltyValue £4187.20)
LEADING COURSE TRAINER (20-25): J Butler (42 wins from 465 runners, 9%) runs SOLANNA TRAINER-IN-FORM (LAST 14 DAYS): T Carroll (5 wins from 40 runners, 12%) runs UPEPO
WEIGHTWATCHER: THREE YORKSHIREMEN won off a handicap mark of 65, his rating is now down 8lb to 57 LONGESTTRAVELLER: UPEPO trained by T Carroll, Cropthorne, 120 miles.



1 ROYAL PLEASURE (IRE) (15) 620201 7 10-2 (12)
Br B g Kingman - Merry Jaunt (USA) Luke Morris J
O Mr A. Fordham Karen Jewell, Sittingbourne T
B Floors Farming, Whitley & Newbyth Studs
TIMEFORM VIEW Finished second in 9f and 8f handicaps, habitually dwells at start. First of 9 in handicap at Lingfield (10f,AW)(6/1)15daysago,overcameslowstarttoquickeninsidefinalfurlong.Notonetotrust. TFRHHHHI BHA
2 FIHRAYN (IRE) (15) 563215
(7)
Br B g Waldgeist - Lady Livius (IRE) Paddy Bradley J
O Inside Track Racing Club Jim Boyle, Epsom T
B Ballylinch Stud Jim Boyle Racing S
TIMEFORM VIEW Won at Chelmsford City (10f) 28 days ago. Fifth of 9 in handicap at Lingfield Park (10f) at 11/2 15 days ago, runningcreditablydespiteariseinweights.Handlesthiscoursewellandlookscapableofbeinginthemixagain. TFRHHHHI BHA68
3 SOLANNA (GB) (15) 022236 CD
6 10-1 (9)
Br Ch g Helmet (AUS) - Night Lily (IRE) David Egan J
O Mr K. Snell John Butler, Newmarket T
B Mr K. Snell
TIMEFORMVIEWConsistentontheAWwithmultiplerunner-upfinishesbetweenMarchandJune.Sixthof9inahandicapatLingfield(6/1)15daysago, mighthavefinishedcloserwithmoreroom.ProvencoursespecialistatKemptonwithpreviouswinsoverthisC&D. TFRHHHHI BHA68
4 NAHY (FR) (15) 6-430
Br B g Lope de Vega (IRE) - Tesoro (IRE)
O D Lovatt & C Bacon
4 10-1 (1)
Josephine Gordon J
Jack Morland, Newmarket T
B James Wigan Junction 17 Prestige S
TIMEFORMVIEWShowed some promise in novice company over C&D but was last of 7 in handicap at Lingfield (25/1) 15daysagoafterstablechange.Hoodremoved. TFRHHIII BHA68
5 UPEPO (IRE) (15) 313200
Br Gr or Ro g Roaring Lion (USA) - Kanes Pass (IRE)
5 10-0 (11)
Molly Gunn (5) J
O Mr A. W. Carroll Tony Carroll, Cropthorne T
B Mrs E. Cosgrove Mill House Racing Limited S TIMEFORMVIEWScoredatWolverhamptoninFebruaryandplacedtwiceinSpring.Wellheldlast2starts5monthsapart,however. TFRHHIII BHA67
6 MELERI (GB) (10) 130042
6 10-0 (10)
Br B m Nathaniel (IRE) - Divine Pamina (IRE) Luke Catton (3) J
O Lady Prosser
B Sir David Prosser
Jim Boyle, Epsom T
Jim Boyle Racing S
TIMEFORMVIEWShowedimprovedformwhenrunner-upof6inhandicapatLingfield(9/2)10daysago,racingheadstrongearly. Canbereluctantleavingstalls.
