The Jockey Club would like to thank our Group Partners for their support in 2026
RACE SPONSORS
EBF ebfstallions.com
RACEDAY OFFICIALS
Race Conditions can be found at the end of this racecard
CHAIRMAN
Richard Fuller
COMMITTEE
Simon Burgoyne, Fred Dashwood, Hayley Moore, Rishi Persad, Simon Tufnell, Mary Plowden, Eva Mariscotti, Emma Palmer
GENERAL MANAGER
Simon Durrant
ASSISTANT GENERAL MANAGER
Beverley Frith
OWNERS &TRAINERS LIAISON
Mimi Ashworth
CLERK OFTHE COURSE & REGIONAL HEAD OF RACING
Brian Clifford – 07880 784484
HEAD GROUNDSMAN
Steve Gudge - 07778 813826
STEWARDS
Sophie Candy (Chief Steward)
Georgina Cartwright (Stewards’ Panel Chair)
Ben Ford, Margaret Groves, Fergus Sweeney
STARTERS
Robert Supple
James Stenning
JUDGE
Emily Jones
CLERK OF THE SCALES
Graham Ford
VETERINARY OFFICER
Amy Hawthorn
VETERINARY SURGEONS
Jamie Knapp, B.V.S.C., M.R.C.V.S.
Simon Knapp, C.V.O., B.Sc., B.Vet.Med., M.R.C.V.S.
Clive Hamblin, B.Vet.Med., M.R.C.V.S.
Alfie Ireland, B.V.S.C., M.R.C.V.S.
Andrew Hamilton, M.V.B, Cert.A.V.P. (ESO) (EL), M.R.C.V.S.
Martin Watson, C.V.O., B.V.M.S., M.R.C.V.S.
Alex Weller BSc(Hons), BVetMed M.R.C.V.S.
MEDICAL OFFICERS
Dr Lucy Free, Dr Rob Cullen, Dr Peter Johnson, Dr Mark Gorvin, Dr Graeme Robertson, Dr Amy Lambert, Dr Rizwan Ghani, Dr Ramy Saker, Dr John Heathcock, Dr Linsey Whitley
EQUINE WELFARE AND INTEGRITY OFFICERS
Nick Holman, Stuart Shilston, Carol Leggett, Peter Double, Sarah Collins, Vincent McKevitt
COMMENTATOR
Mark Johnson
BETTING RING MANAGER
Andrew Boardley
DESIGNATED SAFEGUARDING LEAD
Simon Durrant
DEPUTY SAFEGUARDING LEADS
Brian Clifford, Beverley Frith
RACECARD EXPLAINED
1 GIAVELLOTTO (IRE) (92) 1131-53 C D 6 9-7 (7)
Br Ch h Mastercraftsman (IRE) - Gerika (FR) Oisin Murphy
Scuderia La Tesa Limited & Vaibhav Shah
Br J O T B S
Marco Botti, Newmarket
Societa Agricola La Tesa SRL Marco Botti Ltd
TIMEFORMVIEWTookhisformtoanotherlevellastseason,winningpairofGroup2soverherebeforeroundingoffhiscampaignwithaGroup1successinHongKong. NotathisbestinGroup1racesatMeydanandEpsomearlierintheyearbutstillthechiefthreattoKalpana.Firstrunfor3months.
Aquick wayto see a horse’s past performance.These are its recent finishing positions.
Look out for Letters:
C = Has won at this course
D = Has won over this distance
CD = Has won over this distance at this course
BF = Was a beaten favourite
MORE INFORMATION ON THE FORM
- = New racing season
/ = Missed racing season
P = Was pulled-up and didn’t finish the race
F = Horse fell
U = Rider unseated
R = Horse refused to race
CO = The horse was forced out of a race by a loose horse
B = Horse was brought down
S = Horse slipped
r = The horse ran around a jump or took the wrong course in a flat race
d = Disqualified
Bold form
figures = performance in allweather (Flat) or Pointto-Point (Jump) races
Select your horse. Note their name and saddlecloth number
Choose your bet. ‘To win’ or ‘each-way’ are popular types of bet.
‘To win’ is for your horse to come first.
‘Each-way’ is for your horse to come first or to be placed. It’s two bets, so ‘£2 each-way’ = £4 total bet.
How the experts rate the horse’s chances:
2. BHA rating = the higher the number, the better the horse.
3. Timeform view and TFR rating
Look out for the summary of leading course trainers before each race
5. JOCKEYS
Listen out for any jockeys who are having a successful day.
OTHER USEFUL DETAILS
6. Owner’s colours worn by the Jockey
7. Saddlecloth number
8. Horse’s name
9. Days since the horse last run
10. Horse’s age
11. Jockey’s weight (stone and Ibs)
12. The horse’s breeding – father (sire) and mother (dam)
13. Horse’s owner
14. Horse’s breeder
15. Birthplace of horse (outside GB)
16. Draw – position of the horse in the starting stalls
Decide the amount – or stake – you are comfortable to bet.
Place your bet. There are different places to bet on course; The Tote, racecourse bookmakers, betting shop or online. Each option offers a different experience.
Collect. Once ‘Weighed-in’ has been announced, present your betting slip and collect any winnings.
1. FORM EXPERTVIEW 4. HORSE’STRAINER &THEIR LOCATION
Virgin Bet
Raceday Preview
1:35pm - There could be still plenty more to come from the top weight
Al Arbeed who ran a close fourth in a Class 2 handicap at Southwell over 1 mile and the form of that race has worked out well. He did disappoint in his last run at Wolverhampton but looks a danger here now returning to action after a break. Cogitate ran well here last time out over a 1 mile trip. He is off the same mark again today and looks to have tactical speed. A repeat of his last run would see him go close here today. Eminency drops 1lb to a mark of86 and should go close with a few runs under his belt in recent months.
2:08pm - Anniversary should come on for his run at Lingfield last month after a long layoff. He looks an interesting contender who is still unexposed over this trip. Blindedbythelights has finished runner-up on his last 3 starts. He was run down at the finish by Many Men in an Ascot handicap last time after making a bold effort from the front and is likely to be in the mix here. Brasil Power was a nice winner of a Class 3 handicap at Wolverhampton. He is now off a career high mark but looks to be suited to this distance.
2.42pm – Respond was an impressive winner in a Class 3 handicap at Chelmsford last time out. He goes up 8lb however making this a much harder task for him and breaks from stall 10. El Burhan won off a mark of 94 at Ayr last time out. He now runs off 100 today but is unexposed over this trip and looks interesting here making his first start on the all-weather Triple Double A won at Newcastle last month after a long break. This will be a tougher test for the Hugo Palmer-trained gelding, but he looks to be going in the right direction.
3:13pm – The fillies’ Listed race looks to be a match between Cathedral and Survie, both who had run respectively in Group One company last season. The latter put up her best performance by far over 1m 4f in the Breeders’ Cup Filly and Mare Turf, finishing a highly respectable fourth. Survie has some very decent 10f form and put in a solid performance last time in Riyadh, the drop back to 1 mile should pose no problems with Kempton’s straight sure to benefit.
3:52pm - A tricky looking three-year-old contest where all six runners must be in with a chance. Spinning Lizzie ran well in good company after her comfortable maiden win and is top rated here. Eskimo Pie could well improve markedly forthe step up in trip, she was pretty consistent in decent company last season, and her shrewd trainer will look to bring the best out of her this time around.
4:28pm - King’s Trail and Sin City, who are both entered in the 2000 Guineas, probably hold the key here. Both have the same sort of profile and one all-weather win to their name. This race will look to be a stepping stone to a Classic trial come April. The gelded Conclave was awarded the win on his debut run here after a disqualification to a rival and could well improve again. The front two pulled six lengths clear there and he looks a solid each way bet in this contest.
5:03pm - The sprinters are back for the final race. The hat-trick seeking Fast Track Harry has proved a revelation after being gelded this spring with two Class 2 handicap victories to his name. He drops to a Class 3 here. Tuco Salamanca was in decent form himself this time last year While he is much higher in the weights now, he could well put up a worthy performance. Another hat-trick seeker is Knebworth from the Richard Hughes yard. He has plenty of miles on the clock compared to Fast Track Harry, but again is sure to run a big race.
PROMOS:
Kempton 2:08pm- Money back all losers as a free bet (max refund £10)
Extra Places: 2:42pm 1/5 4 places (min 12 runners)
for four yrs old and upwards ™ Total prize fund £16000
Owners Prize Money 1st £6606, 2nd £3304, 3rd £1651, 4th £826, 5th £413. (PenaltyValue £8374.40)
RACE FACTS - A CLOSER LOOK
LEADING COURSETRAINER (20-25): A Balding (99 wins from 602 runners, 16%) runs GOLDEN REDEMPTION TRAINER-IN-FORM (LAST14 DAYS): A Balding (7 wins from 21 runners, 33%) runs GOLDEN REDEMPTION LONGESTTRAVELLERS: I’M WORKIN ON IT& BOLD IMPACT trained by R Millman, Cullompton, 157 miles.
