Cheltenham Racecard - Tuesday 10th March

THE JOCKEY CLUB

WELCOMES YOU

A very warm welcome to Cheltenham Racecourse for our opening day of The Festival. We’re delighted you have been able to join us for Champion Day, and we’re looking forward to getting The Festival off to a brilliant start.

Ahead of the first race, we encourage you to head to the Parade Ring at 12.15pm, when the Retraining of Racehorses (RoR) Parade gets underway. This inspiring showcase highlights the remarkable second careers of former racehorses and celebrates the work being done to ensure life after racing remains fulfilling and rewarding for these magnificent athletes.

We are also delighted to welcome arguably one of the greatest hurdlers of all time, Constitution Hill, who will join us in the Parade Ring at 12.30pm. This will give racegoers the opportunity to show their appreciation for a racehorse who has defined a generation. We wish Nicky Henderson and Michael Buckley all the very best as they decide the next chapter in his remarkable career.

The action on the track begins with an incredibly deep renewal of the Sky Bet Supreme Novices’ Hurdle, always one of the most anticipated opening contests of the week as the famous Cheltenham roar finally erupts. That is followed by a fascinating clash in the Singer Arkle Challenge Trophy Novices’ Chase, where the Willie Mullinstrained Kopek Des Bordes is set to meet Lulamba from Seven Barrows, in what promises to be a fiercely competitive match-up.

Later in the afternoon, all eyes will turn to the feature race of the day, the Unibet Champion Hurdle In keeping with the theme of this year’s Festival, it looks one of the most open renewals in

recent times. Golden Ace bids to retain her crown but faces formidable opposition. Last year’s Festival winners The New Lion and Lossiemouth head the market, while Brighterdaysahead is also firmly in the mix. It promises to be a thrilling four-way battle to crown this season’s Champion Hurdler.

Between races today, racegoers are encouraged to visit The Orchard to see an outstanding collection of brands including Boodles, Debenhams, Holland Cooper, Chapel Down, Lavazza, Bottlegreen, Glenfarclas, Brooklands, Gaucho and Red Bull.

A huge thank you to today’s sponsors: Sky Bet, Singer Capital Markets, McCoy Contractors, Unibet, Trustmarque Ultima and Sun Racing. Their continued support plays an essential role in making the Cheltenham Festival the extraordinary event it is today.

We hope that you will really feel the benefit of the investment and improvements the Cheltenham team have made with our customers in mind for this year’s event. We are confident these changes will make a positive difference to your experience.

We hope that you enjoy your day here at Cheltenham for what is the pinnacle of Jump racing and look forward to welcoming you back to this iconic sporting venue again soon.

MARTIN ST QUINTON Chairman Chief Executive

GUY LAVENDER

Races 1, 2, 3 & 5

Race 4

Race 7

Race 6

COURSE MAP

OLD COURSE

RACE STARTS

Race 1 - 1:20pm

The Sky Bet Supreme Novices’ Hurdle Race (Grade 1) (GBB Race) (2m 87yds)

Race 2 - 2:00pm

The Singer Arkle Challenge Trophy Novices’ Steeple Chase (Grade 1) (GBB Race) (1m 7f 199yds)

Race 3 - 2:40pm

The McCoy Contractors Juvenile Handicap Hurdle (Registered as The Fred Winter) (Premier Handicap) (GBB Race) (2m 87yds)

Race 4 - 3:20pm

The Trustmarque Ultima Handicap Steeple Chase (Premier Handicap) (GBB Race) (3m 1f)

Race 5 - 4:00pm

The Unibet Champion Hurdle Challenge Trophy (Grade 1) (GBB Race) (2m 87yds)

Race 6 - 4:40pm

The Sun Racing Plate Handicap Steeple Chase (Premier Handicap) (GBB Race) (2m 4f 44yds)

Race 7 - 5:20pm

The National Hunt Challenge Cup Novices’ Handicap Steeple Chase (Class 2) (GBB Race) (3m 5f 201yds)

Cheltenham Racecourse has 75 acres (30 hectares) of racing surface with five different tracks – a Chase and Hurdle course on the Old and New Courses and the Glenfarclas Cross Country Course.

A team of 10 Groundstaff look after the track day to day and on raceday the team increases to 50, and 100 at The Festival.

TO DA Y ’S R AC E SP ONS OR S

RACEDAY OFFICIALS

RACE CONDITIONS CAN BE FOUND ON PAGE 78&79

CHAIRMAN

Martin St Quinton COMMITTEE

John Inverdale

Max McNeill

Martin Pope

David Redvers

Margaret Arthur

Zara Tindall

Michael Wainwright

CHIEF EXECUTIVE OFFICER

Guy Lavender

HEAD OF RACING & CLERK OF THE COURSE

Jon Pullin

CLERK OF THE COURSE

Dan Cooper

REGIONAL HEAD OF OPERATIONS

Gemma Steve

HEAD OF FINANCE

Hak Virk

COMMUNICATIONS

MANAGER – WEST

Megan Furse

PARTNERSHIPS

ACCOUNT MANAGER

Hannah Duff

SALES MANAGER

Toby Lewis

CAMPAIGN

MARKETING MANAGER

Luke Wall

ASSISTANT

GENERAL MANAGER

Andre Klein

HEAD GROUNDSPERSON

Alastair King

GENERAL MANAGER, JOCKEY CLUB CATERING

Matthew Davies

TOTE MANAGER

Paul Ritchie

STEWARDS

Shaun Parker (Chief Steward)

George Welch (Stewards’ Panel Chair)

Milly Bersey

Thomas Evetts

Margaret Groves

Chris Hill

Guy Upton

STARTERS

Robert Supple

James Stenning

William Jordan

Seamus O’Neill

JUDGES

David Hicks

Nick Bostock

CLERKS OF THE SCALES

Robert Cuthbert

Wayne Burnell

HANDICAPPERS

Dominic Gardiner-Hill

Michael Harris

EQUINE WELFARE & INTEGRITY OFFICERS

Alec Dent

Lisa Cook

Will Seely

Suzanne Feltham

Helena Warbrick

Richard Painter

Christine Hannaford

Vince McKevitt

Steve Fox

Andrea Kelly

Christopher Maiden

Martin Knight

Mel Baker

Jane Southam

Joanna Vickers

Michael Turner

Clive Jefferies

Kelly Corke

MEDICAL OFFICERS

Jon Mutimer SRMO

Lee Humphreys

Andy Simpson

Jemma Rooker

Gavin Nicol

CROWD DOCTORS

Anna Keitley

Suzannah Hoult

MEDICAL CO-ORDINATOR

Kevin Dickens

VETERINARY SURGEONS

Liam Kearns SRVS

Ian Camm

Andrew Harrison

Henry Tremaine

Vittorio Caramello

John Campbell

Tom Campbell

Scott Milne FARRIERS

David Hall

Alex Hall

Mike Cooper

VETERINARY OFFICERS

Graham Potts

Kate Maxwell

Alice Brown

Sally Taylor

COMMENTATORS

David Fitzgerald

Alan Howes

BETTING RING MANAGERS

Neil Pateman

Malcolm Hart

Grant Newman

Macauley Chapman

Andy Collins

The Jockey Club would like to thank our Group Partners for their support in 2026

BE T TI NG E XP L AI NE D

Select your horse. Note their name and saddlecloth number.

Choose your bet. ‘To win’ or ‘each-way’ are popular types of bet.

‘To win’ is for your horse to come first.

‘Each-way’ is for your horse to come first or to be placed. It’s two bets, so ‘£2 each-way’ = £4 total bet.

Decide the amount –or stake – you are comfortable to bet.

Place your bet. There are different places to bet on course; The Tote, racecourse bookmakers, betting shop or online. Each option offers a different experience.

Collect. Once ‘Weighed-in’ has been announced, present your betting slip and collect any winnings.

Unbeatenin4novicehurdleslastseason,includingtheDawnRunat thismeeting(beatBrighterdaysahead).ReachedtheframeinGrade2eventsonfirst2outings thiswinterpriortoproving3/4lengthtoostrongforBurdettRoadinKingwellatWincanton.

A quick way to see a horse’s past performance. These are its recent finishing positions

Look out for Letters:

C = Has won at this course

D = Has won over this distance

CD = Has won over this distance at this course

BF = Was a beaten favourite

- = New racing season

/ = Missed racing season

P = Was pulled-up and didn’t finish the race

F = Horse fell

U = Rider unseated

R = Horse refused to race

CO = The horse was forced out of a race by a loose horse

B = Horse was brought down

S = Horse slipped

r = The horse ran around a jump or took the wrong course in a flat race

d = Disqualified

Bold form

figures = performance in all-weather (Flat) or Point-to-Point (Jump) races

Look out for the summary of leading course trainers before each race Listen out for any jockeys who are

LEADING CONNECTIONS

Leading Jockey

The Jockey with the most wins over the four days will receive the Leading Rider Perpetual Trophy on Friday

Leading Owner

The Owner with the most wins over the four days will be presented with a perpetual trophy.

Leading Trainer

The Trainer with the most wins over the four days will be presented with a perpetual trophy.

Fancy something away from Cheltenham today?

SEDGEFIELD

Race 1 1.38 2m 178y

1 Blackwater Lilly (GB) 12-0

2 Captain Cool (IRE) 11-13

3 Newport (GB) 11-7

4 Cosmic Soul (IRE) 11-0

5 Lahire (FR) 10-13

6 Warrior Lion (GB) 10-8

7 Jet Approach (IRE) 10-2

8 Susiesparkle (IRE) 10-2

9 King Kodiak (IRE) 10-2

Race 2 2.18 2m 3f 188y

1 Shan’t Wait (IRE) 12-0

2 Saint Polo (FR) 11-12

3 Klapton Boy (FR) 11-12

4 Swingforthefence (IRE) 11-11

5 Wind Your Neck In (IRE) 11-8

6 Star Vantage (IRE) 11-3

7 Dartmhor (GB) 10-5

Race 3 2.58 2m 178y

1 Fearless Dragon (GB) 11-5

2 Laristote (FR) 11-5

3 Las Canals (FR) 11-5

4 Liberty Coach (GB) 11-5

5 Matching Energy (GB) 11-5

6 Rebel Tribesman (IRE) 11-5

7 The Den Master (GB) 11-5

Race 4 3.38 3m 2f 59y

1 Great Notions (FR) 11-11

2 Upfordebate (IRE) 11-9

3 Realisation (FR) 11-6

4 Alright Dai (IRE) 11-6

5 Ribeye (GB) 11-3

6 Le Grand Vert (FR) 11-2

Race 5 4.18 2m 77y

1 Intenzo (FR) 12-0

2 Powerofjet (IRE) 11-12

3 Tanking Along (IRE) 11-6

4 Clean Getaway (IRE) 11-3

5 Blue Bear (GB) 10-9

Race 6 4.55 2m 178y

1 Bourbon Girl (GB) 11-2

2 Connells Cross (IRE) 11-2

3 Crimson Ocean (GB) 11-2

4 Datstheholyallofit (IRE) 11-2

Never beaten by SP

Today’s RoR Parade

Everyone is welcome to join us at the Parade Ring on Tuesday 10th March before the first race, from 12.15pm, for the Retraining of Racehorses (RoR) parade.

The parade will shine a spotlight on 14 remarkable former racehorses, many of them Cheltenham heroes, National Hunt’s most celebrated stars and Grade 1 winners, each with their own story and now enjoying fulfilling second careers across a variety of disciplines, including showing, dressage and eventing, as well as life as much-loved family pets.

RoR is British horseracing’s official charity for the welfare of horses that have retired from racing. Through education, welfare support and membership, alongside a nationwide series of competitions, the charity helps former racehorses find new purpose and loving homes, while promoting their versatility and adaptability.

www.ror.org.uk

1. A PLUS TARD – ridden by Emily Kate Robinson

12-year-old by Kapgarde

Formerly trained by Henry De Bromhead

Breeder: Mme Henri Devin

A Plus Tard ran 23 times under National Hunt rules, winning eight races in total, including six over fences. In 2022 he provided one of Cheltenham’s most memorable moments when Rachael Blackmore became the first female rider to win the Cheltenham Gold Cup, steering him to an emphatic 15-length victory. His career earnings exceeded £957,000. Since joining Emily Kate Robinson during Cheltenham week in 2024, A Plus Tard has flourished in the show ring and dressage arena. In 2025 the pair achieved the remarkable double of Champion Racehorse to Riding Horse at both the RDS Dublin Horse Show and Royal Balmoral Show He also claimed the Treo Eile award for the highest-scoring Thoroughbred at the National Dressage Championships at preliminary level; a fitting second act for a Gold Cup hero.

2. AL BOUM PHOTO – ridden by Louise Duffy 14-year-old by Buck’s Boum

Formerly trained by Willie Mullins

Breeders: Emmanuel Clayeux & Jacky Rauch

A dual Cheltenham Gold Cup winner (2019 and 2020), Al Boum Photo was the first horse since Best Mate to regain the title, amassing over £1 million in prize money during a distinguished career Since retiring in 2022, he has embraced eventing and showing with equal enthusiasm. He qualified for the Eventing Ireland National Championships at EI90 in 2024 and stepped up to EI100 in 2025, finishing in the top six in four of his six starts, including runnerup at Ballindenisk International. He has also excelled in working hunter classes and competed at the RoR Championships at Aintree. At home, he enjoys cuddles, loves farm life, sea swims and plenty of well-earned downtime accompanied by lots of carrots.

3. BALTHAZAR KING – ridden by Michael Andrews

22-year-old by King’s Theatre

Formerly trained by Philip Hobbs

Breeder: Sunnyhill Stud

Winner of 16 races and over £489,000 in prize money, Balthazar King’s most notable triumph came in the Cross Country Chase at the 2014 Cheltenham Festival. After recovering from a life-threatening injury at Aintree, he retired and spent several seasons hunting. Now partnered by Michael Andrews, he is enjoying life as a schoolmaster, with plans to compete in low-level dressage and show jumping. Michael says he is the most charming, loveable and intelligent horse.

4. BRISTOL DE MAI – ridden by Clare Lawes

15-year-old by Saddler Maker

Formerly trained by Nigel Twiston-Davies

Breeder: Jean-Yves Touzaint

A three-time winner of the Grade 1 Betfair Chase at Haydock, Bristol De Mai amassed over £900,000 in prize money across a 42-race career Retired in 2023, he has taken naturally to flatwork, jumping and trailhunting. A very intelligent horse with a big personality, he also takes a keen interest in proceedings on the gallops and occasionally leads young horses in their early training, letting them learn from the expert!

5. CONEYGREE – ridden by Sara Bradstock 19-year-old by Karinga Bay

Formerly trained by the late Mark Bradstock

Breeder: Lord Oaksey

Coneygree made history in 2015 when, as a novice, he led from flagfall to win the Cheltenham Gold Cup, the first horse in 41 years to do so He won nine races from 18 starts and earned over £500,000. Since retiring in 2019, he has excelled in RoR showing classes, twice qualifying for the Tattersalls RoR Show Series final. Recently he competed in the Cotswold Team Chase, coming up the hill towards the finish just like he was winning the Cheltenham Gold Cup again.

6. ELEGANT ESCAPE – ridden by Lilly Clothier 14-year-old by Dubai Destination

Formerly trained by Joe Tizzard

Breeder: Jay Leahy

Winner of the 2018 Coral Welsh Grand National, Elegant Escape ran 36 times and earned over £370,000. Now enjoying life in Somerset and affectionately known as Dobby, he’s thriving in a varied routine of show jumping, cross country schooling, and trail-hunting, whilst spending plenty of time relaxing with his field mates

7. FRODON – ridden by Philippa Hyde 14-year-old by Nickname

Formerly trained by Paul Nicholls

Breeder: Philippe Gasdoue

A 17-time chase winner with career earnings exceeding £1 million, Frodon’s partnership with Bryony Frost produced unforgettable victories, including the 2019 Ryanair Chase at Cheltenham and the 2020 King George VI Chase. A modern-day legend, Frodon lives under the care of Philippa, guided by Bryony Frost and his owners, the Vogt family Still playful and full of personality, he has enjoyed qualifying for Hickstead and the RoR National Championships at Aintree in the show ring, embodying the life of a pampered, happy horse.