7 REDONDO (GB) (68) 060-214 D
67
4 9-11 (3)
Br B g Territories (IRE) - Chincoteague (IRE) Stevie Donohoe J
O Queensbury racing Des Donovan, Exning T
B Glebe Farm Stud
TIMEFORMVIEWWonatHamiltonover11f(8/1)inJunebeforefinishing4thof8atsamecourse(11/4)68daysagowhen hamperedatstart.Wearsfirst-timehood.Firstrunfornewtrainer
8 BOWNDER (IRE) (16) 140325
(5)
Br B g Belardo (IRE) - City Vaults Girl (IRE) Joe Leavy J
O Mrs Suzanne Williams & Partner Jonathan Portman, Upper Lambourn T
B B. Kennedy Pump Technology Limited S TIMEFORMVIEWHasshowndecentform,finishing3rdof7atSandown(8f)and2ndof6atNewbury(10f).Fifthof10inhandicap atGoodwood(9/2)16daysagoonheavyground.First-timecheekpiecesandreturntoAWcouldsuit. TFR
Br B f Cracksman - La Pantera
Sean Levey J
O Lilywhite Racing & Stuart Lake Tom Ward, Upper Lambourn T
B Ms Vivienne O’Sullivan Smulders S
TIMEFORM VIEW Best form when 2nd of 5 at this C&D in April but last of 6 at Goodwood (10/3) 27 days ago, weakeningtamelyinfirst-timevisor First-timeblinkersreplacevisor TFRHHIII BHA69
10 CATHERINE’S GIFT (IRE) (19) 4-340 BF 3 9-9 (13)
Br Ch f Nathaniel (IRE) - Papelaine (IRE) Oisin Murphy J
O Mr Mohammed Jaber
B SCEA Marmion, Skymarc & Nightchill LLC
Harry Charlton, Beckhampton T
TIMEFORMVIEWShowedpromiseinnovicesbeforeeighthof10inhandicapatLingfield(3/1)19daysagowhentrying12f forfirsttime.Returnstoshortertripwithhoodremoved. TFRHHHII BHA68
11 MUST BELIEVE (GB) (52) 623500 3 9-8 (6)
Br B g Make Believe - Dalhousie
Tommie Jakes (5) J
O Mr Khalifa Saeed Sulaiman Ismail Mohammed, Newmarket T
B St Albans Bloodstock LLP Dubai Racing Club S TIMEFORMVIEWShowndecentformwithanecksecondatWolverhamptonandthirdatHaydockover10fbutwasseventhof11in14fhandicap atSouthwell(9/2)52daysago,trappedontherail.Shortertripcouldsuitbetterbasedonpreviousefforts. TFRHHHII BHA67
(13) 031340 CD 5 9-4 (2)
Br B g Massaat (IRE) - House of Roses Sean Dylan Bowen J
O Mr F. J. Brennan Barry Brennan, Upper Lambourn T B McCracken Farms
TIMEFORM VIEW Has been in fair form this year with a C&D win in June but was seventh of 9 in a handicap at KemptonParkover12f(25/1)13daysago Tonguestrapbackon.
13 BLUE TRAIN (IRE)
031534
57
Br B g Blue Point (IRE) - Samdaniya Hollie Doyle J
O Kennet Valley Syndicates XIV
William Knight, Newmarket T
B Rabbah Bloodstock Limited All Angels S
TIMEFORM VIEW One win from 11 runs, 4th of 8 in 10f handicap at Chelmsford (17/2) 28 days ago, staying on late. Extrafurlongmaysuit. TFRHHHII BHA62
DECLARED RUNNERS 13 2024: THE GLEN ROVERS 5 9 10 Jonny Peate 13-2 (LucyWadham) 10 ran Hood worn first time by No 7. Blinkers worn first time by No 9. Sheepskin Cheek Pieces worn first time by No 8. Visor worn by No 11, 13. Tongue Strap worn by No 4, 9, 12. Hood, Tongue Strap worn by No 1. Sheepskin Cheek Pieces worn by No 2.
Stewards Note:
LIEUTENANT LILY: Following its run on 22/8/2025 it was reported that the horse was never travelling.
Probable S.P’s: 7-1 Royal Pleasure (IRE), Catherine’s Gift (IRE), 8-1 Redondo (GB), 17-2 Meleri (GB), 9-1 Fihrayn (IRE), Bownder (IRE), 12-1 Solanna (GB), 14-1 Must Believe (GB), Blue Train (IRE), 20-1 Lieutenant Lily (GB), 25-1 Nahy (FR), 28-1 Three Yorkshiremen (IRE), 33-1 Upepo (IRE)
BOWNDER remains on a fair mark and should appreciate returning to the all-weather after finding heavy ground at Goodwood beyond him last time. He’s shown decent form with placed efforts at Sandown and Newbury Fihrayn has been consistent on artificial surfaces, including a win at Chelmsford, while course specialist Solanna must be respected.