1 ALARBEED (GB) (123) 13440- D
Br B c Night of Thunder (IRE) - Queen’s Pearl (IRE) Joe Leavy J
O Mr Ziad A. Galadari Richard Hannon, Marlborough T
B Galadari Sons Stud Company Limited
TIMEFORMVIEWDebutmaidenwinneronAW12monthsagoandprogressiveformindefeatnext3starts,includingwhenfourthatSouthwellonhandicapbow inOctoberafter6monthsoffDisappointedatWolverhamptonfollowingmonthbutremainsrelativelyunexposed.
2 DEFENCE MINISTER (GB) (195) 6/00240- 4 9-7 (2)
Br B g Too Darn Hot - Tears of The Sun Callum Rodriguez J
O Wathnan Racing Hamad Al Jehani, GB T
B Mildmay Bloodstock Ltd Damsa Holding Company W.L.L S
TIMEFORMVIEWHighlytriedafterwinningfirst2startsbuthasdonewellinhandicapsconsidering,includingwhenfourthof20 atGloriousGoodwood.RespectedonAWdebut/return.
BHA92
3 SISYPHEAN (IRE) (106) 202000- 5 9-5 (8)
Br B h Dubawi (IRE) - Lunar Vega (IRE) David Egan J
O Phil Cunningham Richard Spencer, Newmarket T
B Sheikh Mohammed Obaid Al Maktoum Direct Commercial Ltd, Rebel Racing Ltd S
TIMEFORMVIEWFrontrunnerwho’smuchbetteronspeed-favouringtracks,twicegoingcloseforKevinRyanatYorklastseasonoffhighermarks, includingonreappearance.However,low-keystartforthisyardatMeydaninDecemberandheadgearnowapplied. TFRHHHII BHA90
4 COGITATE (IRE) (150) 640242- D 5 9-2 (9)
Br B g Churchill (IRE) - Damaniyat Girl (USA)
Billy Loughnane J
O Mr H. Frost Charles Hills, Lambourn T
B Lynch Bages Ltd Wishanger Estates Ltd S TIMEFORMVIEWReliableoperator,includingontheAW,andheendedlastseasonwithagoodsecondhere(1m).Otherslook bettertreatedaheadofreturn,though. TFRHHHII BHA87
5 EMINENCY (IRE) (15) 41-2043 D
Br Gr g Havana Grey - Kendamara (FR)
6 9-1 (4)
Jack Dace (5) J
O Mrs J. Morley Stuart Williams, Newmarket T
B Awbeg Stud Unlimited Tote S TIMEFORMVIEWAthree-time6f/7fwinnerinthesecondhalfof2025andcomeshereingoodnick,endinguptoofarbackwhen thirdatSouthwell(7.1f)15daysago Hasafitnessedgeovermostofthesesooughttobeintheshake-up TFRHHHHI BHA86
6 ELECTRIFARHH (GB) (313) 41/2- C
Br B f Farhh - Electrify (IRE)
(3)
George Downing J
O Miss Yvonne Jacques Ed Walker, Upper Lambourn T
B Carisbrooke Stud Carisbrooke Stud LLP S TIMEFORMVIEWProgressiveform,betterfordebutwhenwinningnoviceover1mhereat2yrsandbeatenonlybyasmartsort inWindsornoviceon3-y-oreturninMay.However,offsinceandhandicapperhastakennochances. TFRHHHII BHA85
7 BOLD IMPACT (IRE) (155) 3221/40- D
Br B g Blue Point (IRE) - Motheeba (USA)
(5)
Oliver Searle (5) J
O Mr Eric Gadsden Rod Millman, Cullompton T
B D. & E. Phelan Millman Racing Club, Rod Millman Racing Ltd S
TIMEFORMVIEWEpsomnovicewinnerwhomadeapromisingreturnfromoverayearoffwhenfourthof11onAW/handicapbowatNewcastle inOctober Easytoforgivenextrun3weekslaterbutwassoldfromRalphBeckettfor32,000gnssoonafter. TFRHHHII BHA83
8 GOLDEN REDEMPTION (USA) (189) 033123- 4 8-11 (7)
Br B c Medaglia d’Oro (USA) - Redemption Day (USA) Jason Watson J
O Mr Saeed Suhail Andrew Balding, Kingsclere T
B WinStar Farm LLC
TIMEFORMVIEWProgressiveafterjoiningthisyardlastsummer,winningdecentNewburymaidenbeforegoodplacedefforts inhandicapsthereandNewmarket Returnto7fwillsuitandremainsonetobeinterestedin
9
I’M WORKIN ON IT (GB) (24) 422-114 CD 4 8-10 (1)
Br B g Harry Angel (IRE) - Bowstar Lewis Edmunds J
O Canisbay Bloodstock Rod Millman, Cullompton T
B Canisbay Bloodstock MillmanRacingClub,RodMillmanRacingLtd,FleetwoodDevelopmentsLtd S
TIMEFORMVIEWThree-timeC&Dwinner,includingwhenforgingclearinfirst-timeheadgearatthestartoflastmonth.Hitwitha9lbrisefor thatsuccessandmanagedonlyfourthover1mheresince,notobviouslytroubledbytheextra1f.Headgearleftoff. TFRHHHHI BHA81
DECLARED RUNNERS 9
2025: NO CORRESPONDING RACE LASTYEAR
Sheepskin Cheek Pieces worn first time by No 3. Hood, Tongue Strap worn by No 5.
Running for the first time since Gelding No. 2.
Stewards Note:
ALARBEED: Following its run on 25/11/2025 it was reported that the trainer could not explain the poor run. Probable S.P’s: 9-2 Golden Redemption (USA), 5-1 Defence Minister (GB), 6-1 I’m Workin On It (GB), 8-1 Eminency (IRE), 9-1 Cogitate (IRE), Electrifarhh (GB), 12-1 Al Arbeed (GB), Sisyphean (IRE), 14-1 Bold Impact (IRE)
GOLDEN REDEMPTION did well for Andrew Balding last season whilst leaving the impression he still has a bigger performance in him, so gets the vote with his yard well forward. Defence Minister boasts solid handicap form and rates the main threat ahead ofthe race-fit Eminency
TODAY'S RACE SPONSOR
STALLS
EACH-WAY
BETTING TERMS
Working alongside the Racecourse Association (RCA), bookmakers have introduced standard each-way betting terms across Jockey Club Racecourses. Bookmakers will provide these terms, or better, when offering each-way betting.
Fewer than 3 runners: win bets only, no places offered
3 or 4 runners: all to win Where a bookmaker wishes to depart from this default position he may offer place terms for 3 or 4 runners, this must be at 1/5 odds a place 1-2
5 to 7 runners (inclusive): 1/4 (one quarter) odds for finishing 1st or 2nd
8 or more runners: 1/5 odds for finishing 1st, 2nd or 3rd
Handicap races with 12 to 15 runners (inclusive): 1/4 odds for finishing 1st, 2nd or 3rd
Handicap races with 16 to 21 runners (inclusive): 1/5 odds for finishing 1st, 2nd, 3rd or 4th
Handicap races with 22 or more runners: 1/4 odds for finishing 1st, 2nd, 3rd and 4th
HANDICAPSTAKES(CLASS2) (LONDONSTAYERS’SERIESQUALIFIER)(GBBPlusRACE)
for four yrs old and upwards ™ Total prize fund £45000
OwnersPrizeMoney 1st£18284,2nd£9144,3rd£4572,4th£2286,5th£1143,6th£572. (PenaltyValue£23193)
LEADING COURSETRAINER(20-25):A Balding (99 wins from 602 runners, 16%) runsBELGRAVIAN & SPIRITMIXER TRAINER-IN-FORM(LAST14DAYS):A Balding (7 wins from 21 runners, 33%) runsBELGRAVIAN & SPIRITMIXER LONGESTTRAVELLER:ALIGNTHE STARStrained by C Johnston, Middleham, 245 miles.
1 LAVENDER HILL MOB (GB) (184) 541003-
Br B g Expert Eye - Whazzat Mason Paetel (5) J
O The Gredley Family James Owen, Newmarket T
B Stetchworth & Middle Park Studs Ltd Unex Group S
TIMEFORMVIEWUsefuldual-purposeperformerwho’sbackdowninclassonhisreturntothissphereandhiswinoverhurdlesat CheltenhaminNovembergivesplentyofhopethathecanprovefullyeffectiveoverstayingtripsontheFlat. TFR
2 BRASIL POWER (FR) (15) 11-3441 C 7
Br B g Dark Angel (IRE) - Venturous Spirit (FR) Billy Loughnane J
O Miss Eleanor Wellesley George Boughey, Newmarket T
B Dayton Investments Limited George Boughey Racing Ltd, Star Sports Bet S
TIMEFORMVIEWSuccessfulon3oflast4startsin2025(includingover1mhere)andremainedingoodformsteppingupfurther intripthisyear,resumingwinningwaysindecisivefashionatWolverhampton2weeksago Up3lb
3 SPIRIT MIXER (GB) (184) 215014- D 8 9-13 (4)
Br Ch g Frankel - Arabian Queen (IRE)
O Mr J. C. Smith
B Littleton Stud
Rob Hornby J
Andrew Balding, Kingsclere T
TIMEFORMVIEWGrandservantwhogainedanotherbigwinintheNorthumberlandPlateinJune.Alsobagged2mChesterhandicapinSeptember beforegoodfourthinListedraceatNewmarketfinalstart.Hasneededcomebackrunlast2seasons,though.