8. MELON – ridden by Sophie Candy

15-year-old by Medicean

Formerly trained by Willie Mullins

Breeder: Newsells Park Stud

Melon won over £440,000 and finished second at the Cheltenham Festival on four occasions, earning a reputation for admirable consistency at the highest level. In retirement he has continued to thrive with Sophie and has taken enthusiastically to hunting, team chasing and RoR events. Melon continues to delight in life, showing his exuberance and charm, and has represented RoR as Warwick Racecourse ambassador where he loved helping educate the next generation about racing.

9. NATIVE RIVER – ridden by Emma Clutterbuck 16-year-old by Indian River

Formerly trained by Colin Tizzard

Breeder: Fred Mackey

The 2018 Cheltenham Gold Cup winner and earner of over £1.1 million, Native River was renowned for his relentless, front-running style. Since retirement he has combined a busy ambassadorial schedule with competitive success, being crowned the 2024 Tattersalls RoR Amateur Show Series Final Champion at Hickstead. As well as competing in Ireland, he continues to thrive in the show ring and under saddle; he has even attended a school prom and visited Boodles in Bond Street!

10. NOT AT PRESENT – ridden by Molly Sherring 11-year-old by Presenting

Formerly trained by Ben Pauling

Breeder: Davy Russell

A four-time hurdle winner, Not At Present (also known as Neil the Baby) retired in 2024 and quickly adapted to dressage, hacking and showing. In 2025 he qualified for multiple RoR finals, including the Tattersalls RoR Supreme Final, highlighting both his intelligence and competitive spirit.

11. PAISLEY PARK – ridden by Gabrielle Jones 14-year-old by Oscar Formerly trained by Emma Lavelle

Breeder: M Conaghan

Winner of 11 hurdle races and over £729,000, Paisley Park became one of the most popular staying hurdlers of recent times Since retiring, he has embraced dressage and flatwork, qualifying for Aintree in 2025 through Tattersalls RoR classes. A natural showman, he enjoys being centre of attention while continuing to mentor younger horses Gabrielle says he is quite a character at home and makes sure you are sitting tight all the time, especially when leading out the youngsters, strutting his stuff!

12. RAMSES DE TEILLEE – ridden by Jess Wyatt 14-year-old by Martaline formerly trained by David Pipe

Breeder: S A S Brosseau Et Fils and C Brosseau

With five chase victories and over £237,000 in earnings, Ramses De Teillee retired in 2024 and has since taken to eventing, completing his first one day event in Wales last summer Jess believes in exploring different disciplines to find each horse’s true passion, and for Ramses De Teillee cross country has quickly become his favourite phase. He also competed in his first Tattersalls RoR show qualifiers at the Beaufort Hunt Supporters Show, placing sixth.

13. SAPHIR DU RHEU – ridden by Charlotte Alexander 17-year-old

Formerly trained by Paul Nicholls

Breeder: Claude Duval

A Grade 1 winner at Aintree, Saphir Du Rheu earned over £339,000 across a sixseason career. Since retiring in 2018, he has progressed to Intermediate eventing level and is now competing in dressage at Elementary and preparing for Medium. He also enjoys show jumping and team chasing, thriving in his new life. Charlotte says that Saphy loves life and particularly performing in front of a crowd where he grows another hand and knows everyone is admiring him.

14. SHARJAH – ridden by Phoebie Hawkins 13-year-old

Formerly trained by Willie Mullins

Breeder: Ecurie Haras De Beauvoir

Over a long and distinguished career spanning close to a decade, Sharjah recorded 13 wins under rules, including nine over hurdles, and amassed more than £990,000 in prize money, marking him as one of the most consistent and high-class performers of his generation. Now retrained for showing, dressage and arena eventing, he has consistently finished in the ribbons throughout 2025 and is always showing how genuine and willing he is He enjoys life with their other three other horses, and his owners, Phoebie and Abbie, feel incredibly lucky to be able to give him the retirement he has so thoroughly earned.

CONSTITUTIONHILL(GB)

Blue Bresil (FR) - Queen Of The Stage (IRE)

Owner: Michael Buckley

Trainer: Nicky Henderson

Dual Cheltenham Festival winner Constitution Hill will today join us between 12:30pm - 12:40pm in the parade ring for a final time before he embarks on a career on the flat. An eight time Grade One winner, Nicky Henderson’s son of Blue Bresil has been a once in a lifetime horse for Michael Buckley, with his last win over hurdles coming rather fittingly at Cheltenham in the Unibet International Hurdle on Trials Day back in January 2025.

Cheltenham Racecourse would like to thank Michael Buckley and Nicky Henderson for letting him parade here today National Hunt fans are forever grateful for the many fantastic days he has given us and we wish Constitution Hill and all those involved in him all the best for his future endeavours, wherever they may be across the globe!

RACE ONE

HURDLE FA CT S AN D ST AT IS TI CS

THE SKYBET SUPREME

RACE DESCRIPTION

The Grade 1 Skybet Supreme Novices’ Hurdle is run over two miles, 87 yards and is contested by the cream of this year’s novice hurdlers. Horses are classed as a novice if they have yet to win a race prior to the official start of the season, usually towards the end of April. In theory, this allows the inexperienced horses to race against each other before graduating to the senior ranks. All the runners in this year’s contest will carry 11st 7lb.

KOPEK DES BORDES

The 2025 Cheltenham Festival kicked off with a win for Willie Mullins and Paul Townend, who teamed up with Kopek Des Bordes to win our opener. There would be no hiding place for any of the runners, with Workhead setting a good gallop, followed in behind by Romeo Coolio, who in turn was tracked by the eventual winner Kopek Des Bordes took up the running turning for home and despite a good challenge from William Munny, he was always doing enough to win.

GRADE 1

Run over two miles, eighty-seven yards. 8 hurdles to be jumped Total prize fund of £150,000 £84,405 to the winner

WINNING CONNECTIONS

Trainers and Jockeys with some of the strongest records in the race over the last 10 years.

TRAINER

Willie Mullins 3 winners Today Willie saddles Leader d’Allier, Mighty Park & Too Bossy For Us

JOCKEY

Nico de Boinville 3 winners Today Nico rides Old Park Star

Jockey J

Trainer T

Owner O

Breeder B

Sponsor S

Equipment E

(CLASS 1) (Grade 1) (GBB RACE)

for novice four yrs old and upwards ™ Total prize fund £150000

Owners Prize Money. 1st £64560, 2nd £26610, 3rd £13305, 4th £6660, 5th £3330, 6th £1665, 7th £825, 8th £420. (Penalty Value £84405)

FORM ANALYSIS - A CLOSER LOOK

Leading course trainer (20-25): W P Mullins (46 wins from 372 runners, 12%) runs LEADER D’ALLIER, MIGHTY PARK & TOO BOSSY FOR US

Trainer-in-form (last 14 days): W P Mullins (13 wins from 38 runners, 34%) runs LEADER D’ALLIER, MIGHTY PARK & TOO BOSSY FOR US

Fancy That: N Henderson won this race in 2016, 2020 and 2022. The stable runs OLD PARK STAR today. W P Mullins won this race in 2019, 2021 and 2025. The stable runs LEADER D’ALLIER, MIGHTY PARK and TOO BOSSY FOR US today.

1 BARON NOIR (IRE) (59)

B g Vadamos (FR) - Scooping (IRE) 6 11-7

J Tom Bellamy

T Alan King, Barbury Castle

O Noel Fehily Racing Syndicate- Baron Noir

B Shane Lawlor & Mary Butterfield

S Olive Print & Graphics

2 EACHTOTHEIROWN (IRE) (51)

B g Westerner - Beautiful War (IRE) 7 11-7

J Sean Flanagan

T Barry Connell, Ireland

O Tim O’Driscoll/Barry Connell

B M. & J. Barry

3 EL CAIROS (FR) (40)

Ch g No Risk At All (FR) - Linda Queen (FR) 6 11-7

J Jack Kennedy

T Gordon Elliott, Ireland

O Mrs L. Rabson/BJM Limited

B Mr Eric Aubree & Mrs Maryse Aubree

S Gordon Elliott

4 KOKTAIL BRUT (FR) (37)

B g Cokoriko (FR) - Skarina (FR) 6 11-7

J Danny Gilligan

T Gordon Elliott, Ireland

O Gigginstown House Stud

B Mrs Karine Perreau

S Bective Stud, Gordon Elliott

5 LEADER D’ALLIER (FR) (43)

B g Cokoriko (FR) - Fromentine (FR) 5 11-7

J P. Townend E Tongue Strap

T W. P. Mullins, Ireland

O Mr Michael Hilary Burke

B Mr Yves Maupoil

6 MIGHTY PARK (IRE) (54)

B g Walk In The Park (IRE) - Knotted Midge (IRE) 5 11-7

J Mark Walsh

T W. P. Mullins, Ireland

O Mr John P. McManus

B Mr John O’Brien

7 MYDADDYPADDY (IRE) (74)

B g Walk In The Park (IRE) - Debdebdeb 5 11-7

J Harry Skelton

T Dan Skelton, Alcester

O Mr Dermot Hanafin

B Dermot Hanafin

S Ivy Lodge Farm

TFRHHIII BHA130 FORM 13-1211 D

TIMEFORM VIEW Dual bumper scorer who has taken very well to hurdling, producing a taking effort when adding to December’s Uttoxeter maiden success with a defeat of a useful rival (pair clear) in 2m Kempton novice (good) in January. Definitelymoretocomebutthisisasignificantstepupinclass

10Jan Kmp 16f Hdl good 1/7 Kocktail Bleu (FR) 2

/

l Dec25 Utt 15f Hdl soft 1/10 Bobby’s Nelson (IRE)

Nov25 War 16f Hdl gd-sf 2/13 Cristal d’Estruval (IRE) 3l

TFRHHHII BHA138 FORM 22-151 D

TIMEFORM VIEW Second in both bumpers and went one better in Galway maiden hurdle in October Still looked in need of experience when well-held fifth in Royal Bond but resumed his progression with easy Thurles handicap win in January. This much harder but the yard has had a win and second in this in recent years

18Jan Thu 15f HcpH yield 1 Fiver Friday (IRE) 9l Nov25 Fai 16f Hdl yd-sf 5/8 Koktail Brut (FR) 20l Oct25 Gal 16f Hdl yield 1 Treasure Memory (IRE) 3l

TFRHHHHI BHA-

FORM 1/15-2F1 D

TIMEFORM VIEW Smart in bumpers for Gary & Josh Moore and would have madeimpressivewinningstartoverhurdlesbutforstumblingandfallingafterthelast at Leopardstown over Christmas Survived a bad mistake at the last to win a maiden at Thurles 5 weeks later Has the potential for considerable improvement.

29Jan Thu 15f Hdl heavy 1 Roc Dino (FR) 3l

Dec25 Leo 16f Hdl yield F Murat (IRE)May25 Pun 16f Stk yield 2/12 Baron Noir (IRE) 11/

TFRHHHII BHA145

FORM 3-51104 D

TIMEFORM VIEW Useful bumper winner and quickly reached a similar standard over hurdles, winning Punchestown maiden and Grade 2 Royal Bond at Fairyhouse in November Better effort in 2m Grade 1 novices at Leopardstown since when 6 1/2 lengths fourth to Talk The Talk last month.Jack Kennedy prefers El Cairos 1Feb Leo 16f Hdl heavy 4/12 Talk The Talk (FR) 6

Dec25 Leo 16f Hdl yield 7 Skylight Hustle (IRE) 82l Nov25 Fai 16f Hdl yd-sf 1/8 Blake hd

TFRHHHII BHAFORM 1-11121 D

TIMEFORM VIEW Multiple bumper winner in France for Mathieu Pitart. Promising second in Leopardstown maiden on hurdle debut having joined WillieMullinsandeasilylandedshortoddsatPunchestown(2m,heavy)since. Potentially smart.

26Jan Pun 16f Hdl heavy 1 Straight John (FR) 9l Dec25 Leo 16f Hdl yield 2 Ballyfad (IRE) 91/2l Jul25 Vic 12f Stk - 1 Karla Conti (FR) 11/4l

TFRHHHHI BHAFORM 2-1 D

TIMEFORM VIEW Closely related to King George VI Chase winner/Cheltenham Gold Cup runner-up Might Bite.Second in sole point last spring and made a striking winning start tohis hurdle careerwhen makingall byawide marginatFairyhouse in January,jumping accurately and in command a long way out.Top prospect.

15Jan Fai 16f Hdl soft 1 Roc Dino (FR) 38l

TFRHHHHI BHA139

FORM 1-112 D BF

TIMEFORM VIEW Easy bumper win last March and once again looked an exciting prospect when landing his first 2 hurdles Beaten by Idaho Sun when odds on for Grade 1 Formby at Aintree over Christmas but this fluent jumper likely wasn’t helped by the removalofthehurdlesinthestraight.Remainscapableofbetter

8 OLD PARK STAR (IRE) (52)

B g Well Chosen - Norwich Star (IRE) 6 11-7

J Nico de Boinville

T Nicky Henderson, Lambourn

O Gordon & Su Hall

B M. Fogarty

S Unibet

9 SAGEBOROUGH (FR) (100)

B g Martinborough (JPN) - Sage Dance (FR) 5 11-7

J Sean O’Keeffe

T Paul Nolan, Ireland

O Browne & Coffey Families

B Mrs Laura Gladysz

10

SOBER GLORY (IRE) (31)

B g Mount Nelson - Milan’s Fingal (IRE) 6 11-7

J Ben Jones

T Philip Hobbs & Johnson White, Minehead

O Brocade Racing

B James Kinsella

S Philip Hobbs Racing

11 TALK THE TALK (FR) (37)

Ch g Born To Sea (IRE) - Walk The Walk (FR) 5 11-7

J J. J. Slevin

T Joseph Patrick O’Brien, Ireland

O Mr Simon Munir/Mr Isaac Souede

B E.A.R.L. de Faydeau

S The Sporting Life

12 TOO BOSSY FOR US (IRE) (34)

B g Golden Horn - Above The Clouds (FR) 5 11-7

J Harry Cobden E Tongue Strap

T W. P. Mullins, Ireland

O H. O. S. Syndicate

B Dayton Investments (Breeding) Limited

TFRHHHHH BHA151 FORM 323-111 C D

TIMEFORM VIEW Failed to win 3 bumpers for Paul Nicholls last season but has created a first-rate impression when winning all 3 hurdle starts for Nicky Henderson.Powered 18 lengths clear in Haydock Grade 2 last time and he’ll be hard to beat with further progress likely

17Jan Hay 15f Hdl gd-sf 1/6 Hurricane Pat (IRE) 18l

Dec25 Chl 16f Hdl gd-sf 1/10 Glance At Midnight 12l

Nov25 Kmp 16f Hdl good 1/6 Un Sens A La Vie (FR) 3l

TFRHIIII BHAFORM 10 D

TIMEFORM VIEW Made a winning debut in 14-runner maiden hurdle atWexfordinOctoberbutfoundthestepuptoGrade2companybeyondhim in the Royal Bond at Fairyhouse in November Pitched in even deeper 100 days on.Outsider

Nov25 Fai 16f Hdl yd-sf 7/8 Koktail Brut (FR) 32l Oct25 Wex 16f Hdl yield 1 Luker’s Tipple (IRE) 21/

TFRHHHII BHA148 FORM 11-1411 D

TIMEFORM VIEW Made it 6 wins from only 7 starts under Rules with another dominant display from the front at Newbury (2m,soft) 31 days ago This is a rise in class but he almost certainly has bigger performances in him.

7Feb Nby 16f Hdl heavy 1/8 Kadastral (FR) 27l 14Jan Nby 16f Hdl gd-sf 1/11 It’s Top (FR) 13l Dec25 San 15f Hdl soft 4/5 Hurricane Pat (IRE) 18l

TFRHHHHI BHA150

FORM 2-11F1 D

TIMEFORM VIEW Likely would have been unbeaten over hurdles but for coming down at the last in Leopardstown Grade 1 over Christmas Gained compensation for that when edging out Ballyfad in another Grade 1 there at the Dublin Racing Festival.Should go well.