for three yrs old and upwards x Total prize fund
Owners Prize Money 1st £2477, 2nd £1239, 3rd £619, 4th £310, 5th £155. (PenaltyValue £3140.40)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): J Butler
(42 wins from 465 runners, 9%) runs GALEL & SOAR ABOVE TRAINER-IN-FORM (LAST 14 DAYS): J Butler
(2 wins from 15 runners, 13%) runs GALEL & SOAR ABOVE
WEIGHTWATCHER: VITALLINE won off a handicap mark of 54, his rating is now down 6lb to 48.
LONGESTTRAVELLER: EARLY RELEASE trained by D Evans, Abergavenny, 138 miles.
1 GALEL (IRE) (150) 052-001



Br B f Exceed And Excel (AUS) - Gallipot Darragh Keenan J
O Mr J. Butler John Butler, Newmarket T
B Newtown Anner Stud TIMEFORMVIEWWentclosewhensecondin7fWolverhamptonhandicaplastNovemberWon0-55handicapover7fatWolverhampton (7/4)150daysago,beating11rivals.Previous6fattemptssuggesttoday’sdropintripisaconcern.
2 LAHINA BAY (IRE) (27) 454133 D 5 9-7 (11)
Br B m Cracksman - Serendipitously (IRE) Rhys Clutterbuck J
O Mrs Daphne Finch Rachel Cook & John Bridger, Liphook T
B Mountarmstrong Stud Tote S
TIMEFORMVIEWWonatWindsorinJulybeforeplacedthirdtwice,mostrecentlyatGoodwood(15/2)27daysagowhen notseentobesteffect.Player
3 RESPECTABLE JACK (GB) (48) 35400-6 4 9-7 (3)
Br B g Eqtidaar (IRE) - Respectable Hollie Doyle J
O The Sixstablemates
Matt Crawley, Newmarket T
B Brook Stud Bloodstock Ltd Tattersalls S TIMEFORMVIEWShowedmodesthandicapformwhensixthof12atNewmarket(25/1)48daysagowithtonguestrap, ranhandyandchallengedbeforeweakeninglate ReturntoAWcouldsuit.
HHHII BHA58
4 LITTLE MISS MAGIC (IRE) (33) 002302 4 9-6 (10)
Br B f Calyx - Missy Mischief (USA) Isobelle Chalmers (7) J
O Mr A. M. Balding Patrick Chamings, Basingstoke T
B Susan Roy
TIMEFORMVIEWHastwo seconds at 6fthisyearand finished second of5 in a 5.7fhandicap at Bath (7/2) 33 days ago, racingoffthepacebeforestayingonlate Couldbeinthemixifovercomingstartinggateissues.