4 ALIGN THE STARS (IRE) (181) 500404- 5 9-9 (2)
Br Br g Sea The Stars (IRE) - Kitcara
O Tony Farmer
Callum Shepherd J
Charlie Johnston, Middleham T
B Sunderland Holding Inc. Johnston Racing Ltd S
TIMEFORMVIEWProgressiveat3.Foundlifeharderlastseasonbutpostedsomedecenteffortsindefeat,includingwhen notbeatenfaratRoyalAscot Off6months(ranwellonreappearancelastterm). TFRHHHII BHA92
5 BELGRAVIAN (IRE) (168) 211130- D 4 9-9 (9)
Br B g Make Believe - Marie Celeste (IRE)
O Mr Michael Blencowe
B Mrs S. M. Rogers
Jason Watson J
Andrew Balding, Kingsclere T
Moretons Investments Ltd S
TIMEFORMVIEWImprovingstayerwhoimpressivelybaggedafourthwinoftheseasonatGoodwoodinAugust.Goodthirdoff10lbhigheratNewmarket nexttimebeforerespectableseventhof19inCesarewitchtherefinalstart.Nosurpriseifhehadmoretoofferstillasa4-y-o. TFRHHHHH BHA95
6 SHERADANN (FR) (15) 010-034 CD BF 6 9-6 (6)
Br Gr g Roaring Lion (USA) - Shemima David Egan J
O Mrs Fitri Hay Ian Williams, Alvechurch T
B S.A. Aga Khan JMH Group S TIMEFORMVIEWBothwinsinBritainhavebeenonall-weatherataround2m,includingoverC&DinOctober.Bouncedbackfromapairof lessereffortswhenthirdatLingfieldbeforenotseentobesteffectatWolverhampton.Backonlastwinningmark. TFRHHHII BHA89
7 BLINDEDBYTHELIGHTS (GER) (246) 22/4/222- 6 9-5 (7)
Br B g Protectionist (GER) - Batya (IRE) Dylan Hogan J
O Middleham Park Racing XXXV Sir Mark Prescott Bt, Newmarket T
B Gestut Am Schlossgarten Middleham Park Racing S
TIMEFORMVIEWProgressed last seasonwithoutwinning, finding onetoo good forthethirdtime in as manystarts at AscotinJuly Offsincebutgoeswellfresh. TFRHHHHI BHA88
8 ANNIVERSARY (GB) (29) 122/05-5 BF 4 9-5 (1)
Br B g Sea The Moon (GER) - Lixirova (FR)
O Mr J. H. Richmond-Watson
Jack Dace (5) J
Ralph Beckett, Kimpton Down T
B The Cantillon Syndicate Dunlin S TIMEFORMVIEWShowedplentyofpromiseasa2-y-obutseenonlytwicelastseason,failingtoconvincewithhisstaminaatDoncaster inJune.Leftbadlyplacedinsteadily-runraceatLingfieldonreturnlastmonthandthisshouldrevealmore. TFRHHHHI BHA91
9 TROJAN STORM (GB) (29) 3310-00 5 8-9 (8)
Br Ch g Ulysses (IRE) - Mystic Storm Jack Doughty J
O The Green Bar Owners Ian Williams, Alvechurch T B Fernham Farm Ltd
TIMEFORMVIEWCareerbestwhenwinningonfirmgroundatAscotsummerbutwellheldall3startsafter6monthsoffsince 1lboutofhandicap. TFRHIIII BHA77
DECLARED RUNNERS 9 2025: COOL PARTY 5 9 3 Silvestre De Sousa 7-1 (Charlie Johnston) 9 ran Blinkers worn by No 8. Tongue Strap worn by No 2. Hood, Tongue Strap worn by No 6. Sheepskin Cheek Pieces worn by No 1, 4, 5, 7.
Stewards Note:
LAVENDER HILL MOB: Following its run on 6/12/2025 it was reported that the horse was unsuited by the going. SPIRIT MIXER: Following its run on 25/9/2025 it was reported that the horse was denied a clear run.
Probable S.P’s: 7-2 Blindedbythelights (GER), 4-1 Belgravian (IRE),Anniversary (GB), 8-1 Brasil Power(FR), 10-1 Spirit Mixer(GB), 12-1 Lavender Hill Mob (GB), 16-1 Align The Stars (IRE), 25-1 Sheradann (FR), 150-1 Trojan Storm (GB)
Competitive stuffwith the vote going to BELGRAVIAN, who went from strength to strength over staying trips last season and may still have more to offer as a 4-y-o. Lightly-raced 6-y-o Blindedbythelights was beaten only by an improving 3-y-o at Ascot when last seen in July and is another to consider along with the thriving Brasil Power
for ease of identification A list of the colours is below.
BACK
*
if your horse loses
ON A SELECTED RACE EVERY SATURDAY
*Max Free Bet £10. Bet must be placed within 48hrs of selected race(s) - 1st cash bet up to £10 (main market, ex antepost & specials). Win part e/w bet. Selection must lose. Free Bet: non-withdrawable, use in 7 days on sportsbook only. Stake not returned. T&Cs apply.
for four yrs old and upwards ™ Total prize fund £100000
OwnersPrizeMoney 1st£40630,2nd£20320,3rd£10160,4th£5080,5th£2540,6th£1270. (PenaltyValue£51540)
Trifecta Rollover Race
THIRD RACE
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): A Balding (99 wins from 602 runners, 16%) runs RESPOND TRAINER-IN-FORM (LAST 14 DAYS): A Balding (7 wins from 21 runners, 33%) runs RESPOND
LONGESTTRAVELLER: MARHABA GHAIYYATH trained by C Johnston, Middleham, 245 miles.
1 MILITARYACADEMY (GB) (35) 565-023 C D 5 9-12 (5)
Br B g Fastnet Rock (AUS) - Sovereign Parade (IRE) Alexandra Egan (7) J
O Mrs Jane Chapple-Hyam Jane Chapple-Hyam, Newmarket T
B Abdulla Al-Khalifa & Isa Salman
TIMEFORMVIEWShowedsignsoftemperamenttowardstheendofawinless4-y-oseasonfortheGosdensbuthasmadeapositivestartforcurrentconnections, closethirdintheWinterDerbyatLingfield5weeksago Moreneededifhe’stodefytopweightbackinahandicap,though. TFRHHHII BHA105
2 REAL DREAM (IRE) (42) 0335-64 C 7 9-11 (12)
Br B g Lope de Vega (IRE) - Laganore (IRE)
David Egan J
O Macable Partnership Ian Williams, Alvechurch T
B Newtown Anner Stud Tote S
TIMEFORMVIEWReliableveteranwhoagoodthirdinthislastyearbutotherslookbettertreated.
104
3 KING’S CODE (GB) (29) 135-156 CD 6 9-9 (4)
Br B g Saxon Warrior (JPN) - Polygon (USA) Pat Cosgrave J
O Eric Griffiths & P D Evans
David Evans, Abergavenny T
B Rabbah Bloodstock Limited Emma Evans Racing Ltd S
TIMEFORM VIEW Has enjoyed a highly productive all-weather season but last 2 starts suggest he’s got no room for manoeuvrefromhisrevisedmark. TFRHHHII BHA102
4 EL BURHAN (IRE) (191) 13/1001- 4 9-7 (11)
Br B g New Bay - Sar Oiche (IRE)
O Shadwell Estate Company Ltd
B Deerpark Stud
Billy Loughnane J
George Boughey, Newmarket T
TIMEFORMVIEWNarrowwinneratChesteronreturnlastseasonandfirmlybackontheupwhensuccessfulatAyrfinalstart,provinghimselfwellaheadofhismark triedatthistripforjustthesecondtime.6lbrisedoesn’tlookinsurmountablesobigshoutifprovingaseffectiveonAW TFRHHHHI BHA100
5 SAINT ETIENNE (GB) (293) 010010- 6 9-7 (8)
Br B g Le Havre (IRE) - Ideal World (IRE)
O The Cat and The Mag Partnership
B Haras d’Haspel
Callum Rodriguez J
Brian Ellison, Malton T
Brian Ellison Racing Limited S
TIMEFORMVIEWUsefulforminFrancelastseason,winningtwice.SubsequentlysoldfromY.Barberotfor€100,000.Off9months andhasworktodooffthismark.