1Feb Leo 16f Hdl heavy 1/12 Ballyfad (IRE) s.h

Dec25 Leo 16f Hdl yield F Skylight Hustle (IRE)Nov25 Fai 16f Hdl yd-sf 1/6 I’m Slippy (IRE) 71/2

TFRHHIII BHA134

FORM 0-51 D

TIMEFORM VIEW Made his hurdle debut in the Triumph at this meeting last year,finishing seventh.Useful form in defeat on the Flat later in 2025 and made a successful return to hurdling in maiden company at Punchestown (2m,heavy) last month.Plenty more will be needed here,though.

4Feb Pun 16f Hdl sf-hv 1 Mino des Mottes (FR) 2

Sep25 Cur 16f Hcp yield 24/30 Puturhandstogether (IRE) 21l

Sep25 Leo 13f Hcp gd-yd 3 Happy Pharoah (IRE) 13/4l

DECLARED RUNNERS 12 2025: KOPEK DES BORDES (FR) 5 11 7 P Townend 4-6 (W P Mullins) 11 ran

Probable S.P’s: 7-4 Old Park Star (IRE), 5-1 Mighty Park (IRE), 6-1 Talk The Talk (FR), 10-1 El Cairos (FR), 11-1 Mydaddypaddy (IRE), 14-1 Sober Glory (IRE), 16-1 Leader d’Allier (FR), 40-1 Baron Noir (IRE), 50-1 Eachtotheirown (IRE), 100-1 Koktail Brut (FR), Too Bossy For Us (IRE), 300-1 Sageborough (FR)

Nicky Henderson’s last 3 winners of the Supreme, Altior, Shishkin and Constitution Hill, have been out of the top drawer and OLD PARK STAR could be of a similar calibre himself judged on the way he quickened right away from very useful opposition at Haydock last time. This fluent-jumping 6-y-o has winning Cheltenham form already and can prove too strong for Mighty Park, who was hugely impressive on his Fairyhouse debut, and last month’s Leopardstown Grade 1 winner Talk The Talk.

find out more about today’s race sponsor at Skybet om

GREATBRITISHBONUSSCHEME

The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly. And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.

You must be 18 or over to place a bet

You may be asked to provide proof of your age when placing a bet

If you cannot produce this your bet will not be accepted

THE PRESTBURY CUP

The Festival at Cheltenham Racecourse has seen a great rivalry between the home team of British-trained runners and those crossing the Irish Sea for many years.

To celebrate this rivalry, the competition between the two countries is officially titled The Prestbury Cup

The Prestbury Cup runs from the first race of the four-day meeting, through until either country has 15 winners or more.

There are a total of 28 races during The Festival.

The Prestbury Cup, named after the nearest village to Cheltenham Racecourse, will be presented to jockeys and trainers from Ireland or Britain once the winning country is confirmed. The Cup itself has been sealed with some hallowed Cheltenham turf, so the winning country will be taking a little bit of Cheltenham with them.

Where Ambition Meets Capital

Here’s to performance, precision, and the relentless pursuit of winning.

Good luck to all taking part.

RACE TWO

THE SINGER ARKLE CHALLENGE TROPHY NOVICES’ STEEPLE CHASE

RACE DESCRIPTION

The Grade 1 Singer Arkle Challenge Trophy Novices’ Steeple Chase is run over the minimum trip of two miles and features this season’s leading novice chasers, all tackling twelve demanding fences at breathtaking speed. Many great horses in the past have used this race as a stepping-stone to Champion Chase glory the following season and the Arkle is one of the highlights of the whole Festival. As is usual in a Grade 1 chase, all horses carry the same weight – 11st 7lb, except Kargese, who as a mare, receives 7lb and thus carries 11st.

JANGO BAIE

Despite the absence of Sir Gino, it was still Nicky Henderson who managed to claim victory with a gallant staying performance from Jango Baie He looked beat as they turned for home but Nico de Boinville had other ideas, slowly bringing him back into contention before pouncing up the run in His job was made slightly easier after a few jumping errors from Majborough throughout the race but take nothing away from the winner

Run over one mile, seven furlongs & 199 yards. 12 fences to be jumped Total prize fund of £200,000 £112,540 to the winner

WINNING CONNECTIONS

Trainers and Jockeys with some of the strongest records in the race over the last 10 years.

Mullins

JOCKEY

Nico de Boinville 3 winners Today Nico rides

FESTIVAL HISTORY

The Singer Arkle Challenge Trophy Novices’ Chase was introduced to The Festival in 1969 as a replacement for the Cotswold Chase. It goes without saying that the race was named in honour of the legendary Arkle, a three-time winner of the Gold Cup in the mid-1960s.

The inaugural race, which was initially run on the second day of The Festival before being switched to its current slot in 1980, was won by the Fred Rimell-trained Chatham who was ridden by the late Terry Biddlecombe. In 1972 Fred Winter and Richard Pitman teamed up to win the Arkle with Pendil, a subsequent dual-winner of Kempton’s King George VI Chase where a race is now named in his honour 1978 Arkle winner, Alverton, certainly deserves a mention as the Peter Easterby-trained gelding is the only horse in the race’s history to go on to win the prestigious Gold Cup, a feat he achieved 12 months later when ridden by Jonjo O’Neill. Easterby was to win the Arkle twice more with Clayside in 1981 and Ryeman in 1983.

The 1991 renewal was notable for a trio of reasons. Firstly, Waterford Castle stepped into become the first sponsor of the race and secondly, the Richard Dunwoody-ridden Remittance Man provided Nicky Henderson with the first of his record seven Arkle winners. But the most noticeable fact was that Remittance Man became the first horse to go on and win the Queen Mother Champion Chase. The Arthur Moore-trained Klarion Davis achieved the same feat in 1995 and 1996.

A. P. McCoy won the first of his three Arkles when partnering the Martin Pipe-trained Or Royal to victory in 1997 and he didn’t have to wait long for his second, following up on Champleve the following year, again for Martin Pipe Flagship Uberalles gave Paul Nicholls his first Arkle success in 1999 and became the third horse to follow up in the Champion Chase, while Azertyuiop gave Nicholls the double when winning both races in 2003 and 2004.

Jessica Harrington’s Moscow Flyer was a hugely popular Arkle winner for Barry Geraghty in 2002, by which time the sponsorship baton had passed to the Irish Independent newspaper A year later, Moscow Flyer was welcomed back into the Winners’ Enclosure following his success in the Champion Chase, and again in 2005 when he regained his crown

In fact, the 2000s proved a hot period for the race as, in addition to Moscow Flyer, Voy Por Ustedes for Alan King and Robert Thornton achieved the Grade 1 double in 2006 and 2007, as did Sizing Europe for Henry de Bromhead and Andrew Lynch in 2010 and 2011

Few will forget Sprinter Sacre’s scintillating success in the 2012 Arkle, which was the Racing Post’s first year of sponsorship, and he has since gone on to establish himself as one of the all-time greats with two victories in the Champion Chase.

The same trainer and jockey teamed up with Simonsig the following year and not only did his victory mean Nicky Henderson became the joint-leading trainer in the race but Barry Geraghty became the winning most rider. Henderson has since moved out on his own as Altior gave his trainer a sixth victory in 2017 before Shishkin made it seven in 2021.

Willie Mullins’ Champagne Fever was denied by 33/1 shot Western Warhorse in 2014 but he had no such problems in the following two years as Un De Sceaux and Douvan both landed the prize for Ireland’s Champion Trainer. The brilliant Footpad gave Mullins a third success in 2018, a victory which also moved jockey Ruby Walsh alongside Barry Geraghty on four wins, while 2019’s winner, Duc Des Genievres made it four wins since 2015 for Mullins, Paul Townend in the saddle this time, recording his first Arkle triumph.

2020’s renewal was taken by a mare for the first time since Anaglogs Daughter’s 1980 triumph as Put The Kettle On emerged victorious in brave style. In 2021 Shishkin and 2025 winner Jango Baie have both followed in the footsteps of Sprinter Sacre and Altior to win the race for top trainer Nicky Henderson. Alan King returned to the roll of honour in 2022 with Edwardstone, who gave him a third success in the race

El Fabiolo and 2024 winner Gaelic Warrior made it wins six and seven for Willie Mullins but Nicky Henderson reclaimed the race with Jango Baie last year

(CLASS 1) (Grade 1) (GBB RACE)

for novice five yrs old and upwards ™ Total prize fund £200000

Owners Prize Money. 1st £86080, 2nd £35480, 3rd £17740, 4th £8880, 5th £4440, 6th £2220, 7th £1100. (Penalty Value £112540)

Jockey J

Trainer T

Owner O

Breeder B

Sponsor S

Equipment E

FORM ANALYSIS - A CLOSER

Leading course trainer (20-25): W P Mullins (46 wins from 372 runners, 12%) runs KOPEK DES BORDES & KARGESE

Trainer-in-form (last 14 days): W P Mullins (13 wins from 38 runners, 34%) runs KOPEK DES BORDES & KARGESE

Fancy That: N Henderson won this race in 2017, 2021 and 2025. The stable runs LULAMBA today. W P Mullins won this race in 2016, 2018, 2019, 2023 and 2024. The stable runs KOPEK DES BORDES and KARGESE today.

1 HANSARD (IRE) (73)

B g The Gurkha (IRE) - Quiet Down (USA) 8 11-7

J Caoilin Quinn

T Gary & Josh Moore, Horsham

O Noel Fehily Racing Syndicates Hansard

B Lynchbages Edgeridge Ltd & Glenvale Stud

S Olive Print & Graphics TFRHHIII BHA137

2 JAX JUNIOR (GB) (17)

B g Jack Hobbs - Double Storm 7 11-7

J Tom Cannon E Tongue Strap

T Lucy Wadham, Newmarket

O Cheryl Burton & Julian Lefevre

B Mrs C R Burton

S Brown & Brown

3 KOPEK DES BORDES (FR) (113)

B g No Risk At All (FR) - Miss Berry (FR) 6 11-7

J P. Townend E Hood

T W. P. Mullins, Ireland

O Monabeg Investments Limited

B EARL Les Bordes de Mornay & G. Hanquiez

4 LULAMBA (FR) (31)

B g Nirvana Du Berlais (FR) - Ejland (FR) 5 11-7

J Nico de Boinville

T Nicky Henderson, Lambourn

O Mrs J Donnelly

B Thierry Cypres

S Unibet

5 MAMBONUMBERFIVE (FR) (31)

B g Born To Sea (IRE) - Sweet Mambo (FR) 5 11-7

J NON RUNNER

T Ben Pauling, Naunton

O Mal Bloodstock Ltd

B Haras de Mandore

S Fitzdares

6 STEEL ALLY (FR) (31)

FORM 000-412 D

TIMEFORM VIEW Useful handicap hurdler who stepped forward from his seasonal/ chase debut when comfortably landing the odds in 3-runner maiden at Lingfield in December ImprovedagainwhensecondtoMambonumberfiveinGrade2WaywardLad atKemptonoverChristmasbutthisdemandsagooddealmore.

Dec25 Kmp 16f Ch good 2/5 Mambonumberfive (FR) 7l Dec25 Lin 16f Ch gd-sf 1/3 Taita Hills (IRE) 8l Nov25 Kmp 18f Ch good 4/5 Jax Junior 28l

TFRHHIII BHA146

FORM 1-21411 C

TIMEFORM VIEW Three-time novice hurdle winner last season and has shownevenbetterformwhennotchingthesamenumberofwinsoverfences this time round, easily taking Grade 2 Pendil at Kempton (20.5f, good) last time.He’s smart but this looks an ultra-strong renewal.

21Feb Kmp 20f Ch gd-sf 1/4 Jasmine Bliss

31Jan San 15f HcpC soft 1/11 Classic

Dec25 Asc 18f Ch soft 4/5 Steel Ally (FR) 19l

TFRHHHHI BHA158

FORM 1/111-41 CD

TIMEFORM VIEW Winner of the Supreme on this day 12 months ago Cruised clear in a Navan maiden chase on reappearance in November His absence since (had surgery to remove a bone chip from his knee) means he lacks chase experience but he could be talented enough to cope

Nov25 Nav 17f Ch sf-hv 1 Lovely Hurling (IRE) 13l

Apr25 Pun 16f Hdl yield 4/6 Irancy (FR) 31l

Mar25 Chl 16f Hdl gd-sf 1/11 William Munny (IRE) 13/4

TFRHHHHH BHA163

FORM 12-1111 D

TIMEFORM VIEW One of the leading juvenile hurdlers last season and has rapidly developed into an even better chaser,bolting up in Sandown Grade 1 novice before readily dispatching more experienced rivals in the Grade 2 Game Spirit at Newbury last month.Will be hard to beat again.

7Feb Nby 16f Ch heavy 1/6 Saint Segal (FR)

Dec25 San 15f Ch gd-sf 1/4 Be Aware (FR)

Nov25 Exe 17f Ch gd-sf 1/5 Fingle Bridge (IRE) 10l

TFRHHIII BHA146

FORM 10-1113 D

TIMEFORM VIEW NON RUNNER

NON-RUNNER

7Feb War 16f Ch heavy 3/3 Steel Ally (FR) 27l

B g Doctor Dino (FR) - Poprock du Berlais (FR) 8 11-7

J Dylan Johnston E Tongue Strap

T Sam Thomas, Cardiff

O Walters Plant Hire Ltd

B Pierre Morruzzi & Philippe Morruzzi

7 KARGESE (FR) (36)

B m Jeu St Eloi (FR) - Rive Gauche (FR) 6 11-0

J Danny Mullins E Hood

T W. P. Mullins, Ireland

O Mr K. Alexander

B Thierry Cypres

Dec25 Kmp 16f Ch good 1/5 Hansard (IRE) 7l

Nov25 Nby 16f HcpC gd-sf 1/7 Mighty Bandit (IRE) 2l

TFRHHHII BHA153

FORM P2P-111 D

TIMEFORM VIEW Very useful hurdler who has taken it up another notch sincechasing,winningall3starts,includingGrade2satAscot(19f,goodtosoft) and Warwick (2m,soft).Looks capable of even better

7Feb War 16f Ch heavy 1/3 Mirabad (FR) 10l

Dec25 Asc 18f Ch soft 1/5 Push The Button (IRE) 9l Nov25 Car 15f Ch soft 1/5 Unexpected Party (FR) 5l

TFRHHHII BHA149

FORM 21-3212 C D

TIMEFORM VIEW Smart hurdler who has quickly shown herself to be even better over fences, winning a Leopardstown maiden over Christmas before goingdownbyonlyanecktoRomeoCooliointheIrishArkletherelastmonth. Needs considering in receipt of weight all round.

2Feb Leo 17f Ch soft 2/3 Romeo Coolio nk

Dec25 Leo 17f Ch yield 1 Lovely Hurling (IRE) 14l

Dec25 Crk 16f Ch soft 2/8 Kala Conti (FR) 16l 1/5

Stewards Note:

MAMBONUMBERFIVE: Following its run on 7/2/2026 it was reported that the horse jumped poorly

Probable S.P’s: 11-8 Lulamba (FR), 2-1 Kopek des Bordes (FR), 11-2 Kargese (FR), 14-1 Steel Ally (FR), 20-1 Jax Junior (GB), 100-1 Hansard (IRE)

Two hugely exciting sorts clash here. LULAMBA has already had the chance to prove he’s a top-class novice chaser courtesy of a pair Graded wins and can put that experience to good use and see off last year’s Supreme hero Kopek des Bordes, who has been restricted to just the one run over fences Kargese looks best of the rest in what promises to be a cracker

out

RA

y’ SRACESPO

find out more about s race sponsor at si om

GREATBRITISHBONUSSCHEME

The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.

EACH-WAY BETTING TERMS

Working alongside the Racecourse Association (RCA), bookmakers have introduced standard each-way betting terms across Jockey Club Racecourses. Bookmakers will provide these terms, or better, when offering each-way betting.