HHHII BHA57
5 SOAR ABOVE (GB) (136) 006000 CD 10 9-6 (7)
Br Gr or Ro g Lethal Force (IRE) - Soar Sean Levey J
O Mr J. Butler John Butler, Newmarket T
B Cheveley Park Stud Limited
TIMEFORMVIEWOutofsortswithnowinin30starts,seventhof12inhandicapatKempton(14/1).Hardtofancy. TFRHIIII BHA57
6 EARLY RELEASE (GB) (16) 260342 D 3 9-6 (4)
Br B g Sergei Prokofiev (CAN) - Evening Starlight Oisin Murphy J
O G & A Racing David Evans, Abergavenny T
B Neil Simpson Emma Evans Racing Ltd, Tote S
TIMEFORMVIEWHasshowndecentformonAW,includingathirdina6fhandicapatWolverhamptoninJuly.Finishedsecondina5fhandicapatSouthwell(14/1) 16daysago,puttinginlateworkandsuggestingthetripwastoosharp Shouldbemoresuitedtothisreturnto6fbasedonpreviousefforts. TFRHHHHI BHA59
7 SUNDIATA KEITA (IRE) (15) 062354 3 9-5 (5)
Br B g Sands of Mali (FR) - Excel Yourself (IRE)
O CHERRY RACING
B Michael O’Mahony
Rob Hornby J
Joe Ponting, Wotton-Under-Edge T
TIMEFORMVIEWHasmixedforminhandicapsincludingaheadsecondatBathinJune.Fourthof8inhandicapatBath (28/1)15daysagowhenhangingrightandfailingtofindextrafinalfurlong. TFRHHHII BHA58
8 SOUTHBANK (IRE) (31) 031502 D
4 9-5 (9)
Br B g Acclamation - Ramone (IRE) Sean Dylan Bowen J
O Alwens & Digweeds Chris Gordon, Winchester T
B Karis Bloodstock Ltd & Rathbarry Stud Equestrian Fencing &Timber Ltd, Goodwin Racing Ltd S
TIMEFORM VIEW Five-time winner who has been running in 6f handicaps. Second of 9 in handicap at Windsor (10/1) 31 days ago, travelledsmoothlybutnotideallyplacedwhenchallenginginthefinalfurlong.StrongcontenderreturningtoAW
9 WILD EMBERS (IRE) (24) 4560
3 9-5 (12)
Br Ch g Cotai Glory - Kimbay (IRE) Stevie Donohoe J
O River Racing Des Donovan, Exning T
B Liam & Sean Mullen Pond House Stables S TIMEFORMVIEWRanmodestlyatthisC&DinJulybutshowedimprovementwhenfifthof10inhandicapatSouthwell (6.1f)24daysago First-timetonguestraptoday. TFRHHIII BHA58
10 EQUALISED (IRE) (87) 0-30650 3 9-4 (2)
Br B g Equiano (FR) - Electric Mistress (IRE) Luke Morris J
O Kennet Valley Syndicates VI
Harry Eustace, Newmarket T
B Matt,Paul & Elizabeth Duffy All Angels, Rank Interactive (Gibraltar) Limited S TIMEFORMVIEW Previous third at this C&D (11/8) but finished ninth of 14 at Windsor (15/2) 87 days ago First run for newtrainer Maybenefitfromreturntothissurfaceafterrecentunderperformances.
TFRHHHII BHA57
11 TOP BILLER (GB) (24) 510242 D 3 9-4 (6)
Br B g Due Diligence (USA) - Balancing Act (IRE)
O Miss J. Feilden
Paddy Bradley J
Julia & Shelley Birkett, Newmarket T
B Whitsbury Manor Stud Birkett Racing S TIMEFORMVIEWWonatLingfieldinMayandfinishedsecondof10in6fAWhandicapatSouthwell(9/1)24daysagoafter settingthepace.Cangivegoodaccountifsecuringearlylead.
TFRHHHII BHA57
12 VITALLINE (GB) (10) 410405 CD 7 8-11 (8)
Br B g Due Diligence (USA) - Vitta’s Touch (USA)
Josephine Gordon J
O Mrs Michelle Anne Crook Keiran Burke, Whitcombe T
B Whitsbury Manor Stud TIMEFORMVIEWWonatLingfield(7f)inJunebutbelowformsince,includingwhenfifthof9inhandicapatLingfield(5f) 10daysago(20/1),makinglateheadway Visorbackon,blinkersremoved.
DECLARED RUNNERS 12
2024: LIOSA (IRE) 4 9 5 Hector Crouch 6-4 (Stuart Kittow) 10 ran Tongue Strap worn first time by No 9. Tongue Strap worn by No 3. Blinkers, Tongue Strap worn by No 11. Visor, Tongue Strap worn by No 12. Sheepskin Cheek Pieces worn by No 7.