6 MARHABA GHAIYYATH (IRE) (182) 212200- 4 9-7 (3)
Br B g Ghaiyyath (IRE) - Zam Zoom (IRE)
Callum Shepherd J
O Mr Jaber Abdullah Charlie Johnston, Middleham T
B Ballymaglassan Farm Limited Johnston Racing Ltd S TIMEFORMVIEWLargelyprogressiveform,winningtwicelastseasonbeforerunner-upinultra-competitive3-y-ohandicapsatNewmarket andGloriousGoodwood.Provedalet-downinCambridgeshirefinaloutingbuttypetobounceback. TFR
7 RESPOND (IRE) (16) 2135-21 4 9-3 (10)
Br B g Ghaiyyath (IRE) - Cross My Mind (IRE)
O Highclere Thoroughbred Racing - Teal
Jason Watson J
Andrew Balding, Kingsclere T
B Mr & Mrs John Banahan Highclere Thoroughbred Racing Ltd S TIMEFORMVIEWHascontinuedhisprogressthisyear,settlingbetterswitchedtofront-runningtacticswhenlandingtheodds atChelmsford16daysago Looksasmartprospectsogoodchancehecandefy8lbrise. TFRHHHHH BHA96
8 WHITCOMBE ROCKSTAR (GB) (26) 364-511 CD 7 9-0 (6)
Br B g Footstepsinthesand - Roshina (IRE) Daniel Muscutt J
O Mrs Michelle Anne Crook Keiran Burke, Whitcombe T
B Mrs M. A. Crook
TIMEFORMVIEWArrivesatthetopofhisgamehavingwonhislast2startshere,furtherenhancinghissuperbcourserecord. Remainsunexposedoverthissortoftripandsuretogowellagain. TFRHHHHI BHA93
9 MUSTAZEED (IRE) (154) 45010R- 8 8-13 (1)
Br Br g Territories (IRE) - Mejala (IRE)
O Newmarket Racing Club HQiii
B Shadwell Estate Company Limited
Lewis Edmunds J
Harry Eustace, Newmarket T
Rank Interactive (Gibraltar) Limited S TIMEFORMVIEWOftenmissesthebreakbutwonNewburyhandicapforsecondconsecutiveyearinSeptember However, refusedtoracefinalstartandbesttreatedwithcaution.
10 GAMRAI (GB) (164) 3/124- 4 8-9 (2)
Br B g Lope de Vega (IRE) - Nouriya
O Mr Imad Alsagar
Rob Hornby J
John & Thady Gosden, Newmarket T
B Blue Diamond Stud Farm (UK) Ltd Blue Diamond Stud Farm S TIMEFORMVIEWLookedusefulwhenmakingsecondstartawinningoneatWindsorinAugust.Failedtoadvancehisform next2startsbutisinexcellenthandsandremainsunexposed(hasbeengelded).
11 NIGHT BREEZE (IRE) (22) 21-0054 D 6 8-8 (9)
Br B g New Approach (IRE) - Right Direction (IRE)
Jack Doughty J
O Midtech 2 Ian Williams, Alvechurch T
B Godolphin Mid-Tech (Air Products) Ltd S TIMEFORMVIEWShowedimprovedformlastseason,winningtwiceatAscot Slowstarttothisyearbutmoreencouragingsigns atNewcastle3weeksagoandreturntothistripwillsuit.
12 RATHGAR (GB) (247) 0/52300- 6 8-6 (13)
Br Ch g Ulysses (IRE) - Why We Dream (IRE)
O Crest Racing XVIII
Rose Dawes (5) J
Jack Channon, West Ilsley T
B Jon and Julia Aisbitt Crest Racing S TIMEFORMVIEWReliablesortbutnotseensinceacoupleofrarebelow-pareffortslastsummer Startsnewseasonon winningmarkatleast.
13 TRIPLE DOUBLE A (IRE) (32) 12544-1 4 8-3 (7)
Br Br g Mohaather - Shaaqaaf (IRE) Tyler Heard J
O Done Ferguson Mason
Hugo Palmer, Malpas T
B Suroben Ltd Morson Group S
TIMEFORMVIEWCompletedahat-trickinthefirsthalfof2025andresumedwinningways/progressafter8monthsoffat Newcastle32daysago,lookingsuitedbythestepupintrip Cangowellagain.
HHHHI BHA82
DECLARED RUNNERS 13 2025: TEUMESSIAS FOX (IRE) 6 9 10 Oisin Murphy 4-1 (Andrew Balding) 14 ran Hood worn first time by No 5. Hood worn by No 7. Blinkers worn by No 1. Tongue Strap worn by No 4, 13. Visor, Tongue Strap worn by No 8. Sheepskin Cheek Pieces worn by No 13. Running for the first time since Gelding No 10
Probable S.P’s: 4-1 Respond (IRE), 6-1 El Burhan (IRE), 8-1 Marhaba Ghaiyyath (IRE), 9-1 Gamrai (GB), 10-1 MilitaryAcademy(GB), Triple Double A (IRE), 11-1 Whitcombe Rockstar (GB), 16-1 Night Breeze (IRE), 20-1 Real Dream (IRE), 22-1 King’s Code (GB), 28-1 Rathgar (GB), 40-1 Mustazeed (IRE), 50-1 Saint Etienne (GB)
Progressive pairRESPOND and El Burhan are potentiallystill ahead oftheirmarkswith narrow preference for the former given he’s race-fit and proven on all-weather Course specialist Whitcombe Rockstar is another to consider
The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.
The Great British Bonus (GBB) offers multiple bonuses of up to £20,000 per eligible race for British-bred fillies and mares.
THE VIRGIN BET SNOWDROP FILLIES’ STAKES (CLASS 1) (LISTED RACE)
forfouryrs old and upwards fillies and mares ™ Total prize fund £60000 OwnersPrizeMoney 1st£26736,2nd£10974,3rd£5490,4th£2742,5th£1374,6th£684. (PenaltyValue£34026)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): A Balding (99 wins from 602 runners, 16%) runs ALL MOONSHINE TRAINER-IN-FORM (LAST 14 DAYS): A Balding (7 wins from 21 runners, 33%) runs ALL MOONSHINE LONGESTTRAVELLER: SWEET PRINCESS trained by K R Burke, Leyburn, 245 miles.
1 ALL MOONSHINE (GB) (45) 31-11 CD 4 9-2 (12)
Br B f Oasis Dream - Alla Luna Jason Watson J
O Miss K. Rausing Andrew Balding, Kingsclere T
B Miss K. Rausing TIMEFORMVIEWOasisDreamfillywhohasimprovedwitheachofherfourruns,completingahat-trickonherhandicapdebutoverC&Dlastmonth. Thisstepupingradeclearlydemandsmorebutsheshouldn’tbeunderestimatedforyardamongthewinners.
2 AMERICAN GAL (GB) (189) 310200- CD 4
Br B f Kameko (USA) - Granny Franny (USA)
Pat Cosgrave J
O Mildmay Racing Ed Walker, Upper Lambourn T
B The Granny Franny Partnership Mildmay Farm & Stud Limited S TIMEFORMVIEWBaggedListedraceatChantillylastMayandpostedaverygoodsecondinGroup3atAscotlastsummer. Resumesfrom6monthsoffbutthisC&Dscorercan’tberuledout.
HHHII BHA101
3 BETTY CLOVER (GB) (195) 23P000- 4 9-2 (3)
Br Gr f Time Test - Reprieval (FR) Charles Bishop J
O The Ascot Revellers & Partner Eve Johnson Houghton, Blewbury T
B Eve Johnson Houghton ABM Catering Limited S
TIMEFORMVIEWUsefulfillybutsheended2025underacloud,only16thinSceptreStakesatDoncaster(7f)6monthsago. Makesherpolytrackdebutwithsomethingtoprove TFRHHIII BHA95
4 CATHEDRAL (GB) (147) 442454- 4
Br B f Too Darn Hot - War And Peace
(2)
David Egan J
O Amo Racing Limited Kevin Philippart de Foy, Newmarket T
B Exors of the Late Sir Robert Ogden Sports Invest UK Ltd S
TIMEFORMVIEWSmartfillywhoendedlasttermforhernewyard(formerlywithRalphBeckett)withaverygoodfourthof13inBreeders’Cup FillyandMareTurfatDelMar(11f)inNovember Backdownintripbuttheclearformpickifreproducingthateffort. TFRHHHHI BHA113
5 GLISTENING (GB) (28) 2/050-10 CD 4 9-2 (7)
Br B f Frankel - Soffia Rob Hornby J
O T Hyde & Mrs P Shanahan Ollie Sangster, Marlborough T
B Juddmonte Farms Ltd
TIMEFORMVIEWFailedtogoonforJohn&ThadyGosdenlastyearbutshemadeawinningdebutforcurrentyardinC&DnoviceinFebruary. OnlyninthatSouthwell(1m)onherhandicapdebut28daysagothoughandthisisaverystifftask. TFR
6 GLITTERING SURF (GB) (245) 1/150- CD 4 9-2 (8)
Br B f Oasis Dream - Sparkling Surf
Callum Rodriguez J
O Mr P. Winkworth Owen Burrows, Lambourn T
B P. Winkworth
TIMEFORMVIEWLookedagoodprospectwhenbaggingapairofC&Dnovicesonherfirst2starts.Failedtoprogressbothsubsequentruns however,justseventhof9inGroup3atAscotlastJuly Returnsfromanabsencenowwithmorerequired.
7 MISS NIGHTFALL (GB) (140) 634500- 4 9-2 (11)
Br B f Sands of Mali (FR) - Dusky Maid (IRE)
Callum Shepherd J
O The Cool Silk Partnership James Fanshawe, Newmarket T
B The Cool Silk Partnership Pegasus Stables LLP S TIMEFORMVIEWUsefulfillybutshe’sonalonglosingrunandsignedofffor2025withawell-heldtenthof13inListedrace atDoncaster(6f)inNovember Needsthisbreaktosparkaresurgence.