Fewer than 3 runners: win bets only, no places offered

3 or 4 runners: all to win Where a bookmaker wishes to depart from this default position he may offer place terms for 3 or 4 runners, this must be at 1/5 odds a place 1-2

5 to 7 runners (inclusive): 1/4 (one quarter) odds for finishing 1st or 2nd

8 or more runners: 1/5 odds for finishing 1st, 2nd or 3rd

Handicap races with 12 to 15 runners (inclusive): 1/4 odds for finishing 1st, 2nd or 3rd

Handicap races with 16 to 21 runners (inclusive): 1/5 odds for finishing 1st, 2nd, 3rd or 4th

Handicap races with 22 or more runners: 1/4 odds for finishing 1st, 2nd, 3rd and 4th

Scan the QR code to enter Enter Lucky

Freetoplay Online.ForregisteredUK/IEplayers.NewcustomersmustregisterusingLS40CHELT. AccessavailableviaQRcodelandingpageonly Separate£5KgameeachdayofCheltenham Entry foreachday’sgameavailablewhile5+racesremainthatday.Onestableperplayerpergame Horses allocatedatrandom.Noredraws.Playerswith3+winninghorsesinastablesharethejackpot. SettlementbasedontheofficialBHA/HRIresult.Prizespaidincashwithin48hrs.T&Csapply.

RACE THREE

THE McCOY CONTRACTORS JUVENILE HANDICAP HURDLE (REGISTERED AS

THE

RACE

DESCRIPTION

The McCoy Contractors

Juvenile Handicap Hurdle is a Premier Handicap restricted to juveniles (four-year-olds), so many of the runners in this two miles and half a furlong race will still be very inexperienced over hurdles. As with the handicap earlier in the card, the higher the rating, the bigger the weight a horse has to carry - see how Bertutea rated 136, carries 2lb more than the 134-rated Barbizon.

PUTURHANDSTOGETHER

Trainer Joseph O’Brien added his name to the roll of honour for the third time in 10 years, as Puturhandstogether followed in the footsteps of Lark In The Mornin when wining 12 months ago. Mark Walsh delivered an inch perfect ride, travelling powerfully in behind the leaders before jumping to the front at the final hurdle. He quickened clear up the hill to score by an emphatic six lengths to Robbies Rock, while Liam Swagger pipped Hot Fuss on the line to complete the podium

Run over two miles, eighty-seven yards. 8 hurdles to be jumped Total prize fund of £80,000 £45,016 to the winner

WINNING CONNECTIONS

Trainers and Jockeys with some of the strongest records in the race over the last 10 years.

TRAINER

JOCKEY Mark Walsh 3 winners Today Mark rides Saratoga

(PREMIERHANDICAP)(RegisteredastheFREDWINTERJUVENILEHURDLE)(GBBRACE) for juvenile four yrs old ™ Total prize fund £80000

Owners Prize Money. 1st £34432, 2nd £14192, 3rd £7096, 4th £3552, 5th £1776, 6th £888, 7th £440, 8th £224. (Penalty Value £45016) Weights raised 2lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable.27 Eliminated Under Rules (I)9 and (I)10.

Jockey J

Trainer T

Owner O

Breeder B

Sponsor S

Equipment E

Leading course trainer (20-25): W P Mullins (46 wins from 372 runners, 12%) runs BERTUTEA, MADNESS D’ELLE and MINO DES MOTTES

Trainer-in-form (last 14 days): W P Mullins (13 wins from 38 runners, 34%) runs BERTUTEA, MADNESS D’ELLE and MINO DES MOTTES

Fancy That: G Elliott won this race in 2018, 2020 and 2023. The stable runs BARBIZON and HARDY STUFF today. J P O’Brien won this race in 2019, 2024 and 2025. The stable runs DIGNAM and GLEN TO GLEN today.

1 BERTUTEA (FR) (36)

B g Beaumec de Houelle (FR) - La Vertu (FR) 11-12

J Sean O’Keeffe E Tongue Strap

T W. P. Mullins, Ireland

O Gigginstown House Stud

B E.A.R.L. Elevage de Pierrepont

2 BARBIZON (IRE) (36)

B g King of Change - Mahsooba (USA) 11-10

J Josh Williamson (5) E Tongue Strap

T Gordon Elliott, Ireland

O Gigginstown House Stud

B Ballinafad Stud

S Bective Stud, Gordon Elliott

3 MADNESS D’ELLE (FR) (24)

B g Moises Has (FR) - Voulay (FR) 11-9

J Danny Mullins

T W. P. Mullins, Ireland

O Mrs S. Ricci

B Mr Bertrand Pignolet

4 HARWA (FR) (35)

B or Br g Saint des Saints (FR) - Kamaloka (IRE) 11-8

J Sean Flanagan

T Paul Nolan, Ireland

O Browne & Coffey Families

B Madame Marie-Therese Mimouni

5 DIGNAM (IRE) (114)

B g Sea The Moon (GER) - Bunraku 11-7

J Richard Deegan

T Joseph Patrick O’Brien, Ireland

O Mr Martin Gowing

B Mount Coote Estates

S Fairplay Exchange

6 THE MIGHTY CELT (IRE)

(24)

Gr g Walk In The Park (IRE) - Cathmart Desjy (FR) 11-7

J Harry Skelton E Hood, Tongue Strap

T Dan Skelton, Alcester

O Gwmr Property Limited

B Mr Martin O’Sullivan

S TheAirAmbulanceService(Warks&Northants),Ladbrokes

7 WINSTON JUNIOR (IRE) (52)

B g Churchill (IRE) - Kimblewick (IRE) 11-7

J Jack Kennedy

T Faye Bramley, Lambourn

O R Bartlett, J Carthy & Mrs P Shanahan

B Grenane House Stud

2m 87y

TFRHHHII BHA136

FORM 32-1P D

TIMEFORM VIEW AW Flat winner in France. Also placed in 2 hurdles there last springandmadeasuccessfulstartforWillieMullinsinmaidenatLimerick(2m,heavy) overChristmas DisappointedinGrade1attheDublinRacingFestivalbutstillearlydays withthis excellentstable.A tonguetiegoesonnow

2Feb Leo 16f Hdl heavy P/7 Narciso Has (FR)Dec25 Lim 16f Hdl heavy 1 Crooked Path (IRE) 9l Apr25 Aut 15f Hdl - 2 Midnight Cowboy (FR) 2l

TFRHHHII BHA134

FORM 146 D

TIMEFORM VIEW Quickly reached useful level on the Flat for John Murphy and madeasmoothtransitiontohurdlingforGordonElliottwhenwinningjuvenileatNavan. Found out in graded races at Leopardstown since but no surprise were he to resume his progressionforayardtraditionallystronginthisrace

2Feb Leo 16f Hdl heavy 6/7 Narciso Has (FR) 15l Dec25 Leo 16f Hdl yield 4 Narciso Has (FR) 12l Nov25 Nav 16f Hdl heavy 1 Ben Hur (IRE) 41/4l

TFRHHHII BHA133

FORM 321 D

TIMEFORM VIEW Third at Auteuil on debut last spring. Couldn’t land the odds (4/11) but shaped well when second of 15 in juvenile at Punchestown on return for newconnectionsanddulywentonebetteratGowran(2m,heavy)lastmonth.Amark in the 130s looks on the high side but there is surely more to come.

14Feb Gow 16f Hdl heavy 1 Manoir de Mirande (FR) 2

12Jan Pun 16f Hdl sf-hv 2 Kilmeaden (IRE) 2

May25 Aut 15f Hdl - 3 Shannon Maestro (FR) 6l

TFRHHHII BHA132

FORM 221 D

TIMEFORM VIEW Runner-up both starts in France for Marcel Rolland and created a good impression when going one better in Fairyhouse maiden (2m,heavy)onyarddebut5weeksago Hismarklookstoughbuthecanlikely improve.

3Feb Fai 16f Hdl sf-hv 1 Springhill Warrior (IRE)

Nov25 Ang 17f Hdl - 2 Sea Liner (FR) 3l Oct25 Nan 17f Hdl - 2 Callisto du Nord (FR) 6

TFRHHIII BHA131

FORM 1115 D

TIMEFORM VIEW Fairly useful Flat performer who won his first 3 starts in juvenile hurdles last summer Found out when stepped up to Group 1 level in France in November Off since. Glen To Glen looks the stronger of the stable pair

Nov25 Aut 18f Hdl heavy 5/11 Leopard du Berlais (FR) 20l Aug25 Cml 17f Hdl good 1/7 Zaraquelle (FR) 7l Jul25 Utt 15f Hdl good 1/11 Manyana Blue 71/2l

TFRHHHHI BHA131

FORM 5-32203

TIMEFORM VIEW Fairly useful in France for Noel George & Amanda Zetterholm. Off3months(hadwindsurgery),shapedwellwhen93/4lengthsthirdof7toManlaga intheVictorLudorumatHaydockonfirstrunforDanSkelton,finishingwithrunningleft fromtoofarback.Nosurprisetoseehimgowell.

14Feb Hay 15f Hdl soft 3/7 Manlaga (IRE) 93/

l Nov25 Aut 18f Hdl heavy 8/11 Leopard du Berlais (FR) 22l Oct25 Aut 18f Hdl - 2/9 Leopard du Berlais (FR) 9l

TFRHHHHH BHA131

FORM 221 D

TIMEFORM VIEW Useful maiden on Flat (stays 13f) for Jessica Harrington in Ireland and has made a very encouraging start to his hurdle career, runner-up twice before making all with ease at Ascot (2m, soft) in January. Capableofhavingabigsayfromanopeningmarkwhichlooksveryworkable.

8 MANLAGA (IRE) (24)

B f Maxios - Tornada (FR) 11-6

J Nico de Boinville

T Nicky Henderson, Lambourn

O Mr John P. McManus

B Mr George Clohessy

9 SARATOGA (IRE) (31)

Gr g Camelot - Dialafara (FR) 11-6

J Mark Walsh

T Padraig Roche, Ireland

O Mr John P. McManus

B Lynch Bages Ltd & Camas Park Stud

10 GLEN TO GLEN (IRE)

(93)

B g Dawn Approach (IRE) - Galuminous (IRE) 11-5

J J. J. Slevin

T Joseph Patrick O’Brien, Ireland

O E S Racing

B J. S. Bolger

11 MUSTANG DU BREUIL (FR) (17)

B g Goliath Du Berlais (FR) - Pearl de La Roque (FR) 11-5

J James Bowen

T Nicky Henderson, Lambourn

O Mr John P. McManus

B Ch. Blin & E. Helye

12 POURQUOI PAS PAPA (FR) (24)

B g Manatee - Pourquoi Pas Elle (FR) 11-4

J Harry Cobden

T Paul Nicholls, Ditcheat

O Bell, Lyons, James, Hill

B Mr Winston & Mr Clovis Cottin

S Morson Group

13 HARDY STUFF (USA) (45)

B g Churchill (IRE) - City of Love 11-4

J Sam Ewing

T Gordon Elliott, Ireland

O Mr Ray Stokes

B Buck Pond Farm Inc

S Bective Stud, Gordon Elliott

14 AMMES (IRE) (17)

E Hood

TFRHHHHI BHA130 FORM 1-21 D

TIMEFORMVIEWWonnewcomershurdleatAuteuilforMarcelRollandlast March and has stepped up on that form for new connections, finishing secondtoManganeseinListedeventatDoncasterbeforeseeingoffPourquoi Pas Papa in the Victor Ludorum at Haydock.Definitely more to come.

14Feb Hay 15f Hdl soft 1/7 Pourquoi Pas Papa (FR)

24Jan Don 16f Hdl soft 2/5 Manganese (FR)

Mar25 Aut 15f Hdl - 1 Manita (FR) 3l

TFRHHHHI BHA130 FORM 332

TIMEFORM VIEW Useful Flat winner for Aidan O’Brien and has shown progressive form in juvenile hurdles this winter This has likely been the plan for a stable which has tasted recent success in this race with a JP McManus runner

7Feb Naa 15f Hdl sf-hv 2 Highland Crystal (IRE)

25Jan Naa 15f Hdl heavy 3 Kai Lung (FR)

Dec25 Pun 16f Hdl yield 3 Immediate Effect

TFRHHHII BHA129 FORM 501

TIMEFORM VIEW Useful Flat performer who left his first 2 runs over hurdles behind to win 17f Cork juvenile (soft) in December Seemingly saved for this since by a yard seeking a hat-trick of wins in this ultra-competitive handicap

Dec25 Crk 16f Hdl sf-hv 1 Ole Ole (FR) 1l

Nov25 Pun 16f Hdl sf-hv 7 Quinta Do Lago (FR) 23l

Nov25 Nav 16f Hdl heavy 5 Barbizon (IRE) 14l

TFRHHHII BHA129

FORM 113 BF

TIMEFORM VIEW Promising individual who landed juvenile hurdle at Auteuil in OctoberandfollowedupfornewconnectionsatDoncasterinFebruary.Metwithdefeat for the first time but advanced his form when 3 1/2 lengths third of 12 to Klub de Reve inGrade2DovecoteatKempton17days ago

21Feb Kmp 16f Hdl gd-sf 3/12 Klub de Reve (FR)

5Feb Don 16f Hdl gd-sf 1/8 Milou du Chenet (FR)

Oct25 Aut 18f Hdl - 1 Mailloche (FR) 1l

TFRHHHHI BHA128

FORM 22212 BF

TIMEFORM VIEW Yet to finish out of the first 2 in 5 outings over hurdles, winning a maiden at Wincanton before going down by 2 1/4 lengths to Manlaga in the Victor Ludorum at Haydock Should give another good account for a stable which has had several run well in this down the years 14Feb Hay 15f Hdl soft 2/7 Manlaga (IRE) 2

29Jan Wcn 15f Hdl heavy 1/17 Aguellid (FR) 7l 9Jan Exe 16f Hdl gd-sf 2/14 Johnny’s Jury (IRE) 9

TFRHHIII BHA128

FORM P410 D

TIMEFORM VIEW Edged out Ole Ole and Munsif to win big-field juvenile at the Leopardstown Christmas meeting. Raced too keenly when well-held seventh in course Grade2ontrialsday.Theyard’srecordinthismakeshimatoughonetodiscountbutJack KennedyhasseeminglybeenletofftopartnerWinstonJunior

24Jan Chl 16f Hdl soft 7/10 Maestro Conti (FR) 25l Dec25 Leo 16f Hdl yield 1 Ole Ole (FR) hd Nov25 Pun 16f Hdl sf-hv 4 Quinta Do Lago (FR) 51/2l

TFRHHHHI BHA128

FORM 112 D BF

B g No Nay Never (USA) - Crystal Diamond 11-4

J Sean Bowen

T James Owen, Newmarket

O J Melville and A Mehrad

B Barronstown Stud

S Fitzdares Limited

15 MACKTOAD (FR) (24)

Gr g Beaumec de Houelle (FR) - Toady (FR) 11-4

J Caoilin Quinn

T Gary & Josh Moore, Horsham

O TSG partnership

B Couetil Elevage & Haras de Montaigu

S KM Elite Products Ltd

16 OLE OLE (FR) (73)

B g Cloth of Stars (IRE) - Flute Bowl 11-4

J Keith Donoghue

T Gavin Cromwell, Ireland

O Vasile Ionesi

B Mr Christopher Steadman

TIMEFORM VIEW Useful on Flat and easy winner of 2 juvenile hurdles this autumn.Secondat odds onin the Listed Wensleydale at Wetherbyat theend of October but it turns out he had plenty on up against Minella Study Warmed up for this with a Flat run last month.Interesting.

21Feb Lin 12f Hcp stand 6/7 Paradias (GER) 71/2l Oct25 Wet 16f Hdl good 2/8 Minella Study 3/4l Oct25 Chp 16f Hdl good 1/10 Wolf Rayet (IRE) 11l

TFRHHIII BHA128

FORM 1145 D

TIMEFORM VIEW French bumper winner who created a good impression when readily defeating Pourquoi Pas Papa on 2m Sandown hurdle debut but disappointed in the Finale at Chepstow and Victor Ludorum at Haydock since.The cheekpieces he wore last time are quickly discarded.

14Feb Hay 15f Hdl soft 5/7 Manlaga (IRE) 28l

Dec25 Chp 16f Hdl gd-sf 4/5 Tenter Le Tout (FR) 37l

Dec25 San 15f Hdl soft 1/8 Pourquoi Pas Papa (FR)31/4l

TFRHHHII BHA128 FORM 3222

TIMEFORM VIEW Second on three consecutive starts since joining from Hugo Merienne, on the latest edged out by the reopposing Hardy Stuff at Leopardstown (2m, good) over Christmas Given a 10-week break ahead of this handicap debut.