Probable S.P’s: 9-2 Southbank (IRE), 6-1 Galel (IRE), 15-2 Top Biller (GB), 8-1 Lahina Bay (IRE), 9-1 Little Miss Magic (IRE), 11-1 Early Release (GB), 12-1 Wild Embers (IRE), 16-1 Equalised (IRE), 20-1 Respectable Jack (GB), 22-1 Soar Above (GB), 25-1 Sundiata Keita (IRE), 40-1 Vitalline (GB)
SOUTHBANK has been running consistently in 6f handicaps, finishing a strong second at Windsor last time when not ideally placed, and shades the vote over the in-form Lahina Bay. Early Release found 5f too sharp last time and should appreciate this return to 6f
TIMEFORM PREDICTION: 1.SOUTHBANK (IRE) 2.LAHINA


Find out more about today’s race sponsor at unibet.co.uk

Timings correct at time of going to print. Kempton Park cannot be held responsible for any changes made by third parties. Please feel free to check timings with the racecourse office or by calling South West Trains on 0845 6000 650 or visiting www.swtrains.co.uk
T: 0344 579 3008
E: London.CustomerRelations@thejockeyclub.co.uk W: thejockeyclub.co.uk/kempton





First Race 3.57 - THE UNIBET ZERO% MISSION/BRITISH STALLION STUDS EBF NOVICE STAKES (CLASS 4) (GBB RACE)
Distributed in accordance with the Stakes and Prize Money Code. £5940 to the winning horse The second to receive £2788, the third £1394 and the fourth £697. for novice two yrs old, which are E.B.F eligible. Enter by noon, September 12th and pay £55 stake, Declare by 10.00 a.m. September 16th. Weights: Colts and geldings 9st 4lb; fillies 8st 13lb Penalties, for each Restricted Novice or Maiden race won 4lb For each other race won 7lb (Sellers and Claimers excluded for the purposes of penalties) Unibet has generously sponsored this race and will present a memento to the winning owner THE TRUSTEES OF THE E.B.F have kindly contributed £1000 towards the prize money for this race 23 entries at £55. - Closed September 12th, 2025. Owners Prize Money. Winner £4694; Second £2346; Third £1174; Fourth £586. (PenaltyValue £5940) SS SEE PAGE 6 FOR THIS RACE. Second Race 4.27 -THE BET@racingtv.com HANDICAP STAKES (CLASS 6) (DIV I) Distributed in accordance with the Stakes and Prize Money Code. £3140 to the winning horse The second to receive £1473, the third £736, the fourth £368 and the fifth £183. for three yrs old and upwards, Rated 46-55 (also open to such horses rated 45 and below). £30 stake if the horse is rated 46 or higher, or £6 stake if the horse is rated 45 or lower with £24 extra if the horse is declared to run Declare by 10.00 a.m. September 16th. Lowest weight: 4-y-o and up 9st; 3-y-o 8st 10lb Highest weight: 4-y-o and up 9st 9lb; 3-y-o 9st 5lb Penalties, after September 6th, 2025, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb. Racing TV has generously sponsored this race and will present a memento to the winning owner 19 entries at £30 - Closed September 12th, 2025. Owners Prize Money. Winner £2477; Second £1239; Third £619; Fourth £310; Fifth £155. (PenaltyValue £3140.40) SS SEE PAGE 10 FOR THIS RACE.
Third Race 5.02 - THE BET @racingtv.com HANDICAP STAKES (CLASS 6) (DIV II) Distributed in accordance with the Stakes and Prize Money Code. £3140 to the winning horse The second to receive £1473, the third £736, the fourth £368 and the fifth £183. for three yrs old and upwards, Rated 46-55 (also open to such horses rated 45 and below). £30 stake if the horse is rated 46 or higher, or £6 stake if the horse is rated 45 or lower with £24 extra if the horse is declared to run Declare by 10.00 a.m. September 16th. Lowest weight: 4-y-o and up 9st; 3-y-o 8st 10lb Highest weight: 4-y-o and up 9st 9lb; 3-y-o 9st 5lb Penalties, after September 6th, 2025, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb Racing TV has generously sponsored this race and will present a memento to the winning owner 18 entries, 2 at £6 and 16 at £30 - Closed September 12th, 2025. Owners Prize Money. Winner £2477; Second £1239; Third £619; Fourth £310; Fifth £155. (Penalty Value £3140.40) Weights raised 1lb and paragraphs 27 to 31 ofthe Weights and Handicapping Code complied with where applicable. SS
SEE PAGE 12 FOR THIS RACE.