8 NEVER LET GO (GB) (183) 323125- D 4 9-2 (4)
Br Ch f No Nay Never (USA) - Tai Hang Dragon (IRE) George Downing J
O Rockcliffe Stud Ed Walker, Upper Lambourn T
B Rockcliffe Stud ABM Catering Facilities Management S TIMEFORMVIEWMadeupintoausefulfillylasttermwhenlandingtheSandringhamatRoyalAscot(1m)inJune.Ended2025 withasolidfifthin1mListedeventatNewmarketinSeptembersoenterscalculations. TFRHHHII BHA99
9 PINA SONATA (GB) (192) 4/1106- D
Br B f Pinatubo (IRE) - Moonlight Sonata Daniel Muscutt J
O Mrs Mary Slack James Fanshawe, Newmarket T
B Wilgerbosdrift (UK) Ltd Pegasus Stables LLP S
TIMEFORMVIEWFairlyusefulformshownwhenlandingapairof1mnovicesatWolverhamptonandLeicesterlastspring.Notdisgraceddespitecominginlastof6 in1mSandownListedracefinalrun.Maydobetterstillonherpolytrackdebutbutthisdemandsaclearpersonalbest. TFRHHIII BHA94
10 RADIANT BEAUTY
(GB) (189) 614113- CD 5 9-2 (6)
Br B m Churchill (IRE) - Main Desire (IRE) Paddy Bradley J
O Mr & Mrs S & D Turner James Owen, Newmarket T
B Branton Court Stud LLP
TIMEFORMVIEWProgressedwellin2025whenafour-timewinner(includingoverC&D).Gainedlasttwoofthosevictories forhercurrentyardandnoforlornhopewithbetterprobablystilltocome. TFRHHHII BHA87
11 SURVIE (IRE) (42) 3240-13 D
Br B m Churchill (IRE) - Sotteville (FR)
Billy Loughnane J
O Mrs Doreen Tabor George Boughey, Newmarket T
B Franklin Finance SA Ashford Stud of 5095 S
TIMEFORMVIEWSmartex-Frenchmarewhowent2-2onall-weatherwithnovicesuccessatLingfieldinJanuaryforhernewyard Notdiscreditedwhenthirdof11inNeomTurfCupatKingAbdulazizfollowingmonth.Theformpick. TFRHHHHH BHA112
12 SWEET PRINCESS (GB) (46)
3-1 D
Br B f Sea The Stars (IRE) - Sheikha Reika (FR)
O Exors of the Late Sheikh Mohammed Obaid
B Sheikh Mohammed Obaid Al Maktoum
Shane Gray J
K. R. Burke, Leyburn T
TIMEFORMVIEWSeaTheStarsfillywhobuiltondebutpromisewheneasilylandingtheoddsin3-runnernoviceatNewcastle(1mf) 46daysago Capableofbetterbutthisisatoughask.
HHIII BHA-
DECLARED RUNNERS 12 2025: SOPRANO (IRE) 4 9 2 William Buick 2-1 (George Boughey) 10 ran Sheepskin Cheek Pieces worn first time by No 5. Tongue Strap worn by No 11.
Probable S.P’s: 7-4 Survie (IRE), 11-4 Cathedral (GB), 12-1 Glittering Surf(GB), 14-1American Gal (GB), NeverLet Go (GB), 16-1 Pina Sonata (GB), 28-1 All Moonshine (GB), Miss Nightfall (GB), 40-1 Sweet Princess (GB), 50-1 Betty Clover (GB), Radiant Beauty (GB), 150-1 Glistening (GB)
PLAY SMARTER
A few of these bring potential but George Boughey took this 12 months ago and is taken to repeat the feat with his new recruit SURVIE who holds the edge on form. Cathedral would prove a major threat though if reproducing the form shown when fourth in the Breeders’ Cup at Del Mar last November Never Let Go, Radiant Beauty and All Moonshine appeal as the pick of the rest in the battle for minor honours.
TIMEFORM PREDICTION: 1.SURVIE (IRE) 2.CATHEDRAL 3.NEVER LET GO
British Stallion Studs will contribute £2million towards British prize-money in 2026, bringing our total investment to £42million since we were founded in 1983
FILLIES’CONDITIONSSTAKES (CLASS2)(GBBRACE)
for three yrs old fillies ™ Total prize fund £30000
OwnersPrizeMoney 1st£12189,2nd£6096,3rd£3048,4th£1524,5th£762,6th£381. (PenaltyValue£15462)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): G Boughey (40 wins from 257 runners, 16%) runs TRYST TRAINER-IN-FORM (LAST 14 DAYS): N Mulholland (4 wins from 29 runners, 14%) runs MYSTIC MOMENT
LONGESTTRAVELLER: ELLUSIVE BUTTERFLY trained by K R Burke, Leyburn, 245 miles.
1 ELLUSIVE BUTTERFLY (IRE) (81) 43-1 9-6 (5)
Br B f Invincible Army (IRE) - Gheedaa (USA)
Shane Gray J
O Nick Bradley Racing 5 & E Burke K. R. Burke, Leyburn T
B Ballybin Stud Ltd. & Patrick F. Kelly Tattersalls S
TIMEFORMVIEWInvincibleArmyfillyshapedwellwhenthirdin7fListedraceatDeauvillelastJulyandresumedfrom6monthsoff withacosysuccessin7fSouthwellmaideninJanuary Capableofbetterstillafteranotherbreak. TFR
2 TRYST (IRE) (151) 021-
(6)
Br B f Sottsass (FR) - Amerique (GER) Billy Loughnane J
O Highclere Thoroughbred Racing - Redwood George Boughey, Newmarket T
B Mr Stefan Hahne Highclere Thoroughbred Racing Ltd S
TIMEFORMVIEWSottsassfillywhobuiltonearlierpromisewhengettingoffthemarkin8.5fnoviceatWolverhamptoninOctober, showingagoodturnoffoot Notseenafterbutsheremainswithafairbitofpotentialforherin-formyard TFRHHHHH BHA83
3 ESKIMO PIE (IRE) (245) 2300- 9-2 (3)
Br B f Kodi Bear (IRE) - Sussex Garden (IRE) David Egan J
O Jane Chapple-Hyam & Gordon Li Jane Chapple-Hyam, Newmarket T
B Rathbarry Stud
TIMEFORMVIEWKodiBearfillywhoadvancedherformwhenaverygoodseventhinQueenMaryatRoyalAscotlastJune.Reportedlyfinishedlamewhen eighthinPrincessMargaretStakesatAscot(6f)followingmonth.Worthanotherchanceonherreturn/polytrackdebut.
HHHII BHA90
4 MYSTIC MOMENT (GB) (175) 215330- 9-2 (1)
Br B f Time Test - Last Enchantment (IRE)
Jason Watson J
O The Enchanted Syndicate Neil Mulholland, Limpley Stoke T
B Guy D. Everett
TIMEFORMVIEWGained a deserved breakthrough success in 7fmaiden atEpsom lastJulyand continued in good nick afterforEveJohnsonHoughton.Startsoutforanothergoodyardhere. TFRHHHII BHA84
5 OURBREN (IRE) (147) 45036- 9-2 (2)
Br B f Starman - Picosa City (IRE)
Taylor Fisher J
O N J Clayton & Partners J. S. Moore, Upper Lambourn T
B Macha Bloodstock & Rocal Bloodstock NJC Thermal Covers (UK) Ltd S TIMEFORMVIEWFairjuvenilemaidenwhoexcelledherselfwhenthirdin7fListedraceatNewburyinOctober.Off147days buthastheformtoplayapart. TFRHHHII BHA86
6 SPINNING LIZZIE (GB) (216) 1025- 9-2 (4)
Br Ch f Kameko (USA) - Cockney Dancer
Jack Doughty J
O Chris Stedman Dr Richard Newland & Jamie Insole, Droitwich T
B The Cockney Dancer Partnership Coulthursts Ltd S TIMEFORMVIEWKamekofillywhowassuccessfulonherdebutatRipon(6f)lastMayandsignedoffwithaverygoodfifthof7 inPrestige(cheekpieceson)atGoodwoodinAugust.Mustentercalculationsonherseasonalreturn. TFRHHHII BHA96
DECLARED RUNNERS 6 2025: GLITTERING SURF 3 9 6 David Probert 8-1 (Owen Burrows) 7 ran
Stewards Note:
ESKIMO PIE: Following its run on 26/7/2025 it was reported that the horse finished lame.
MYSTIC MOMENT: Following its run on 4/10/2025 it was reported that the horse hung left-handed. SPINNING LIZZIE: Following its run on 24/8/2025 it was reported that the horse ran too free.
Probable S.P’s: 11-4 Ellusive Butterfly (IRE), Spinning Lizzie (GB), 4-1 Tryst (IRE), Eskimo Pie (IRE), 16-1 Ourbren (IRE), 22-1 Mystic Moment (GB)
PLAY SMARTER
None of these can be ruled out but this could go the way ofTRYST who created a good impression when opening her account at Wolverhampton last autumn and can take another step forward here forherin-form handler Karl Burke’s Ellusive Butterfly also has better days ahead of her and rates a big threat though, while both Spinning Lizzie and Ourbren have the form to play a part too.
TIMEFORM PREDICTION: 1.TRYST (IRE) 2.ELLUSIVE BUTTERFLY (IRE) 3.SPINNING LIZZIE
GREAT BRITISH BONUS SCHEME
GREAT BRITISH BONUS SCHEME
The Great British Bonus (GBB) offers multiple bonuses of up to £20,000 per eligible race for British-bred fillies and mares. The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.