Dec25 Leo 16f Hdl yield 2 Hardy Stuff (USA) hd

Dec25 Crk 16f Hdl sf-hv 2 Glen To Glen (IRE) 1l

Nov25 Pun 16f Hdl sf-hv 2 Quinta Do Lago (FR) 1l

17 QUINTA DO LAGO (FR) (55)

Ch g Galiway - Extreme Green 11-4

J Donagh Meyler E Cheek Pieces

T Mrs J. Harrington, Ireland

O Dan Kiely/P.V. Breen

B Framont Limited

18 PADDOCKWOOD (FR) (65)

B g Birchwood (IRE) - Bourgeauville (IRE) 11-4

J Ben Jones E Tongue Strap

T Ben Pauling, Naunton

O Brown, Halliday, Sankey & Wilding

B Emile Buttigieg & Ecurie D’Auge

S Fitzdares

19 KLYCOT (FR) (47)

Gr g The Grey Gatsby (IRE) - Queen Bubble (IRE) 11-3

J Harry Bannister

T Richard Bandey, Kingsclere

O Les amis de Cedric

B Mr Jean-Claude Seroul

S Brackenwood Windows Ltd

20 BIBE MUS (FR) (3) (in 5lb ex)

B g Camelot - Josephine Bettany 11-3

J Sam Twiston-Davies

T Paul Nicholls, Ditcheat

O Mr Colm Donlon

B Ecurie de Cachene

S Morson Group

21 BANDJO (FR) (65)

B g Bande (IRE) - Signaturedupeintre (FR) 11-2

J Finn Lambert (3)

T Georgina Nicholls, Kingston Lisle

O Mr. M Freud & Mr. S Kelner

B Scea Karwin Farm & O. Rauscent

22 MINO DES MOTTES (FR) (34)

B g It’s Gino (GER) - Ulyssa des Mottes (FR) 11-2

J Brian Hayes

T W. P. Mullins, Ireland

O Gigginstown House Stud

B E.A.R.L. Ecurie Des Mottes

TFRHHIII BHA128

FORM 1163

TIMEFORM VIEW Won first 2 starts but his limitations having seemingly been exposed the last twice. Makes handicap debut from a mark which demands plenty of improvement.Wears first-time cheekpieces

14Jan Fai 16f Hdl yield 3 Proactif (FR) 91/4l

Dec25 Leo 16f Hdl yield 6 Narciso Has (FR) 16l

Nov25 Pun 16f Hdl sf-hv 1 Ole Ole (FR) 1l

TFRHHIII BHA128

FORM 1415 D

TIMEFORM VIEW Pair of soft-ground hurdle wins at Cagnes-sur-Mer for MathieuPitartthiswinter NotobviouslywelltreatedforthisBritishdebutbut in good hands so worth a second look in the betting.

4Jan Cag 17f Hdl - 5 Isaac of York (FR) 10l 1Jan Cag 17f Hdl - 1 No Limits Steve (FR) 10l Dec25 Cag 17f Hdl - 4 Melinos de Charnie (FR)73/4l

TFRHHHII BHA127

FORM 4121 D

TIMEFORM VIEW Fairly useful winner on Flat in France who is proving steadily progressive over hurdles, winning juveniles at Exeter and Wetherby (both heavy) this winter Handicap debut.

22Jan Wet 16f Hdl soft 1/10 Cloaks of Gold (IRE) 12l

Dec25 Chp 16f Hdl gd-sf 2/5 Tenter Le Tout (FR) 7l Dec25 Exe 16f Hdl heavy 1/4 Lord Byron (IRE) 1l

TFRHHHHI BHA122

FORM 13221 D

TIMEFORM VIEW Solid record over hurdles for Ross O’Sullivan in Ireland but still found a jolt of improvement when comfortably making a winning start for the Paul Nicholls yard in a Sandown juvenile handicap (soft) on Saturday.He’s a player if coping with the quick turnaround.

7Mar San 15f HcpH soft 1/6 Only One Blue (IRE) 3l 26Jan Pun 16f HcpH heavy 2 Sopelana 21/4l

Dec25 Ain 16f Hdl soft 2/7 Lord (GER) 5l

TFRHHIII BHA126

FORM 6012F6

TIMEFORM VIEW Flat/hurdle winner in France for Mickael Seror Finished 12 1/2 lengths sixth of 9 in Listed juvenile at Cagnes-Sur-Mer on his final start there,with reopposing Paddockwood 3 1/2 lengths ahead in fifth.Others are more obvious

4Jan Cag 17f Hdl - 6 Isaac of York (FR) 12l Dec25 Cag 17f HcpH soft F Master Falcon (FR)Dec25 Cag 17f Hdl - 2 Melinos de Charnie (FR) hd

TFRHHHII BHA126

FORM U1452

TIMEFORM VIEW French bumper Fair form in 3 juvenile hurdles at Punchestown for new yard, best effort when second of 15 last time. Open to further progress in handicaps

4Feb Pun 16f Hdl sf-hv 2 Too Bossy For Us (IRE) 21/

12Jan Pun 16f Hdl sf-hv 5 Kilmeaden (IRE) 24l Dec25 Pun 16f Hdl yield 4 Immediate Effect 101/2

DECLARED RUNNERS 24 2025: PUTURHANDSTOGETHER (IRE) 4 11 6 Mark Walsh 17-2 (Joseph Patrick O’Brien) 22 ran Running for the first time since Gelding No 5.

Stewards Note: HARDY STUFF: Following its run on 24/1/2026 it was reported that the horse ran too free. MACKTOAD: Following its run on 14/2/2026 it was reported that the horse was unsuited by the going.

Probable S.P’s: 6-1 Saratoga (IRE), 13-2 Winston Junior (IRE), 8-1 Manlaga (IRE), 12-1 Ammes (IRE), 14-1 Bibe Mus (FR), 16-1 The Mighty Celt (IRE), Mustang du Breuil (FR), 20-1 Glen To Glen (IRE), 22-1 Madness d’Elle (FR), Pourquoi Pas Papa (FR), 28-1 Bertutea (FR), Harwa (FR), Klycot (FR), 33-1 Barbizon (IRE), Dignam (IRE), 40-1 Ole Ole (FR), 50-1 Hardy Stuff (USA), Mino des Mottes (FR), 66-1 Quinta Do Lago (FR), 100-1 Macktoad (FR), 150-1 Paddockwood (FR), Bandjo (FR)

Faye Bramley has already won a big handicap chase here this season and perhaps WINSTON JUNIOR can repeat the feat over hurdles for his emerging stable. Manlaga impressed when seeing off a couple of these in the Victor Ludorum and is second choice ahead of the same owner’s Saratoga, who looks to have been laid out for this Bibe Mus, whose 5lb penalty for his win at Sandown on Saturday gets him into the race, and Ammes also make the shortlist.

SRACESPONSOR

find more about s race sponsor at mccoycontractors.co.uk

The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB. RA out y’ coyco

GREATBRITISHBONUSSCHEME

We would like to welcome Damien and Ann Cassidy from County Kildare here today to celebrate their Golden wedding anniversary. 50 years on from their first trip here together on their honeymoon, they are back here again with some of their family to celebrate this wonderful occasion and we hope they have a great day.

uld her

Ifyou would like your message to appear here, please email Cheltenham.racecard@thejockeyclub.co.uk

Exciting new membership offering incredible value. Club/Tatts Enclosure access to each of our 16 fixtures plus a full-field of additional benefits. Just £379 / £245 Concessions* (*18-28s, Over 65s, Irish & International)

ON SALE TO EVERYONE FROM MONDAY MARCH 16

SIGN UP NOW TO REGISTER YOUR INTEREST

A global powerhouse where ormanc pr ection, and nnectivity unite to ke business co tly leading eld. que.c ultima.c ormance, and powerhouse connectivity to keep y your confidently the field. the field. om /

RACE FOUR

THE TRUSTMARQUE ULTIMA HANDICAP STEEPLE CHASE (PREMIER HANDICAP)

RACE DESCRIPTION

The Trustmarque Ultima is a Premier Handicap and is the first Handicap Steeple Chase of The Festival The aim of a handicap is to ensure a level playing field for all - achieved by allocating different weights to each of the runners based on what they have achieved on the racecourse so far. All horses possess an official BHA rating that reflects their relative abilities. The higher the rating, the bigger the weight the horse has to carry – see how top-weight Iroko, rated 157, carries 2lb more than Handstands, rated 155.

You’ll see few better rides than the one given to last year’s winner Myretown Patrick Wadge was excellent in getting his mount to the front of the field after a standing start and once there, he would not be for passing. His jumping was exemplary and try as they might, nothing gave him any serious trouble as he came home a ready winner The Changing Man was a distant second, while Irish raider Malina Girl claimed third

Trainers and Jockeys with some of the strongest records in the race over the last 10 years.

Jockey J

Trainer T

Owner O

Breeder B

Sponsor S

Equipment E

1 IROKO (FR) (80)

ULTIMA HANDICAP STEEPLE CHASE (CLASS 1) (PREMIER HANDICAP) (GBB RACE)

for five yrs old and upwards ™ Total prize fund £150000

Owners Prize Money. 1st £64560, 2nd £26610, 3rd £13305, 4th £6660, 5th £3330, 6th £1665, 7th £825, 8th £420. (Penalty Value £84405) 3m 1f

Leading course trainer (20-25): N Henderson (34 wins from 240 runners, 14%) runs HYLAND Trainer-in-form (last 14 days): L Russell & M Scudamore (11 wins from 48 runners, 23%) runs MYRETOWN

Longest Travellers: BLAZE THE WAY trained by Mrs M Mullins, SEARCH FOR GLORY & PATTER MERCHANT trained by G Elliott, THE SHORT GO trained by H De Bromhead - all Ireland.

B g Cokoriko (FR) - Boscraie (FR) 8 12-0

J Jonjo O’Neill Jr. E Tongue Strap

T Oliver Greenall & Josh Guerriero, Malpas

O Mr John P. McManus

B Jacques Cypres

S Dodson & Horrell Ltd

2 HANDSTANDS (IRE) (51)

Br g Getaway (GER) - Wattle Bridge (IRE) 7 11-12

J Ben Jones E Cheek Pieces

T Ben Pauling, Naunton

O Mr T. P. Radford

B Brendan & Mary Fitzpatrick

S Fitzdares

3 RESPLENDENT GREY (IRE) (51)

Gr g Walk In The Park (IRE) - Caltra Princess (IRE) 8 11-10

J Sean Bowen E Blinkers

T Olly Murphy, Wilmcote

O Mrs R. J. Skan

B Ms M. Kavanagh

S Betano

4 JAGWAR (FR) (45)

B g Karaktar (IRE) - Quizas Jolie (FR) 7 11-9

J Mark Walsh E Tongue Strap

T Oliver Greenall & Josh Guerriero, Malpas

O Mr John P. McManus

B Jacques Cypres and Laurent Couetil

S Dodson & Horrell Ltd

5 BLAZE THE WAY (IRE) (44)

B g Getaway (GER) - Enniscoffey (IRE) 8 11-3

J Danny Mullins

T Ms Margaret Mullins, Ireland

O M.Willis/P.Willis/B.Groarke/T.Groarke

B Brian Groarke

6 LEAVE OF ABSENCE (FR) (31)

Ch g Masked Marvel - To Much Fun 9 11-3

J Rex Dingle

T Anthony Honeyball, Beaminster

O Mr Richard & Mrs Carol Cheshire

B Mr Jean-Pierre Dubois & SCEA Haras du Ma

S geegeez.co.uk

7 JOHNNYWHO (IRE) (52)

Br g Califet (FR) - Howaya Pet (IRE) 9 11-3

J Richie McLernon E Tongue Strap, Cheek Pieces

T Jonjo & A.J O’Neill, Cheltenham

O Mr John P. McManus

B Steven Vaughan

S Wasdell Group

HHHHH BHA157 FORM F424-21 C

TIMEFORMVIEWMartinPipewinneratthe2023CheltenhamFestivaland has developed into a very smart chaser,ending last season with fine fourth in Grand National at Aintree. All the better for return when winning 3-runner class2eventatAscot(21f),displayinghisversatilitydownintrip Majorclaims Dec25 Asc 21f

TFRHHHII BHA155

FORM 11P-243

TIMEFORM VIEW Developed into a smart performer over fences last term, winning all 3 completed starts,including Grade 1 Scilly Isles at Sandown.Has been found wanting in the latter stages to varying degrees on all 3 starts this term but must be respected running in a handicap for the first time.Headgear on.

18Jan Wdr 22f Ch soft 3/5 Protektorat (FR)

Nov25 Hay 25f Ch gd-sf 4/5 Grey Dawning (IRE)

Nov25 Car 19f Ch gd-sf 2/4 Resplendent Grey (IRE)

TFRHHHII BHA153

FORM 441-102

TIMEFORM VIEW Ended last season with a win in bet365 Gold Cup at Sandown and backed that up when beating Handstands in Carlisle Listed race on return.On back footthroughoutinCoralCupatNewburybutbackontrackwhensecondinFleurDeLys ChaseatWindsor Returntofurtherwillsuit.Changeofheadgear

18Jan Wdr 22f Ch soft 2/5 Protektorat (FR)

Nov25 Nby 25f HcpC gd-sf 11/24 Panic Attack (IRE) 27l Nov25 Car 19f Ch gd-sf 1/4 Handstands (IRE)

TFRHHHHI BHA152

FORM 1311-32 C BF

TIMEFORMVIEWImprovedatarateofknotsswitchedtofenceslastseason, winning 4 from 5, notably the Plate at this meeting on final start. Excellent placed efforts in Premier Handicaps here both outings this term and this longer trip may place less pressure on his slightly flawed jumping technique.

24Jan Chl 20f HcpC soft 2/11 Donnacha (IRE) hd Dec25 Chl 20f HcpC gd-sf 3/10 Glengouly (FR) 13/4

Mar25 Chl 20f HcpC gd-sf 1/20 Thecompanysergeant 23/4

TFRHHHHI BHA146

FORM 562415 C D

TIMEFORM VIEW Nomugoverhurdlesbutchasinghastransformedhimno end and produced a career best when winning the Turners here (26.3f,good) in December,suited by the increase in trip Disappointed in graded company next time but no surprise if he bounced back.

25Jan Naa 24f Ch heavy 5/8 Argento Boy (IRE) 25l Dec25 Chl 26f HcpC gd-sf 1/9 L’homme Presse (FR) 5l Oct25 Pun 18f Ch gd-yd 4/6 King of Kingsfield (IRE) 61/4l

TFRHHHII BHA146

FORM 21-1P23 CD

TIMEFORM VIEW Progressive sort who won C&D novice on return.Better form in defeat last 2 starts,just denied in Silver Cup at Ascot before third of 4 in Grade 2 at Newbury.

7Feb Nby 23f Ch heavy 3/4 Haiti Couleurs (FR) 17l Dec25 Asc 23f HcpC gd-sf 2/12 Deep Cave (IRE) hd Nov25 Chl 25f Ch soft P/5 Wade Out (IRE) -

TFRHHHII BHA146

FORM 325-535 BF

TIMEFORMVIEWWithoutawinsincechasingdebutbutwasonlynarrowly deniedintheKimMuiratthismeetinglastyearandwentcloseagaininSilver CupatAscotinDecember BitdisappointinginPeterMarshatHaydocksince, however,and headgear now applied.