Fourth Race 5.40 - THE UNIBET HANDICAP STAKES (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code. £4187 to the winning horse The second to receive £1964, the third £981, the fourth £491 and the fifth £244. for three yrs old only, Rated 51-70 (also open to such horses rated 50 and below). £40 stake if the horse is rated 51 or higher, or £8 stake if the horse is rated 50 or lower with £32 extra if the horse is declared to run Declare by 10.00 a.m. September 16th. Lowest weight 8st 4lb; Highest weight 9st 9lb Penalties, after September 6th, 2025, for each race won 6lb 15 entries at £40 - Closed September 12th, 2025. Owners Prize Money. Winner £3303; Second £1652; Third £826; Fourth £413; Fifth £206. (PenaltyValue £4187.20) SS SEE PAGE 14 FOR THIS RACE.
Fifth Race 6.12 - THE JUDDMONTE BRITISH EBF RESTRICTED NOVICE STAKES (CLASS 2) (for horses in Bands A, B, C and D) (EBF Restricted Race Qual.) (GBB/GBBPLUS RACE) Distributed in accordance with the Stakes and Prize Money Code £15462 to the winning horse The second to receive £7251, the third £3627, the fourth £1812 and the fifth £906. for novice two yrs old, which are E.B.F eligible, which are in Bands A, B, C, and D. Enter by noon, September 12th and pay £150 stake, Declare by 10.00 a.m. September 16th. Weights: Colts and geldings 9st 4lb; fillies 8st 13lb Penalties, for each race won 6lb (Sellers and Claimers excluded for the purposes of penalties) Allowances: Band B from Band A 2lb Band C from Band B 2lb Band D from Band C 2lb (Allowances are cumulative) Juddmonte has generously sponsored this race and will present a memento to the winning owner The British Horseracing Authority’s Development Fund has generously contributed £2500 towards the prize money for this race THE TRUSTEES OF THE E.B.F have kindly contributed £1000 towards the prize money for this race All horses which are placed in the first six in an EBF Restricted Maiden or Novice race qualifier in 2025 will be qualified to run in either THE £100,000 EBF RESTRICTED RACE FINAL (CLASS 2) (for fillies only) at Goodwood on 24 September, 2025, or THE £100,000 EBF RESTRICTED RACE FINAL (CLASS 2) (for colts and geldings only) at York on 10 October, 2025. Both races will be run over seven furlongs. NOTE: Horses entered or declared in a race which is subsequently abandoned will not be eligible to enter a Final. 14 entries at £150 - Closed September 12th, 2025. Owners Prize Money. Winner £12189; Second £6096; Third £3048; Fourth £1524; Fifth £762. (PenaltyValue £15462) A SS
SEE PAGE 18 FOR THIS RACE.
Sixth Race 6.45 - THE UNIBET MORE EXTRA PLACE RACES FILLIES’ NOVICE STAKES (CLASS 4) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £5940 to the winning horse The second to receive £2788, the third £1394 and the fourth £697. for novice two yrs old fillies only Enter by noon, September 12th and pay £55 stake, Declare by 10.00 a.m. September 16th. Weights: 9st 2lb each Penalties, for each Restricted Novice or Maiden race won 4lb For each other race won 7lb (Sellers and Claimers excluded for the purposes of penalties) Unibet has generously sponsored this race and will present a memento to the winning owner 28 entries at £55. - Closed September 12th, 2025. Owners Prize Money. Winner £4694; Second £2346; Third £1174; Fourth £586. (PenaltyValue £5940) SS
SEE PAGE 20 FOR THIS RACE.