5f (2yo) Glamorous Spirit (IRE) (28/11/2008)
5f A Momentofmadness (07/04/2018)
6f (2yo) Invincible Army (IRE) (09/09/2017)
6f Trinityelitedotcom (IRE) (29/03/2014)
7f (2yo) Elsaakb (USA) (08/11/2017)
7f Sirius Prospect (USA) (20/11/2014)
1m (2yo) Queen Gamrah (30/10/2019)
1m Western Aristocrat (USA) (15/09/2011)
1m 2f Ply (25/09/2017)
1m 3f Forbidden Plant (30/03/2019)
1m 4f Spring of Fame (USA) (07/11/2012)
2m Colour Vision (FR) (02/05/2012)
forthree yrs old colts and geldings ™ Total prize fund £30000
OwnersPrizeMoney 1st£12189,2nd£6096,3rd£3048,4th£1524,5th£762,6th£381. (PenaltyValue£15462)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): A Balding (99 wins from 602 runners, 16%) runs CONCLAVE TRAINER-IN-FORM (LAST 14 DAYS): A Balding (7 wins from 21 runners, 33%) runs CONCLAVE
FANCYTHAT: J & T Gosden won this race in 2018, 2021 and 2023. The stable runs ARCHER ROYAL today.
LONGESTTRAVELLER: ROCHFORTBRIDGE trained by A P Keatley, Malton, 222 miles.
1 LAKE COMO (IRE) (90) 00211- D
Br B c St Mark’s Basilica (FR) - Step Sequence Pat Cosgrave J
O J R Boughey & Partner George Boughey, Newmarket T
B Newstead Breeding Star Sports Bet, George Boughey Racing Ltd S
TIMEFORMVIEW
€130,000yearling.StMark’sBasilicacolthasprovedarevelationfornewyard(purchasedfor16,000gnsfollowingdebutforAidanO’Brien),improving tolandadoubleonhandicapdebutatSouthwellinDecemberHasmoreonattheweightsherebutfurtherprogresscannotberuledout. TFRHHHII BHA89
2 CONCLAVE (IRE) (24) 1 CD
9-6 (8)
Br Br g Sioux Nation (USA) - Anniemaymarie Jason Watson J
O Highclere Thoroughbred Racing - Cypress Andrew Balding, Kingsclere T
B Andrew Hogan Highclere Thoroughbred Racing Ltd S TIMEFORMVIEW€62,000foal,€75,000yearling,€170,0002-y-o.SiouxNationgelding.Damtwice-racedhalf-sistertosmartwinnerupto1mSpaceTraveller.Madewinningstart overC&D(awardedraceafterfirstpastpostweighedinlight),pullingclearoftheremainderingoodstyle,andhelookssuretoimprove TFRHHHII BHA-
3 KING’S TRAIL (GB)
(117)
1- CD
9-6 (5)
Br Ch c Sea The Stars (IRE) - Crown Walk Billy Loughnane J
O Godolphin Charlie Appleby, Newmarket T
B Godolphin Emirates Fly Better S
TIMEFORMVIEW
SeaTheStarscolt.Dam,winnerupto1m1f(2-y-o7fwinner),wonPrixChloe,half-sistertoverysmartwinnerupto11/4mCutlassBay.Wonintakingfashionon C&DdebutinDecemberandheldinhighregard(enteredin2000GuineasandDerby)bytopconnections.Looksthetypetoimprovemarkedly TFRHHHHH BHA-
4 SIN CITY (GB) (35) 1 D 9-6 (1)
Br B c Too Darn Hot - Rhythm Excel David Egan J
O Amo Racing Limited Kevin Philippart de Foy, Newmarket T
B Rabbah Bloodstock Limited Sports Invest UK Ltd S
TIMEFORMVIEW200,000gnsTooDarnHotcolt.Half-brothertoseveralwinners,includingsmart6f-9.7fwinnerExcelPower.Clearlyknew hisjobwhenjustifyingstrongsupportonLingfielddebut.He’swelldrawnandsuretoprogress. TFRHHHII BHA-
5 ARCHER ROYAL (IRE) (168) 130-
9-2 (3)
Br B g Blue Point (IRE) - Ahd (USA) Tyler Heard J
O Godolphin John & Thady Gosden, Newmarket T
B Old Carhue Stud Emirates Fly Better S TIMEFORMVIEW340,000gnsBluePointgeldingshowedasharpturnoffoottowinonChelmsforddebutandthoughimprovedthirdinGroup3atNewmarketsubsequently, heagainlookedunsuitedbythetrackintheAutumnStakestherelasttime.Couldproveadifferentpropositiononfirststartsincebeinggelded. TFRHHHHI BHA99
6 HE’S
WALIIM
(GB) (168) 1625-
9-2 (7)
Br B g Too Darn Hot - Phiz (GER) Callum Shepherd J
O Mr Jaber Abdullah James Tate, Newmarket T
B Minster Stud
TIMEFORMVIEWSonofTooDarnHot(75,000gnsyearling)improvedondebutsuccesswhenpushingaprogressiveonecloseoverC&Dbutwastoofreetodohimself justiceonnurserydebutatYorkinOctoberLooksthetypethat’llbenefitfromageldingoperation,andneedsconsideringonhisbestform. TFRHHHII BHA91
7 LORD BRITAIN (GB) (182) 5130- C 9-2 (4)
Br B c Universal (IRE) - Time To Strike (IRE)
O Mr Abdulla Al Mansoori
Paddy Bradley J
Ismail Mohammed, Newmarket T
B Rabbah Bloodstock Limited Dubai Racing Club S
TIMEFORMVIEWWellplacedwhenwinningover7fhereonsecondcareerstart,andwhilehebackedthatupwithsubsequentthirdover sameC&D,heseeminglyhadhislimitationsexposedinGroup2RoyalLodgeatNewmarketlaterinSeptember TFRHHIII BHA84
8 ROCHFORTBRIDGE (IRE) (154) 14524- 9-2 (9)
Br B c Mehmas (IRE) - Annual (USA)
Callum Rodriguez J
O Mr James Fyffe & Mr Scott Fyffe Adrian Keatley, Malton T
B Tally-Ho Stud JF Kegs (Scotland) Ltd S TIMEFORMVIEW100,000gnsMehmascoltfinishedusefulrunner-upinListedraceatPontefractbutfoundquickturnaround/markedstepupinclassagainsthim whenwellheldfourthof5inGroup1FuturityatDoncasterinOctoberOughttobemorecompetitivewithsightslowered. TFRHHHII BHA99
9
SUNSET ON LEROS (GB) (160) 4143- 9-2 (2)
Br Ch c Almanzor (FR) - Juliet Capulet (IRE)
Daniel Muscutt J
O Mr Paul Hunt & Partner Marco Botti, Newmarket T
B Cheveley Park Stud Limited Heart Of The South Bloodstock S TIMEFORMVIEW10,000gnsfoal,42,000gnsyearling.Almanzorcoltwenttherightwayasajuvenile,comingfromfurtherbackthan thepairthatbeathimwhenthirdinMilanGroup3lastOctober,andhe’sentitledtobeinthemixonthatform. TFRHHHII BHA99
DECLARED RUNNERS 9 2025: GLITTERING LEGEND 3 9 9 Daniel Muscutt 5-2 (James Fanshawe) 5 ran Tongue Strap worn by No 7. Running for the first time since Gelding No 5, 6.
Probable S.P’s: 11-8 King’sTrail (GB), 13-2 Sin City(GB), 7-1ArcherRoyal (IRE), 9-1 Sunset On Leros (GB), 10-1 Rochfortbridge (IRE), 12-1 He’s Waliim (GB), 20-1 Lake Como (IRE), Conclave (IRE), 66-1 Lord Britain (GB)
Charlie Appleby won this race in 2024 with Notable Speech and while KING’S TRAIL has a way to go to reach those heights, it was hard not to be impressed by his debut C&D success in December It’s unlikely we’ve seen the best of Godolphin’s Archer Royal either, while He’s Waliim could bounce back having been gelded.
TODAY'S RACE SPONSORS
Find out more about today’s race sponsors at
OFFICIAL PHOTOGRAPHER
JOHN HOY
Mobile: 07594 056996 Website: www.hoycubed.com
CUSTOMER PROMISE
The team at Kempton recognise how important you are to our business
Our Customer Promise is that we are committed to delivering the best experience we can for you by:
Being welcoming and friendly
Treating you with respect
Being flexible to your needs
Being committed to consistently delivering quality & value
Providing clear and relevant information in a timely and appropriate manner
Encouraging and valuing your feedback to help us improve your experience
All we ask is that if you feel like we haven’t delivered on this promise or would like to offer us any feedback on your experience, please do let us know by emailing us at: London.CustomerRelations@thejockeyclub.co.uk
BETAGOOD BET HANDICAPSTAKES (CLASS 3) (LONDON SPRINTSERIES QUALIFIER)
for four yrs old and upwards ™ Total prize fund £16000
OwnersPrizeMoney 1st£6501,2nd£3251,3rd£1626,4th£813,5th£406,6th£203. (PenaltyValue£8246.40)
RACE FACTS - A CLOSER LOOK
LEADING COURSE TRAINER (20-25): R Hannon (49 wins from 484 runners, 10%) runs WILD CLARY TRAINER-IN-FORM (LAST 14 DAYS): T Carroll (7 wins from 63 runners, 11%) runs CITY CYCLONE LONGESTTRAVELLER: CITY CYCLONE trained by T Carroll, Cropthorne, 120 miles.