17Jan Hay 25f HcpC gd-sf 5/6 Imperial Saint (FR)

8 KONFUSION (GB) (52)

Ch g Schiaparelli (GER) - Tahira (GER) 8 11-2

J Callum Bewley

T Joel Parkinson & Sue Smith, Bingley

O Mrs A. Ellis

B Mr Carl Hinchy

S Tuffa Footwear Ltd

9 SEARCH FOR GLORY (IRE) (47)

B g Fame And Glory - Geek Chic (IRE) 9 11-2

J James Smith (5) E Blinkers, Tongue Strap

T Gordon Elliott, Ireland

O Gigginstown House Stud

B P. Connell

S Bective Stud, Gordon Elliott

10 STOLEN SILVER (FR) (10)

Gr g Lord du Sud (FR) - Change Partner (FR) 11 11-2

J Miss Olive Nicholls (5) E Tongue Strap

T Georgina Nicholls, Kingston Lisle

O Mr Scott Shearsmith & Georgina Nicholls

B S.C. Snig Elevage

S Worldwide Hospitality Ltd

11 IMPERIAL SAINT (FR) (52)

B g Saint des Saints (FR) - Quinine de Mazille (FR) 8 11-1

J Callum Pritchard (3)

T Philip Hobbs & Johnson White, Minehead

O Richard Johnson Racing Imperial Saint

B Karine Perreau & Louis Colson

S Philip Hobbs Racing

12 BLOW YOUR WAD (IRE) (10)

B g Walk In The Park (IRE) - Molly’s Mate (IRE) 8 11-1

J Freddie Mitchell (3) E Tongue Strap, Cheek Pieces

T Gary & Josh Moore, Horsham

O Mr Jerry Hinds & Mr Ashley Head

B Minch Bloodstock

S KM Elite Products Ltd

13 HYLAND (FR) (80)

Gr g Turgeon (USA) - Medine (FR) 9 11-0

J Nico de Boinville E Cheek Pieces

T Nicky Henderson, Lambourn

O The Ten From Seven

B Mr Denis Parreau Delhote

S Unibet

14 MYRETOWN (IRE) (24)

B g Dylan Thomas (IRE) - Miss Platinum (IRE) 9 10-13

J Derek Fox

T Lucinda Russell & Michael Scudamore, Kinross

O Wymer & Russell

B Longrove Stud

S Ian Macleod & Co Ltd

15 THE DOYEN CHIEF (IRE) (17)

B g Doyen (IRE) - Mandarli (IRE) 9 10-13

J Tom Bellamy

T Alan King, Barbury Castle

O Masterson Holdings Limited

B Fintina Kealey & Irene Giles

S Goodwin Racing Ltd

16 QUEBECOIS (FR)

(21)

TFRHHHII BHA145 FORM 2-1U113 BF

TIMEFORM VIEW Has taken his form to another level this season,winning first 3 completed starts, impressing with his jumping when making all in Rowland Meyrick at Wetherby on Boxing Day. Good third off revised mark in Peter Marsh at Haydock next time but more needed again if he’s to resume winning ways

17Jan Hay 25f HcpC gd-sf 3/6 Imperial Saint (FR) 21/4l

Dec25 Wet 24f HcpC soft 1/4 Marble Sands (FR) 7l Nov25 Nwc 23f HcpC gd-sf 1/8 Deafening Silence (IRE)15l

TFRHHIII BHA145

FORM 00-022P

TIMEFORM VIEW Didn’t go on after being placed at Grade 1 level as a novice last season but has rediscovered his form in valuable handicaps this season, runner-up in theFoxrockatNavanandPaddyPowerChaseatLeopardstown.However,ranpoorlyat Gowran since andjumpingwentto piecesinthis lastyear

22Jan Gow 25f HcpC heavy P/18 Now Is The Hour (IRE)Dec25 Leo 24f HcpC yield 2 Favori de Champdou (FR) 4

Dec25 Nav 20f HcpC sf-hv 2 Down Memory Lane (IRE) 1

TFRHIIII BHA145 (-8)

FORM P64-0P3 C

TIMEFORM VIEW Very smart chaser at his best but lost his way for Sam Thomas last season and well beaten all 3 outings for this stable.

28Feb Kel 23f Ch gd-sf 3/4 Protektorat (FR) 62l

3Jan San 19f HcpH good P/10 Range (IRE)Dec25 Chl 23f HcpH gd-sf 10/10 Titan Discovery 27l

TFRHHIII BHA144

FORM 342-561

TIMEFORM VIEW Won 3 times over fences at Aintree last term and back to bestwhennarrowwinnerofPeterMarshatHaydockunderthisrider,landing a gamble on just his second start at 3m+. Had nothing to spare that day, however,and this tougher

17Jan Hay 25f HcpC gd-sf 1/6 Richmond Lake (IRE) nk Dec25 Chl 20f HcpC gd-sf 6/10 Glengouly (FR) 11l Oct25 Ain 19f HcpC gd-sf 5/7 Hitman (FR) 103/4l

TFRHHHII BHA144 (+4)

FORM 55-3032

TIMEFORMVIEWWonGrade2novicechaseatKemptonin2023/24.Lightlyraced sincebuthasmadeapositivestartforthisyard,thirdof6inBetfairAscotChasebefore narrow second back in a handicap at Newbury (Greatwood Gold Cup). Worth a try over this longer trip and can outrun his odds

28Feb Nby 19f HcpC gd-sf 2/11 Heltenham (FR)

14Feb Asc 21f Ch gd-sf 3/6 Jonbon (FR) 15l

Dec25 Asc 23f HcpC gd-sf 7/12 Deep Cave (IRE) 81/4l

TFRHHHII BHA143

FORM 22P-004 C

TIMEFORM VIEW Enjoyed a fine campaign over fences last term,2 of his 3 wins coming over C&D Back to something like that sort of form when fourth in Silver Cup at Ascot in December, likely to have gone close but for a bad mistake 2 out.Not taken lightly off the same mark with headgear applied. Dec25 Asc 23f HcpC gd-sf 4/12 Deep Cave (IRE) 11/4l Nov25 Nby 25f HcpC gd-sf 7/24 Panic Attack (IRE) 16l Oct25 Chl 25f HcpC good 9/18 Three Card Brag (IRE) 11l

TFRHHHHI BHA142

FORM F11-F4P CD BF

TIMEFORM VIEW Looked a smart prospect when a runaway winner of this 12 months ago (off 15lb lower). Prone to the odd mistake, though, and that held him back first 2 starts this term.Stopped quickly trying a marathon trip at Haydock latest but better expected now 14Feb Hay 28f HcpC gd-sf P/11 Grand Geste (IRE)17Jan Hay 25f HcpC gd-sf 4/6 Imperial Saint (FR) 31/2l Nov25 Nby 25f HcpC gd-sf F/24 Panic Attack (IRE) -

TFRHHHII BHA142

FORM 1-2P512

TIMEFORMVIEWStrong-travellingsortwhohasbarelyhadanoff-dayinhis chasingcareersofarandfoundonlyalightly-racedtypewithgraded-winning form from his hurdling days too strong at Kempton 17 days ago

21Feb Kmp 24f HcpC gd-sf 2/13 Lookaway (IRE) 2l 10Jan Kmp 24f HcpC good 1/5 Your Darling (IRE) nk Dec25 Chl 26f HcpC gd-sf 5/9 Blaze The Way (IRE) 73/4l

Ch g No Risk At All (FR) - Miss Poutine (FR) 7 10-10

J Harry Cobden E Tongue Strap

T Paul Nicholls, Ditcheat

O McNeill,Stevens,McKenzie,Flowers&Walsh

B Haras de Moricand

S Morson Group

TFRHHHII BHA139 FORM 21-2422 BF

TIMEFORM VIEW Improved when making a winning handicap hurdle debut at Ayrfinalstartlastseason.EasilybesteffortoverfencesthistermsecondinTimeform Novices’Handicap here in January. Unsuited by drop in distance at Newbury since and remains with potential back in a handicap/over a more suitable trip 17Feb Nby 16f Ch soft 2/3 Personal Ambition (IRE) 17l 24Jan Chl 20f HcpC soft 2/9 Jordans Cross (IRE) nose Dec25 San 24f Ch gd-sf 4/4 Salver (FR) 60l

17 THE SHORT GO (IRE)

(88)

B g Fame And Glory - Izzy du Berlais (IRE) 9 10-9

J Darragh O’Keeffe E Hood, Tongue Strap

T Henry de Bromhead, Ireland

O Mr N. Byrne

B Louis G. Vambeck

18 PATTER MERCHANT (IRE) (23)

B g Walk In The Park (IRE) - Bowenscourt (IRE) 7 10-5

J Jack Kennedy E Cheek Pieces

T Gordon Elliott, Ireland

O Gigginstown House Stud

B Brittas House Stud and Grenane House

S Bective Stud, Gordon Elliott

19 FILANDERER (GB) (53)

B g Kayf Tara - Flirtatious 10 10-2

J Jonathan Burke

T Hughie Morrison, East Ilsley

O Mrs M. D. W. Morrison

B Mrs M. D. W. Morrison

S Bridgend Hotel

20 KNIGHT OF ALLEN (FR) (31)

B g Masterstroke (USA) - Atacames (FR) 6 10-2

J Ciaran Gethings

T Mrs Jane Williams, South Molton

O Holt, Macnabb, Robinson & Jeffrey

B Bruno Vagne

S Culverhill Farm Racing

21 MARGARET’S LEGACY (FR) (53)

Ch g Prince Gibraltar (FR) - Caphira 9 10-2

J Harry Bannister

T Warren Greatrex, Upper Lambourn

O The Old Romantics

B M. Richard Venn Bloodstock Ltd & M. J. W

S Warren Greatrex Racing

22 EYED (GB) (52)

B g Kayf Tara - One Gulp 9 10-2

J Sam Twiston-Davies

T Hughie Morrison, East Ilsley

O Mr Martin Hughes

B R. J. McAlpine

S Old Oak Holdings Ltd

DECLARED RUNNERS 22

TFRHHHII BHA138 FORM 2F5-P43 BF

TIMEFORMVIEWWinlesssincemakingasuccessfuldebutinthisspherein ClonmelnovicebuthasagoodrecordatCheltenham,makingtheframehere both starts this season and was also a creditable fifth in this last year off 6lb lower Others look better treated,however

Dec25 Chl 26f HcpC gd-sf 3/9 Blaze The Way (IRE) 5

Oct25 Chl 25f HcpC good 4/18 Three Card Brag (IRE) 3

May25 Pun 31f HcpC yield P/23 Shanbally Kid (IRE) -

TFRHHIII BHA134

FORM 5-32530

TIMEFORM VIEW Useful hurdler but has only a maiden win to his name (ninth in the last year’s Pertemps Final here).Decent start over fences in the autumn but form has dipped since,well held tried in this headgear in Listed handicap at Punchestown latest.

15Feb Pun 27f HcpC heavy 11/14 My Immortal (IRE) 20l

17Jan Nav 24f Ch sf-hv 3 Joystick (FR) 23l

Dec25 Leo 21f Ch yield 5 Koktail Divin (FR) 38l

TFRHHIII BHA128 (+1)

FORM 111-151

TIMEFORM VIEW Continued his progression from last season when landing a 4-timer by a wide margin at Ffos Las on return. Undone by jumping at Newbury next time but resumed winning ways with another stylish win at Market Rasen. Likely to find this too competitive from 3lb out of the weights,though.

16Jan Mkt 21f HcpC soft 1/8 Mahons Glory (IRE) 11l Nov25 Nby 19f HcpC gd-sf 5/6 Twinjets (IRE) 23l Oct25 Fls 19f HcpC soft 1/8 Miralago (FR) 16l

TFRHHIII BHA127

FORM 31-2142

TIMEFORM VIEW Has taken to fences very well this season, building on debut when winning Newbury handicap Similar form in defeat since, unlucky to bump into one so vastly improved at back at Newbury last time. However,looks up against it here from 4lb out of the handicap

7Feb Nby 23f HcpC heavy 2/10 Holloway Queen (IRE) 14l

1Jan Chl 20f Ch good 4/5 Miami Magic (IRE) 93/

Dec25 Nby 19f HcpC gd-sf 1/9 Aviation (IRE) 3/

TFRHIIII BHA126

FORM 2/11-246

TIMEFORM VIEW Positive start for this yard last term, bagging handicap chases at Southwell and Haydock (both at around 2 1/2m).Good start to this campaignwhenrunner-upatBangor butnotin sameformeitherstart since. Has it all to do from 5lb out of the handicap

16Jan Wdr 22f HcpC soft 6/10 Officer of State 15l

Dec25 Ain 19f HcpC soft 4/6 Uncle Bert 24l

Nov25 Bgr 20f HcpC soft 2/9 Fine Casting (IRE) 11/2

TFRHIIII BHA122

FORM 224-205

TIMEFORM VIEW Much improved over fences for this yard last season, winning 3 times However, form has levelled off since and out of his depth here (9lb out of the handicap).

17Jan Asc 23f HcpC soft 5/11 The Jukebox Kid (IRE) 10

/

Nov25 Nby 22f HcpC gd-sf 7/12 Booster Bob (IRE) 27l Nov25 Kmp 21f HcpH good 2/7 Idy Wood (FR) 2

2025: MYRETOWN (IRE) 8 10 3 Patrick Wadge 13-2 (Lucinda Russell) 24 ran

Running for the first time since Wind Surgery No. 7, 17. Stewards Note: MYRETOWN: Following its run on 14/2/2026 it was reported that the horse raced too enthusiastically KNIGHT OF ALLEN: Following its run on 7/2/2026 it was reported that the horse made a bad mistake.

Probable S.P’s: 9-2 Jagwar (FR), 7-1 Iroko (FR), 11-1 Handstands (IRE), 12-1 Myretown (IRE), 14-1 Johnnywho (IRE), Hyland (FR), Quebecois (FR), 20-1 The Short Go (IRE), 22-1 Blaze The Way (IRE), 25-1 Konfusion (GB), 28-1 Resplendent Grey (IRE), 33-1 Leave of Absence (FR), Blow Your Wad (IRE), Knight of Allen (FR), 40-1 Imperial Saint (FR), The Doyen Chief (IRE), Patter Merchant (IRE), 50-1 Search For Glory (IRE), 80-1 Margaret’s Legacy (FR), 100-1 Filanderer (GB), Eyed (GB), 200-1 Stolen Silver (FR)

PLAY SMARTER

One of the few races Britain has dominated, and they appear to hold the aces once again with the Greenall & Guerriero stable holding a strong hand with IROKO and Jagwar, the former shading the vote at the forecast odds. Things haven’t gone to plan for Myretown this season but he still makes the shortlist with last year’s romp still fresh in the memory, while Blaze The Way looks the pick of the Irish.

TIMEFORM PREDICTION: 1.IROKO (FR) 2.JAGWAR (FR) 3.MYRETOWN (IRE)

THE JOCKEY CLUB RACECOURSES

SOUTH WEST REGION FREQUENT RUNNER SCHEME

The Jockey Club South West Frequent Runner Scheme is aimed at rewarding trainer who run horses regularly at Jockey Club Racecourses in the South West Region – Cheltenham, Exeter, Warwick, and Wincanton.

There are two frequent runner categories, Trainers with 40 or more horses and Trainers with 40 or fewer horses in training

The Championships for the 2025/26 season will start at Warwick on the 23rd September, and will conclude at the last Warwick fixture in June 2026.

All qualifying races are allocated a star rating (* to *****) with trainers awarded full points (star rating) for their first runner and half points for additional runners in the same race. These are based on the average numbers of runners a race has attracted over the previous two or three years as follows:

1 star - 18 plus runners 2 stars - 15-17 3 stars - 12-14 4 stars – 8-11 5 stars – less than 8

The star ratings for each qualifying race are marked with the race conditions. CURRENT STANDINGS (as of 9 March 2026)

FA CT S AN D ST AT IS TI CS

RACE FIVE

THE UNIBET CHAMPION HURDLE CHALLENGE TROPHY

RACE DESCRIPTION

The third Grade 1 race on today’s card, the Unibet Champion Hurdle is the historic Championship race for two-mile hurdlers and is the highestquality race of its type run anywhere in the world. The crème de la crème of Europe’s speed hurdlers will all be in the line-up chasing a first prize of £262,077. All of the runners are set to carry 11st 10lb, except Brighterdaysahead, Golden Ace and Lossiemouth who receive 7lb as mares and carry 11st 3lb.