Seventh Race 7.15 - THE UNIBET 40,000+ LIVE STREAMED EVENTS HANDICAP STAKES (CLASS 5) (London Stayers’ Series Qualifier) Distributed in accordance with the Stakes and Prize Money Code £4187 to the winning horse The second to receive £1964, the third £981, the fourth £491 and the fifth £244. for three yrs old and upwards, Rated 51-70 (also open to such horses rated 50 and below). £40 stake if the horse is rated 51 or higher, or £8 stake if the horse is rated 50 or lower with £32 extra if the horse is declared to run Declare by 10.00 a.m. September 16th. Lowest weight: 4-y-o and up 8st 11lb; 3-y-o 8st 2lb Highest weight: 4-y-o and up 10st 2lb; 3-y-o 9st 7lb Penalties, after September 6th, 2025, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb Unibet has generously sponsored this race and will present a memento to the winning owner All horses which have Started in this race, as defined in the Rules of Racing, will be eligible to enterTHE 2025 LONDON STAYERS’ (FINAL) HANDICAP STAKES to be run over about Two Miles at Kempton Park on 9 December, 2025, with a Total Race Value of £70,000 In the event of the abandonment ofthis qualifying race, any horse which has been declared to run in this race , or any horse entered to run in this race if the time of the abandonment was prior to the declaration stage, will be qualified to enter the Final. Any horse which has been eliminated from this qualifying race will also be eligible, subject to the Rules of Racing, to enter the Final 11 entries at £40. - Closed September 12th, 2025. Owners Prize Money. Winner £3303; Second £1652; Third £826; Fourth £413; Fifth £206. (Penalty Value £4187.20) Weights raised 1lb and paragraphs 27 to 31 of the Weights and Handicapping Code complied with where applicable. SS SEE PAGE 24 FOR THIS RACE.
Eighth Race 7.45 - THE TRY UNIBET’S NEW ACCA BOOSTS HANDICAP STAKES (CLASS 5) (London Middle Distance Series Qualifier) Distributed in accordance with the Stakes and Prize Money Code £4187 to the winning horse The second to receive £1964, the third £981, the fourth £491 and the fifth £244. for three yrs old and upwards, Rated 51-70 (also open to such horses rated 50 and below). £40 stake if the horse is rated 51 or higher, or £8 stake if the horse is rated 50 or lower with £32 extra if the horse is declared to run Declare by 10.00 a.m. September 16th. Lowest weight: 4-y-o and up 8st 11lb; 3-y-o 8st 5lb Highest weight: 4-y-o and up 10st 2lb; 3-y-o 9st 10lb Penalties, after September 6th, 2025, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb Unibet has generously sponsored this race and will send a memento to the winning owner All horses which have Started in this race, as defined in the Rules of Racing, will be eligible to enter THE 2025 LONDON MIDDLE DISTANCE HANDICAP STAKES (LONDON MIDDLE DISTANCE SERIES FINAL) to be run over one mile about three furlongs at Kempton Park on 3 November, 2025, with a Total Prize Fund of £80,000 In the event of the abandonment of this qualifying race, any horse which has been declared to run in this race , or any horse entered to run in this race if the time of abandonment was prior to the declaration stage, will be qualified to enter the Final. Any horse which has been eliminated from this qualifying race will also be eligible, subject to the Rules of Racing, to enter the Final. 21 entries at £40 - Closed September 12th, 2025. Owners Prize Money. Winner £3303; Second £1652; Third £826; Fourth £413; Fifth £206. (PenaltyValue £4187.20) SS
SEE PAGE 26 FOR THIS RACE.
Ninth Race 8.15 - THE UNIBET SUPPORTS SAFER GAMBLING HANDICAP STAKES (CLASS 6) Distributed in accordance with the Stakes and Prize Money Code. £3140 to the winning horse The second to receive £1473, the third £736, the fourth £368 and the fifth £183. for three yrs old and upwards, Rated 46-60 (also open to such horses rated 45 and below). £30 stake if the horse is rated 46 or higher, or £6 stake if the horse is rated 45 or lower with £24 extra if the horse is declared to run Declare by 10.00 a.m. September 16th. Lowest weight: 4-y-o and up 8st 9lb; 3-y-o 8st 7lb Highest weight: 4-y-o and up 9st 9lb; 3-y-o 9st 7lb Penalties, after September 6th, 2025, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb Unibet has generously sponsored this race and will present a memento to the winning owner 19 entries at £30. - Closed September 12th, 2025. Owners Prize Money. Winner £2477; Second £1239; Third £619; Fourth £310; Fifth £155. (PenaltyValue £3140.40) SS
SEE PAGE 28 FOR THIS RACE.