1 FASTTRACK HARRY (GB) (9) 1200-11 D 4 9-13 (11)
Br Ch g Harry Angel (IRE) - Olympic Runner
Rob Hornby J
O Mr J. C. Smith Clive Cox, Hungerford T
B Littleton Stud
TIMEFORMVIEWIsgoingtherightwayandarrivesonahat-trickafterbagging6fhandicapsatLingfieldandNewcastlerecently Up4lbbutthisstrong-travellingsortisnottakenlightly
2 BRIAN (IRE) (117) 005200- D 4 9-9 (10)
Br B g Shaman (IRE) - Alys Love Taylor Fisher J
O Mr T R Lock & Partner J. S. Moore, Upper Lambourn T
B Alys Love Syndicate Tote S
TIMEFORMVIEWUsefulathisbestbutheended2025belowpar,onlyseventhof8in1mListedracehereinDecember. Moreisneededafterabreak.
BHA95
3 KNEBWORTH (GB) (21) 2060-11 D 6 9-7 (3)
Br B g Awtaad (IRE) - Stereophonic (IRE) Finley Marsh J
O Blake, Dellar, Giles & Merritt
Richard Hughes, Upper Lambourn T
B Minster Stud & Stratford Place Stud Agetur (UK) Ltd S
TIMEFORMVIEWEnded2025outofformbutbetterthaneverthiswinter,scoringatChelmsfordCitybeforefollowingupin6fWolverhampton handicapthreeweeksago Cangowellagaindespitehavingacareer-highmarktoovercome.
HHHII BHA93
4 DURHAM CASTLE (GB) (285) 0/311/01- D 5 9-7 (2)
Br Ch g Havana Grey - Dundunah (USA)
Jack Mitchell J
O Rabbah Racing Simon & Ed Crisford, Newmarket T
B Whitsbury Manor Stud
TIMEFORMVIEWLightly-raced5-y-owhoreadilyresumedwinningwaysin6fhandicapatWindsorlastJune.Offsincebut yardisamongthewinners.
BHA93
5 TUCO SALAMANCA (IRE) (176) 301150- C D 4 9-6 (6)
Br B g Belardo (IRE) - Espoir Et Bonheur (IRE)
Billy Loughnane J
O Pompey Ventures 5 Ollie Sangster, Marlborough T
B Whisperview Trading Ltd Tote S
TIMEFORMVIEWEnjoyedanexcellent2025whenafive-timewinner(from6fto8.5f).Alsoscoredonhisseasonalreturn heresoheisonetoconsiderafter176daysoff
6 CHANGE SINGS (IRE) (229) 624600- CD 6 9-0 (4)
Br B g Saxon Warrior (JPN) - Cassandra Go (IRE)
Charles Bishop J
O Mr Trevor C. Stewart Eve Johnson Houghton, Blewbury T
B T. Stewart
TIMEFORMVIEWDualC&Dwinnerwholargelyranwellin2025,includingwhenthirdinthiseventonhisreappearance.Canraceoff a1lblowermarkheresohe’snotwithoutinterest.
7 WILD CLARY (IRE) (182) 321322- D 4 8-10 (7)
Br B g Dark Angel (IRE) - Chrysanthemum (IRE) Joe Leavy J
O Hollywood Racing & Barnane Stud Richard Hannon, Marlborough T
B Barnane Stud Ltd
Betting Entertainment Technologies Limited S TIMEFORMVIEWProgressivetypewho ended 2025with a good second of12 in 6fhandicap at Haydock in September whennotenjoyingaclearrununder2fout.Meritsconsideration.
8 STANLEY SPENCER (IRE) (24) 42-0063 CD 5 8-10 (5)
Br B g Iffraaj - Marsh Hawk Jason Watson J
O Mr Anthony Hogarth James Tate, Newmarket T
B Rockcliffe Stud
TIMEFORMVIEWC&Dwinnerwhogotbackontrackinfirst-timeblinkerswhenaclosethirdof8overC&D24daysago. Needsconsideringnudgedup1lb
9 FLEETWATER (GB) (15) 00200-2 D
Br B f Ardad (IRE) - Noble Nova
O Ms H N Pinniger and Partner
8-10 (1)
David Egan J
J. S. Moore, Upper Lambourn T
B Llety Farms Tote S
TIMEFORMVIEWBackonsongafter5monthsoffwhensecondof7in6fhandicapatSouthwell15daysago Inthemixoff anunchangedmark.
TFRHHHII BHA82
10 SERAPHIM ANGEL (GB) (257) 0/54041- D 4 8-10 (9)
Br Br f Sergei Prokofiev (CAN) - Silvery Blue
O Pompey Ventures 12,Singh & Partner
B Mrs Mary Taylor and James F. Taylor
Mason Paetel (5) J
Ollie Sangster, Marlborough T
Norfolk External Rendering Ltd S
TIMEFORMVIEWImprovedwhenbagging6fWindsorhandicaplastJulyonherfinalrunforTomDascombe.Changedhands for19,000gnssubsequentlyandneedstohitthegroundrunningafter8monthsoff TFRHHHII BHA82
11 CITY CYCLONE (GB) (24) 303-111 CD 6 8-7 (8)
Br Ch g Cityscape - Dubai Cyclone (USA)
John Egan J
O Mr W. Clifford Tony Carroll, Cropthorne T
B Ladyswood Farm & Stud LLP
Byerley Stud (Courtlands) Ltd S TIMEFORMVIEWBetterthaneverin2026andcompletedahat-trickin7-runnerhandicapoverC&D24daysago Helpedby beingheldupinstrongly-runracetherebutstillinthepicture.
DECLARED RUNNERS 11
BHA79
2025: NO CORRESPONDING RACE LASTYEAR
Blinkers worn by No 3, 8. Tongue Strap worn by No 1, 4, 5.
Stewards Note:
WILD CLARY: Following its run on 27/9/2025 it was reported that the horse suffered interference.
Probable S.P’s: 10-3 Fast Track Harry (GB), 7-1 Knebworth (GB), 8-1 Durham Castle (GB), 9-1 City Cyclone (GB), 10-1 Stanley Spencer (IRE), 11-1 Seraphim Angel (GB), 12-1 Wild Clary (IRE), 14-1Tuco Salamanca (IRE), Change Sings (IRE), 16-1 Fleetwater (GB), 40-1 Brian (IRE)
This is wide open so at the likely odds it is worth siding with CHANGE SINGS, who ran well when third in this event 12 months ago, to capitalise on a handy-looking mark and garner a third C&D success. Clive Cox’s upwardly-mobile Fast Track Harry heads the list of dangers, while Wild Clary, Knebworth, Tuco Salamanca and City Cyclone all need factoring in too.
TIMEFORM PREDICTION: 1.CHANGE SINGS (IRE) 2.FASTTRACK HARRY 3.WILD CLARY (IRE)
TODAY'S RACE SPONSOR
HORSERACE BETTING LEVY BOARD
Find out more about today’s race sponsor at virginbet.com
The Horserace Betting Levy Board (HBLB) has allocated £77.1m in prize money for 2026.