GOLDEN ACE

It’s rare you see one horse fall in a Champion Hurdle but last year we saw two of the market principles fail to complete the course. First Constitution Hill fell at the fourth, then State Man came down at the last when five lengths clear. This left Golden Ace in front, who eventually came home a ready winner by nine lengths, albeit in fortunate circumstances. The other talking horse of the race Brighterdaysahead was disappointing on the day, finishing a well beaten fourth

GRADE 1

Run over two miles, eighty-seven yards. 8 hurdles to be jumped Total prize fund of £465,750 £262,077 to the winner

WINNING CONNECTIONS

Trainers and Jockeys with some of the strongest records in the race over the last 10 years.

TRAINER

Willie Mullins 2 winners Today Willie saddles Lossiemouth, Poniros & Anzadam

JOCKEY

Paul Townend 1 winner Today Paul rides Lossiemouth

FESTIVAL HISTORY

The Unibet Champion Hurdle is without doubt the most prestigious hurdle race in the calendar. Run over a distance of two miles and 87 yards, with eight flights to be jumped, the race was first run in 1927.

That inaugural race was won by Blaris, earning connections the grand sum of £365. Twelve months later, Brown Jack added his name to the Roll of Honour before switching codes to win the Queen Alexandra Stakes six times from 1929-34. Only three runners went to post in 1932 – the smallest field in the race’s history. Insurance proved victorious that day and confirmed his superiority by following up twelve months later

The post-war years saw the race’s first triple winner. Hatton’s Grace, trained by the legendary Vincent O’Brien, dominated from 1949-51. He was swiftly followed by Sir Ken who recorded a hat-trick of wins for Willie Stephenson from 1952-54 and still holds the record of being the shortest-priced winnersent off a 2/5 favourite in 1953. He was ridden by Tim Molony who with four victories is the winning most rider.

The late 60s saw the emergence of another superstar in the shape of Persian War who ruled the race for trainer Colin Davies, winning three times from 1968-1970. The 70s provided some well-known winners and even today few will need little introduction. Bula recorded back-to-back wins in 1971-72, Comedy Of Errors’ two wins in 1973 and 1975 were sandwiched around the victory of a certain Lanzarote, before Night Nurse 1976-77, Monksfield 1978-79 and Sea Pigeon 1980-81 all recorded doubles

In 1984 Dawn Run, trained by Paddy Mullins, emerged on the scene and started re-writing the history books. That year she became only the second mare to win the Unibet Champion Hurdle – also adding the Irish and French versions, and two years later she added the Gold Cup and remains the only horse to have completed the Champion Hurdle-Gold Cup double.

Nicky Henderson’s See You Then dominated the race from 1985-87 to become the race’s fourth three-time winner.

The most recent three-time winner came in 1998-2000 when Istabraq helped launch the career of a certain Aidan O’Brien. He was odds-on to become the first four-time winner of the race in 2001 but was cruelly denied due to the entire Festival being lost to the foot-and-mouth outbreak.

In recent times, Hurricane Fly excelled in 2011 and although he missed the following year through injury, he returned in 2013 to regain his crown. He could finish only fourth in 2014 and in his final attempt at the race, he finished a gallant third behind stablemate Faugheen in 2015.

Willie Mullins also saddled the winner in 2016 as Annie Power became the first mare since Flakey Dove in 1994 and just the fourth overall to win the Unibet Champion Hurdle.

2017 and 2018 saw Nicky Henderson’s Buveur d’Air cross the line first and extend his trainer’s tally of victories in the race to seven. He fell in the 2019 renewal when bidding for the hat-trick and instead, it was JP McManus’ other representative, the Gavin Cromwelltrained Espoir d’Allen, who became the first five-year-old since Katchit in 2008 to win Epatante made it back-to-back wins for JP McManus’ in 2020 before finishing third in 2021 and second in 2022. The winner on both those occasions was the superstar mare Honeysuckle for Henry de Bromhead who had done a brilliant job with the Queen of Ireland before her retirement in 2022. Constitution Hill announced himself as the latest superstar in 2023 but fell last year in dramatic circumstances, as did 2024 winner State Man Leaving the way open for Golden Ace, giving Jeremy Scott his biggest career win

THE UNIBET CHAMPION HURDLE CHALLENGE

(CLASS 1) (Grade 1) (GBB RACE)

for four yrs old and upwards ™ Total prize fund £465750

Owners Prize Money. 1st £200459, 2nd £82624, 3rd £41312, 4th £20679, 5th £10340, 6th £5170, 7th £2562, 8th £1304. (Penalty Value £262077.52)

Jockey J

Trainer T

Owner O Hunt H

Sponsor S

Equipment E

1 ALEXEI (GER) (24)

Leading course trainer (20-25): W P Mullins (46 wins from 372 runners, 12%) runs ANZADAM, PONIROS & LOSSIEMOUTH

Trainer-in-form (last 14 days): W P Mullins (13 wins from 38 runners, 34%) runs ANZADAM, PONIROS and LOSSIEMOUTH

Fancy That: H De Bromhead won this race in 2021 and 2022. The stable runs WORKAHEAD today. W P Mullins won this race in 2016 and 2024. The stable runs ANZADAM, PONIROS & LOSSIEMOUTH today.

B g Tai Chi (GER) - Andromeda (GER) 6 11-10

J Brendan Powell E Tongue Strap

T Joe Tizzard, Sherborne

O Brocade Racing

B J.Stecklein

S Coral Racing Limited

2 ANZADAM (FR) (37)

B g Authorized (IRE) - Astaradame (FR) 6 11-10

J Mr P. W. Mullins E Hood, Tongue Strap

T W. P. Mullins, Ireland

O Mrs J. Donnelly

B Mr Richard Corveller

3 PONIROS (GB) (37)

B g Golden Horn - Rue Renan (IRE) 5 11-10

J Danny Mullins

T W. P. Mullins, Ireland

O Tony Bloom

B Wilgerbosdrift (UK) Ltd

4 THE NEW LION (GB) (45)

B g Kayf Tara - Raitera (FR) 7 11-10

J Harry Skelton

T Dan Skelton, Alcester

O Mr John P. McManus

B R. D. & Mrs J. S. Chugg

S Ladbrokes

5 TUTTI QUANTI (FR) (31)

B g Chanducoq (FR) - Terebella (FR) 6 11-10

J Harry Cobden

T Paul Nicholls, Ditcheat

O Mr Colm Donlon

B E.A.R.L. Elevage Figerro & Hubert Favre

S Morson Group

6 WORKAHEAD (IRE) (24)

B g Workforce - Cluain Easa (IRE) 8 11-10

J Darragh O’Keeffe

T Henry de Bromhead, Ireland

O Mr Barry Maloney

B J. H. Walsh

7 BRIGHTERDAYSAHEAD (FR) (37)

B m Kapgarde (FR) - Matnie (FR) 7 11-3

J Jack Kennedy

T Gordon Elliott, Ireland

O Gigginstown House Stud

B Mr Francois-Marie Cottin

S Bective Stud, Gordon Elliott

TFRHHIII BHA148

FORM 0-21131 CD

TIMEFORM VIEW Has come back a bigger force this season, bagging valuable Greatwood here in November and shaped well when finishing third in another premier handicap back at Ascot.Didn’t need to improve to land the odds in Grade 2 Kingwell Hurdle latest but this asks a totally different question.

14Feb Wcn 15f Hdl heavy 1/4 Rubaud (FR)

Dec25 Asc 15f HcpH gd-sf 3/13 Wilful (IRE) 4l Nov25 Chl 16f HcpH soft 1/18 Helnwein (IRE) 6l

TFRHHIII BHA157

FORM 1/11-244 D

TIMEFORM VIEW Extended unbeaten record to 4 in Grade 3 at Naas in January 2025 but has gone from an exciting, unknown quantity to looking a hard ride and not quite at Grade 1 company this season, dropped out and never really a threat in the Irish Champion Hurdle.Tongue tie reinstated.

1Feb Leo 16f Hdl heavy 4/5 Brighterdaysahead (FR) 14l

Dec25 Leo 16f Hdl gd-yd 4

Nov25 Nwc 16f Hdl gd-sf 2/5

TFRHHHII BHA154

FORM 1-23 C

TIMEFORMVIEWUsefulonFlatandcausedthebiggestshockinthehistoryofthe TriumphHurdlewhenrunningouta100/1winnerondebutinthissphereayearago Proved that was no fluke when second in Grade 1 at Punchestown and shaped as though he’d come on for run behind the very smart mares at Leopardstown.

1Feb Leo 16f Hdl heavy 3/5 Brighterdaysahead (FR) 14l

Jun25 Asc 19f Hcp gd-fm 17/20 Ascending (IRE) 45l

May25 Pun 16f Hdl yield 2/12 Lulamba (FR) 4l

TFRHHHHI BHA159

FORM 1111-F1 C

TIMEFORMVIEWUnbeatenin4startsasanoviceandparticularlyimpressivein BaringBinghamayearago Stillfindinginfrontwhenfallingheavily2outinFighting Fifth on reappearance and was ultimately presented with a straightforward task in the International on Trials Day.The one open to improvement.

24Jan Chl 16f Hdl soft 1/4 Nemean Lion (GER)

Nov25 Nwc 16f Hdl gd-sf F/5 Golden Ace

Mar25 Chl 21f Hdl gd-sf 1/11 The Yellow Clay (IRE)

TFRHHIII BHA151

FORM 261-611 D

TIMEFORM VIEW Disappointing in Welsh Champion on Chepstow reappearance but back to form with a bang to win Gerry Feilden at Newbury month later and confirmed he’s a young hurdler on the up when supplementing that over the same C&D lastmonth.Slickjumperbut he’spitchedindeep

7Feb Nby 16f HcpH heavy 1/15 Wellington Arch 15l Nov25 Nby 16f HcpH soft 1/8 Indeevar Bleu (FR) 3l Oct25 Chp 16f HcpH good 6/9 Celtic Dino (FR) 25l

TFRHIIII BHA148

FORM 1//310-42 D

TIMEFORM VIEW Has just a maiden hurdle win to his name (albeit beat a smart one) but all the better for reappearance when second in Grade 3 at Gowran last month.Hard to make a case for him in this company,though.

14Feb Gow 16f Hdl heavy 2/7 Storm Heart (FR) 11/2l 25Jan Naa 15f Hdl heavy 4/7 Glen Kiln (IRE) 14l Mar25 Chl 16f Hdl gd-sf 11/11 Kopek des Bordes (FR) 71l

TFRHHHHI BHA160

FORM 114-321 D

TIMEFORM VIEW Very smart mare who got her career back on track in no uncertain terms this winter, runner-up in quest to follow up in the December Hurdle and cashed in on a below-par Lossiemouth for third

8 GOLDEN ACE (GB) (74)

B m Golden Horn - Deuce Again 8 11-3

J Lorcan Williams

T Jeremy Scott, Dulverton

O Mr I. F. Gosden

B Meon Valley Stud

S Brendon Powerwashers

9 LOSSIEMOUTH (FR) (37)

Gr m Great Pretender (IRE) - Mariner’s Light (FR) 7 11-3

J P. Townend

T W. P. Mullins, Ireland

O Mrs S. Ricci

E Cheek Pieces

B Sarl Elevage Des Vallons & M. Ian Kellit

DECLARED RUNNERS 9

TFRHHHII BHA152

FORM 11-2212 CD

TIMEFORM VIEW Really likeable mare who scaled new heights when landing thisayearago,albeithelduntilStateManfellatthelast.Herreappearancewininthe FightingFifthwasalsoaidedbyacoupleofhigh-profilefallersbutranrightuptoform when second to Sir Gino in the Christmas Hurdle.

Dec25 Kmp 16f Hdl good 2/6 Sir Gino (FR) 6l

Nov25 Nwc 16f Hdl gd-sf 1/5 Anzadam (FR) 11/2l

Nov25 Wet 16f Hdl good 2/2 Kateira 28l

TFRHHHHH BHA159

FORM F11-112 C D BF

TIMEFORM VIEW Prolific hurdler,winning 14 of 16 completed starts including 9 atthehighestlevel.SmoothwinneroftheMares’Hurdleforasecondtimeayearago and while Brighterdaysahead lowered her colours at Leopardstown, she’s fancied to reverse the form this time with cheekpieces likely to help

1Feb Leo 16f Hdl heavy 2/5

Dec25 Leo 16f Hdl gd-yd 1

Brighterdaysahead (FR) 31/4l

Brighterdaysahead (FR) 1l Nov25 Pun 16f Hdl sf-hv 1/4 Glen Kiln (IRE) 19l

Probable S.P’s: 9-4 Lossiemouth (FR), 5-2 The New Lion (GB), 5-1 Brighterdaysahead (FR), 10-1 Golden Ace (GB), 16-1 Poniros (GB), 25-1 Alexei (GER), Tutti Quanti (FR), 33-1 Anzadam (FR), 100-1 Workahead (IRE)

Several high-profile absentees potentially leaves the door ajar for another mare to add their name to the Champion Hurdle roll of honour. LOSSIEMOUTH looks the type to benefit from cheekpieces so is marginally preferred to Brighterdaysahead in her quest for a Cheltenham Festival 4-timer. The Elliott-trained mare has yet to win at this venue but she did beat the selection at Leopardstown and demands respect, while The New Lion’s ceiling has yet to be ascertained. TIMEFORM PREDICTION:

SRACESPONSOR

RA

out y’

find out more about s race sponsor at unibet om

GREATBRITISHBONUSSCHEME

The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.

S P E C I A L 28 APRIL - 2 MAY

THE SUN RACING PLATE HANDICAP STEEPLE CHASE (PREMIER HANIDCAP)

RACE DESCRIPTION

The Sun Racing Plate is a Premier Handicap Steeple Chase run an extended two and a half miles. Handicaps exist as an attempt to level the playing field for horses of varying quality, thereby ensuring more competitive racing for connections and punters alike. All horses possess an official BHA rating that reflects their relative abilities. Put simply, the higher the rating, the bigger the weight carried - see how 154 rated Dee Capo carries 2lb more than the 152 rated Down Memory Lane.

A thrilling finish in last year’s Plate saw Jagwar battle it out with Thecompanysergeant. The two market principles travelled powerfully into the contest from midfield, with the latter getting first run on the eventual winner under Connor Stone-Walsh Jagwar moved up alongside between the second and final fences and despite an inferior jump at the last, he had enough left in the tank to get the better of his rival. Run over two miles, four furlongs & 127 yards. 17 fences to be jumped Total prize fund of £150,000 £84,405 to the winner

Trainers and Jockeys with some of the strongest records in the race over the last 10 years.

TRAINER

Jockey J

Trainer T

Owner O

Breeder B

Sponsor S

Equipment E

THE SUN RACING PLATE HANDICAP STEEPLE CHASE

(CLASS 1) (PREMIER HANDICAP) (GBB RACE)

for five yrs old and upwards ™ Total prize fund £150000

Owners Prize Money. 1st £64560, 2nd £26610, 3rd £13305, 4th £6660, 5th £3330, 6th £1665, 7th £825, 8th £420. (Penalty Value £84405)

Weights raised 1lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable.

Leading course trainer (20-25): W P Mullins (46 wins from 372 runners, 12%) runs O’MOORE PARK

Trainer-in-form (last 14 days): W P Mullins (13 wins from 38 runners, 34%) runs O’MOORE PARK

Longest Travellers: DOWN MEMORY LANE & DEE CAPO trained by G Elliott, O’MOORE PARK trained by W P Mullins, ZURICH, THEATRE NATIVE & DOWNMEXICOWAY trained by H De Bromhead, MCLAUREY trained by E Mullins, MOON D’ORANGE trained by J McConnell, MIDNIGHT IT IS & WILL THE WISE trained by G Cromwell - all Ireland.