Since 2000 HBLB has invested £1.5bn in prize money to support the British horseracing industry
TRAIN TIMES
Kempton Park Dep: 16:29 16:59 17:29 17:59 18:29
Clapham Junc Arr: 17:05 17:35 18:05 18:35 19:05 Waterloo Arr: 17:16 17:49 18:16 18:49 19:16
Timings correct at time of going to print. Kempton Park cannot be held responsible for any changes made by third parties. Please feel free to check timings with the racecourse office or by calling South West Trains on 0845 6000 650 or visiting www.swtrains.co.uk
T: 0344 579 3008
E: London.CustomerRelations@thejockeyclub.co.uk
W: thejockeyclub.co.uk/kempton
TFRHHHII
TODAY'S RACE CONDITIONS
First Race 1.35 - THE VIRGIN BET HANDICAP STAKES (CLASS 3) Distributed in accordance with the Stakes and Prize Money Code £8374 to the winning horse The second to receive £3929, the third £1963, the fourth £982 and the fifth £489 for four yrs old and upwards, Rated 76-95 (also open to such horses rated 96 and 97; such horses rated 75 and below are also eligible - see Standard Conditions) £80 stake if the horse is rated 76 or higher, or £16 stake if the horse is rated 75 or lower with £64 extra if the horse is declared to run Declare by 10.00 a.m. March 26th. Lowest weight 8st 4lb; Highest weight 9st 9lb Penalties, after March 21st, 2026, for each race won 4yo to 6yo 5lb; 7yo and up 4lb Virgin Bet has generously sponsored this race and, will present a memento to the winning owner 13 entries at £80 - Closed March 23rd, 2026. Owners Prize Money. Winner £6606; Second £3304; Third £1651; Fourth £826; Fifth £413. (PenaltyValue £8374.40) SS SEE PAGE 8 FOR THIS RACE. Second Race 2.08 - THE VIRGIN BET QUEEN’S PRIZE HANDICAP STAKES (CLASS 2) (London Stayers’ Series Qualifier) (GBBPlus RACE) Distributed in accordance with the Stakes and Prize Money Code. £23193 to the winning horse The second to receive £10876, the third £5440, the fourth £2718, the fifth £1359 and the sixth £679 for four yrs old and upwards, Rated 81-100 (also open to such horses rated 101 and 102; such horses rated 80 and below are also eligible - see Standard Conditions) £225 stake if the horse is rated 81 or higher, or £45 stake if the horse is rated 80 or lower with £180 extra if the horse is declared to run Declare by 10.00 a.m. March 26th. Lowest weight: 5-y-o and up 8st 9lb; 4-y-o 8st 6lb Highest weight: 5-y-o and up 10st; 4-y-o 9st 11lb Penalties, after March 21st, 2026, for each race won 4yo to 6yo 5lb; 7yo and up 4lb Virgin Bet has generously sponsored this race and will present a memento to the winning owner All horses which have Started in this race, as defined in the Rules of Racing, will be eligible to enterTHE 2026 LONDON STAYERS’ (FINAL) HANDICAP STAKES to be run over about Two Miles at Kempton Park on 8 December, 2026, with a Total Race Value of £80,000 In the event of the abandonment of this qualifying race, any horse which has been declared to run in this race , or any horse entered to run in this race if the time of the abandonment was prior to the declaration stage, will be qualified to enter the Final. Any horse which has been eliminated from this qualifying race will also be eligible, subject to the Rules of Racing, to enter the Final. PLEASE NOTE: In accordance with the provisions of paragraph 9 of the Weights and Handicapping Code a horse must have run three times or more in order to qualify to run in this race 9 entries at £225. - Closed March 23rd, 2026. Owners Prize Money. Winner £18284; Second £9144; Third £4572; Fourth £2286; Fifth £1143; Sixth £572. (PenaltyValue £23193) SS SEE PAGE 10 FOR THIS RACE.
Third Race 2.42 - THE VIRGIN BET A GOOD BET ROSEBERY HANDICAP STAKES (CLASS 2) (London Middle Distance Series Qualifier) (GBBPlus RACE) Distributed in accordance with the Stakes and Prize Money Code. £51540 to the winning horse The second to receive £24170, the third £12090, the fourth £6040, the fifth £3020 and the sixth £1510 for four yrs old and upwards, Rated 0-105 (also open to such horses rated 106 and 107; such horses rated 78 and below are also eligible - see Standard Conditions) £500 stake if the horse is rated 79 or higher, or £100 stake if the horse is rated 78 or lower with £400 extra if the horse is declared to run Declare by 10.00 a.m. March 26th. Lowest weight 8st 2lb; Highest weight not less than 9st 12lb Penalties, after March 21st, 2026, for each race won 4yo to 6yo 5lb; 7yo and up 4lb Virgin Bet has generously sponsored this race and will present a memento to the winning owner All horses which have Started in this race, as defined in the Rules of Racing, will be eligible to enter THE 2026 LONDON MIDDLE DISTANCE HANDICAP STAKES (LONDON MIDDLE DISTANCE SERIES FINAL) to be run over one mile about three furlongs at Kempton Park on 4 November, 2026, with a Total Prize Fund of £80,000 In the event of the abandonment of this qualifying race, any horse which has been declared to run in this race , or any horse entered to run in this race if the time of abandonment was prior to the declaration stage, will be qualified to enter the Final. Any horse which has been eliminated from this qualifying race will also be eligible, subject to the Rules of Racing, to enter the Final. PLEASE NOTE: In accordance with the provisions of paragraph 9 of the Weights and Handicapping Code a horse must have run three times or more in order to qualify to run in this race 15 entries at £500 - Closed March 23rd, 2026. Owners Prize Money. Winner £40630; Second £20320; Third £10160; Fourth £5080; Fifth £2540; Sixth £1270. (PenaltyValue £51540) SS SEE PAGE 14 FOR THIS RACE. Fourth Race 3.13 - THE VIRGIN BET SNOWDROP FILLIES’ STAKES (CLASS 1) (Listed Race) Distributed in accordance with the Stakes and Prize Money Code. £34026 to the winning horse The second to receive £12900, the third £6456, the fourth £3216, the fifth £1614 and the sixth £810 for four yrs old and upwards fillies and mares only Enter by noon, March 23rd and pay £300 stake, Declare by 10.00 a.m. March 26th. Weights: 9st 2lb each Penalties, after August 31st, 2025, a winner of a Listed race 3lb Of a Group 3 race 5lb Of a Group 1 or Group 2 race 7lb Virgin Bet has generously sponsored this race and will present a memento to the winning owner All number cloths to be carried in this race have been sponsored and will carry the name/logo of Virgin Bet. The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code. 14 entries at £300 - Closed March 23rd, 2026. Owners Prize Money. Winner£26736; Second £10974;Third £5490; Fourth £2742; Fifth £1374; Sixth £684. (PenaltyValue £34026)ASS SEE PAGE 16 FOR THIS RACE.
Fifth Race 3.52 - THE VIRGIN BET DAILY EXTRA PLACES/BRITISH EBF FILLIES’ CONDITIONS STAKES (CLASS 2) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £15462 to the winning horse The second to receive £7251, the third £3627, the fourth £1812, the fifth £906 and the sixth £453. for three yrs old fillies only, which are E.B.F eligible, which have not won a Pattern race and have won no more than two races. Enter by noon, March 23rd and pay £150 stake, Declare by 10.00 a.m. March 26th. Weights: 9st 2lb each Penalties, after August 31st, 2025, a winner of a race 4lb Of 2 races 7lb
Note: Excluding the winner, the Official BHA Rating of any horse taking part in this race will not be increased due to performance in this race, providing the horse has had at least four prior completed runs Allowances: Horses which have never run 3lb Virgin Bet has generously sponsored this race and will present a memento to the winning owner THE TRUSTEES OF THE E.B.F have kindly contributed £5000 towards the prize money for this race 7 entries at £150 - Closed March 23rd, 2026. Owners Prize Money. Winner £12189; Second £6096; Third £3048; Fourth £1524; Fifth £762; Sixth £381. (PenaltyValue £15462) A SS SEE PAGE 20 FOR THIS RACE.
Sixth Race 4.28 - THE VIRGIN BET/BRITISH EBF CONDITIONS STAKES (CLASS 2) Distributed in accordance with the Stakes and Prize Money Code. £15462 to the winning horse The second to receive £7251, the third £3627, the fourth £1812, the fifth £906 and the sixth £453. for three yrs old colts and geldings only, which are E.B.F eligible, which have not won a Pattern race and which have won no more than two races. Enter by noon, March 23rd and pay £150 stake, Declare by 10.00 a.m. March 26th. Weights: 9st 2lb each Penalties, after August 31st, 2025, a winner of a race 4lb Of 2 races 7lb Note: Excluding the winner, the Official BHA Rating of any horse taking part in this race will not be increased due to performance in this race, providing the horse has had at least four prior completed runs Allowances: Horses which have never run 3lb Virgin Bet has generously sponsored this race and will present a memento to the winning owner THE TRUSTEES OFTHE E.B.F have kindly contributed £5000 towards the prize money for this race 10 entries at £150 - Closed March 23rd, 2026. Owners Prize Money. Winner £12189; Second £6096; Third £3048; Fourth £1524; Fifth £762; Sixth £381. (PenaltyValue £15462) A SS
SEE PAGE 22 FOR THIS RACE.
Seventh Race 5.03 - THE VIRGIN BET A GOOD BET HANDICAP STAKES (CLASS 3) (London Sprint Series Qualifier) Distributed in accordance with the Stakes and Prize Money Code. £8246 to the winning horse The second to receive £3867, the third £1934, the fourth £966, the fifth £483 and the sixth £241 for four yrs old and upwards, Rated 76-95 (also open to such horses rated 96 and 97; such horses rated 75 and below are also eligible - see Standard Conditions) £80 stake if the horse is rated 76 or higher, or £16 stake if the horse is rated 75 or lower with £64 extra if the horse is declared to run Declare by 10.00 a.m. March 26th. Lowest weight 8st 4lb; Highest weight 9st 9lb Penalties, after March 21st, 2026, for each race won 4yo to 6yo 5lb; 7yo and up 4lb Virgin Bet has generously sponsored this race and will present a memento to the winning owner All horses which have Started in this race, as defined in the Rules of Racing, will be eligible to enter THE 2026 LONDON SPRINT SERIES (FINAL) HANDICAP STAKES to be run over about six furlongs at Kempton Park on 14 October, 2026, with a Total Prize Fund of £65,000 In the event of the abandonment of this qualifying race, any horse which has been declared to run in this race , or any horse entered to run in this race if the time of abandonment was prior to the declaration stage, will be qualified to enterthe Final. Any horse which has been eliminated from this qualifying race will also be eligible, subject to the Rules of Racing, to enter the Final. 16 entries at £80 - Closed March 23rd, 2026. Owners Prize Money. Winner £6501; Second £3251; Third £1626; Fourth £813; Fifth £406; Sixth £203. (PenaltyValue £8246.40) SS SEE PAGE 24 FOR THIS RACE.