1 DEE CAPO (FR) (37)

B g Maxios - Walkure (IRE) 7 12-0

J Danny Gilligan

T Gordon Elliott, Ireland

O Mr David L’Estrange

B S.C.E.A. Haras de La Perelle

S Bective Stud, Gordon Elliott TFRHHHII BHA154 FORM 140-1U4

2 DOWN MEMORY LANE (IRE) (94)

B g Walk In The Park (IRE) - Credo Star (IRE) 8 11-12

J Jack Kennedy

T Gordon Elliott, Ireland

O Mr John P. McManus

B Cathal Ennis

S Bective Stud, Gordon Elliott

3 NO QUESTIONS ASKED (IRE) (53)

Ch g Ask - Fancy Fashion (IRE) 8 11-9

J Ben Jones

T Ben Pauling, Naunton

O Newton LDP Ltd

B Jerry O’Connor

S Newton LDP Ltd

4 JUNGLE BOOGIE (IRE) (52)

B g Gold Well - A Better Excuse (IRE) 12 11-8

J Charlie Deutsch

T Venetia Williams, Hereford

O Mr Malcolm C. Denmark

B Noel O’Brien

S Leaflet Company Ltd

5 BOOMBAWN (IRE) (17)

B g Dylan Thomas (IRE) - Well Clad (IRE) 9 11-7

J Tristan Durrell

T Dan Skelton, Alcester

O Bullen-Smith & Faulks

B Mr Rory O’Toole

S TheAirAmbulanceService(Warks&Northants),Ladbrokes

6 DOWNMEXICOWAY (IRE) (36)

Ch g Champs Elysees - On The Way Home (IRE) 7 11-5

J Darragh O’Keeffe

T Henry de Bromhead, Ireland

O Mr Basil Holian

B Rosemary Hutch

7 O’MOORE PARK (IRE) (37)

B g Walk In The Park (IRE) - Glor Na Gaoithe (IRE) 9 11-1

J Sean O’Keeffe E Tongue Strap

T W. P. Mullins, Ireland

O Mrs S. Ricci

B Patrick J. O’Mahony

2m 4f 44y

TIMEFORM VIEW Returned an improved model this season, successful at Punchestown (21.3f) in November Unseated next start but produced his best effort yet when fourth in Grade 3 handicap at Leopardstown (21.5f) 37 days ago Career-high mark demands more but he’s a definite each-way player

1Feb Leo 21f HcpC soft 4/23 Backmersackme (IRE)

Dec25 Lim 19f HcpC sf-hv U Ballybawn Belter (IRE)

Nov25 Pun 21f HcpC sf-hv 1 High Class Hero

TFRHHHII BHA152

FORM 1324-01

TIMEFORM VIEW Smart chaser who is lightly raced for his age and he got firmly back on the up following a 4-month break when landing Foxrock Handicap at Navan (20.7f) in December, jumping better than can often be thecase.Recordfreshanobviousplusandaplayerifkeepingtheerrorsatbay.

Dec25 Nav 20f HcpC sf-hv 1 Search For Glory (IRE)

Jul25 Gal 22f HcpC good 16/22 Western Fold (IRE)

Apr25 Fai 20f Ch sf-hv 4/6 Spindleberry (IRE) 38l

TFRHHHII BHA149

FORM 10-1231

TIMEFORMVIEWPrettyuseful3-timenovicehurdlewinnerwhohasmade a bright start in this sphere, finding a good test at the trip playing to his strengths when doubling his tally in 3-runner Grade 2 at Windsor (16.2f) in January.Return to further will hold no fears and stable took this in 2024.

16Jan Wdr 16f Ch soft 1/3 Be Aware (FR) 1l

Dec25 Asc 18f Ch soft 3/5 Steel Ally (FR) 12l Nov25 Nby 19f Ch gd-sf 2/6 Wendigo (FR) 2l

TFRHHIII BHA148

FORM 16/1P-0P D

TIMEFORM VIEW Fragile but one time highly-talented performer who was sixth in 2024 Gold Cup on just his fourth start over fences However, very lightly raced since and he hasn’t looked anything like the same force in 2 outings for present yard since the turn of the year Up against it.

17Jan Asc 21f HcpC soft P/9 Vincenzo (FR)1Jan Chl 20f HcpC good 7/9 Matata (IRE) 30l Mar25 Chl 20f Ch gd-sf P/9 Fact To File (FR) -

TFRHHIII BHA147

FORM 5-44300 D

TIMEFORM VIEW Grade 2 novice winner during a busy 2024/25 and produced best effort of present campaign when third in Silviniaco Conti Chase at Kempton in January. However, his mark has looked a stumbling block in handicaps here/at Kempton since and yard hold stronger claims with Madara.

21Feb Kmp 24f HcpC gd-sf 12/13 Lookaway (IRE) 64l 24Jan Chl 20f HcpC soft 8/11 Donnacha (IRE) 33l 10Jan Kmp 20f Ch good 3/4 Edwardstone 21/4l

TFRHHHHI BHA145

FORM P01213

TIMEFORM VIEW Hurdles winner who produced a decidedly useful effort when doubling his chase tally on handicap debut at Gowran (2m) inNovember FoundIrishArkletoocompetitiveatLeopardstowninFebruary but this return to handicaps firmly in his favour back up in trip

2Feb Leo 17f Ch soft 3/3 Romeo Coolio 23l

Nov25 Gow 16f HcpC heavy 1 Drumgill (IRE) 3l Oct25 Tip 19f Ch gd-yd 2/5 Gold Dancer

TFRHHHII BHA141

FORM 20-2050 D

TIMEFORMVIEWYettotastesuccessoverfencesbutplentyofgoodeffortstohis name, including when third in Grade 2 handicap at last season’s Festival before runner-up in Silver Trophy back here.Had been running creditably prior to a below par display at Leopardstown 37 days ago and type to bounce back.

8 GUARD YOUR DREAMS (GB)

(31)

B g Fame And Glory - Native Sunrise (IRE) 10 11-1

J Sam Twiston-Davies E Tongue Strap

T Nigel & Willy Twiston-Davies, Cheltenham

O Graham and Alison Jelley

B Little Lodge Farm & Mr & Mrs TWR Chugg

S Jelson Ltd

9 MADARA (FR) (36)

B g Doctor Dino (FR) - Becquascenthe (FR) 7 11-0

J Harry Skelton E Cheek Pieces

T Dan Skelton, Alcester

O Bryan Drew and Friends

B Sas Ecurie de Cachene & Elise Drouet

S TheAirAmbulanceService(Warks&Northants),Ladbrokes

10 BOOSTER BOB (IRE) (45)

B g Malinas (GER) - Ceka Dawn (IRE) 8 11-0

J Sean Bowen

T Olly Murphy, Wilmcote

O Mrs Diana L. Whateley

B P. Kennedy

S Betano

11 PEAKY BOY (IRE) (17)

B g Kayf Tara - Joanne One (IRE) 8 10-13

J Jonjo O’Neill Jr. E Cheek Pieces

T Jonjo & A.J. O’Neill, Cheltenham

O Martin Tedham & Wasdell Properties Ltd.

B N. Heaney & K. Heaney

S Wasdell Group

12 WILL THE WISE (IRE) (73)

Ch g Well Chosen - Now Were Broke (IRE) 7 10-13

J Keith Donoghue E Tongue Strap

T Gavin Cromwell, Ireland

O Have No Clue Syndicate

B Mr D. Breen

13

RISKINTHEGROUND (IRE) (17)

B g Presenting - The Folkes Choice 9 10-11

J Charlie Todd E Tongue Strap

T Dan Skelton, Alcester

O 3 Sons

B Fergal Duncan & Loman Duncan

S TheAirAmbulanceService(Warks&Northants),Ladbrokes

14 MIDNIGHT IT IS (GB) (55)

B g Midnight Legend - Santera (IRE) 10 10-9

J Sean Flanagan

T Gavin Cromwell, Ireland

O Mr Brendan Keogh

B Mr P. W. Gillbard

15 ZURICH (FR) (87)

Br g Doctor Dino (FR) - Zureka (FR) 7 10-8

J Brian Hayes

T Henry de Bromhead, Ireland

O Pimlico Racing Ireland

B Mrs Henri Devin

16 JIPCOT (FR) (24)

B g Choeur du Nord (FR) - Blinngaroe (FR) 7 10-7

J Kielan Woods E Tongue Strap

T Jonjo & A.J O’Neill, Cheltenham

O The Megsons

B J.Alvarez & G. Lassaussaye

S Wasdell Group

TFRHHIII BHA141

FORM 404F-21 CD

TIMEFORM VIEW Smart hurdler at his best who enhanced his good record fresh when readily landing 7-runner veterans handicap chase at Warwick 31 days ago,jumping more fluently than usual.Still,an 8lb rise likely enough to prevent him following up in this more demanding affair

7Feb War 20f HcpC heavy 1/7 Fugitif (FR) 13l

May25 Utt 24f HcpC good 2/14 Coco Mademoiselle (IRE) 41/4l

Mar25 Chl 25f HcpC gd-sf F/24 Myretown (IRE) -

TFRHHHHH BHA140

FORM 0/042-52 C

TIMEFORMVIEWAdualwinnerforSophieLeechin2023/24whoshapedwellin PaddyPower/DecemberGoldCupherein2024.Seenonlytwicesincebutverymuch caught the eye when second at Kempton 5 weeks ago and top stable likely had this on his radar for some time.Very interesting in refitted cheekpieces

2Feb Kmp 20f HcpC gd-sf 2/7 Issam (FR)

Dec25 Wet 15f HcpC soft 5/6 Traprain Law (FR) 20l

Dec24 Chl 20f HcpC gd-sf 2/11 Gemirande (FR) 1l

TFRHHHII BHA140

FORM 3231-15 D

TIMEFORM VIEW Signed off last season with success in Greatwood Gold Cup at Newbury in the spring and reappeared with a career-best victory in another valuable handicap chase there in November Seemingly caught out from revised mark when fifth here in January and more needed.

24Jan Chl 20f HcpC soft 5/11 Donnacha (IRE) 14l Nov25 Nby 22f HcpC gd-sf 1/12 Leader In The Park (IRE) 41/2l Mar25 Nby 19f HcpC soft 1/14 Vincenzo (FR) 1

TFRHHIII BHA139

FORM 11/133-F CD

TIMEFORM VIEW Progressive for Nicky Henderson during 2024,winning 3 of his 4 starts over hurdles/fences (all here).However,low-key start for new yard at Ascot last February and he got no further than the second after a breathing operation on last month’sbelatedNewcastlereappearance.Cheekpiecesgo onnow

21Feb Nwc 20f HcpC gd-sf F/7 Prairie Wolf (IRE)Feb25 Asc 23f Ch good 3/4 The Changing Man (IRE) 88l Dec24 Chl 25f HcpC gd-sf 3/9 Haiti Couleurs (FR) 23/

TFRHHHHI BHA139

FORM 5-22140 BF

TIMEFORM VIEW Good sixth in last season’s Pertemps and raised his game further over fences this term, off the mark at Galway prior to a good fourth on handicap bow in the Troytown at Navan (3m) in November Not disgraced at Leopardstown over Christmas and freshened up ahead of this Tongue tie added.

Dec25 Leo 24f HcpC yield 10 Favori de Champdou (FR) 12l

Nov25 Nav 24f HcpC heavy 4/19 Answer To Kayf 7

Oct25 Gal 18f Ch yield 1 Prends Garde A Toi (FR) 23/4

TFRHHIII BHA137

FORM 106040 C D

TIMEFORMVIEWCamegoodlastspring,supplementinghisAyrwininthe Silver Trophy here from O’Moore Park in April.More miss than hit following his victory in intermediate chase at Newton Abbot in October but he’s edged back down to last successful mark as a result.

21Feb Kmp 20f HcpC gd-sf 9/9 Califet En Vol (IRE) 45l

7Feb Nby 23f Ch heavy 4/4 Haiti Couleurs (FR) 52l

24Jan Chl 20f HcpC soft 10/11 Donnacha (IRE) 54l

TFRHHIII BHA135

FORM 303-000

TIMEFORM VIEW Successful on last season’s reappearance at Navan (2m) and good placed efforts on 2 of 3 starts thereafter, notably when third in Grand Annual 12 months ago Has not fired in 3 subsequent runs though, again well below best at Fairyhouse 55 days ago

14Jan Fai 17f HcpC yield 7/12 Western Diego (IRE) 35l Nov25 Fai 17f HcpC yd-sf 9/12 Drumgill (IRE) 54l May25 Pun 16f HcpC yield 11/23 Petit Tonnerre (FR) 34l

TFRHHHHI BHA134

FORM 530-113 CD

TIMEFORM VIEW Hurdles winner in France who put fitness/experience to good usewhendoublinghischasetallyfrom9lblowermarkoverC&DinOctober Backed thatupwhenkeepingonforthirdatDoncaster(19.1f)inDecemberanddemandsof this race promise to see him to even better effect.Very interesting.

Dec25 Don 19f HcpC gd-sf 3/5 Jordans Cross (IRE) 33/4l

Oct25 Chl 20f HcpC good 1/14 Crest of Fortune 21/4l Oct25 Kny 17f HcpC yield 1 Prince of Air (FR) -

TFRHHHII BHA133

FORM 40P-314 BF

TIMEFORMVIEWRespondedfavourablytoapositiveridewitharecentrun under his belt when opening chase account at Leicester (22.7f) in January and acquitted himself well (jumped fluently) back up in grade when fourth at Ascot (3m) since,just doing too much too soon.Each-way possibilities 14Feb Asc 23f HcpC gd-sf 4/11 Montregard (FR) 18l 20Jan Lei 22f HcpC gd-sf 1/7 No Tackle 10l 2Jan Ayr 20f HcpC soft 3/9 Milcree (IRE) 6l

17 MCLAUREY (IRE) (49)

B g Jukebox Jury (IRE) - Soeur Dee (IRE) 7 10-7

J Mark Walsh

T Emmet Mullins, Ireland

O Mr John P. McManus

B Victor Connolly

18 THEATRE NATIVE (IRE) (74)

B m Getaway (GER) - Native Beauty (IRE) 8 10-7

J M. P. O’Connor E Hood

T Henry de Bromhead, Ireland

O Mr K. Alexander

B John Noonan

19 WESTERN ZEPHYR (IRE) (24)

B g Westerner - Beneficial Breeze (IRE) 9 10-6

J Shane Fenelon (5) E Cheek Pieces

T Mickey Bowen, Haverfordwest

O Mrs J. Iddon

B Longrove Stud

20 GRANDEUR D’AME (FR) (31)

B g Desir d’Un Soir (FR) - Sourya d’Airy (FR) 10 10-5

J Tom Bellamy

T Alan King, Barbury Castle

O Syders & Burkes

B Mr Georges Lacombe

S Goodwin Racing Ltd

21 EMBITTERED (IRE) (4)

B g Fame And Glory - Kilbarry Classic (IRE) 12 10-4

J Paddy Hanlon (5) E Blinkers, Tongue Strap

T Syd Hosie, Sherborne

O Mrs Kate Kenyon

B Con O’Keeffe

S Sherborne Utilities Ltd

22 MOON D’ORANGE (FR) (8)

Ch g Spanish Moon (USA) - Fleur d’Orange 8 10-2

J Callum Pritchard (3) E Visor

T John McConnell, Ireland

O Ian Stuart Griffiths and Gary Evans

B EARL Elevage Marion & Mr Didier Marion

23 YES INDEED (FR) (36)

B g Martaline - She Hates Me (IRE) 9 10-2

J Freddie Keighley (5)

T Martin Keighley, Cheltenham

O Stephen Sugden and Helen Sugden

B Marie-Christine Gabeur

S Optima Self Store

TFRHHHHI BHA133

FORM 10-4304

TIMEFORM VIEW Progressive over hurdles last term and plenty of promise to glean from 3 of his 4 starts over fences this season,catching the eye when fourthinnoviceatDownRoyal7weeksago Remainswithplentyofpotential returned to handicaps for stable who bagged this with The Shunter in 2021.

20Jan Dow 16f Ch yd-sf 4 Anotherway (FR) 61/2l

9Jan Naa 16f HcpC soft 7 Rockbrook (IRE) 29l

Dec25 Fai 16f Ch soft 3 Jacob’s Ladder (IRE) 71/2l

TFRHHIII BHA133

FORM 21-0306 C

TIMEFORM VIEW Went the right way over fences during 2024/25,building ongoodplacedeffortswhentaking7-runnermaresnovicehandicapherelast April.Down the field in Paddy Power Gold Cup in November and didn’t see her race out at Leopardstown (17f) over Christmas Others look stronger

Dec25 Leo 17f HcpC yield 6 Addragoole (IRE) 18l

Nov25 Chl 20f HcpC soft 9/12 Panic Attack (IRE) 34l

Oct25 Lim 19f HcpC yd-sf 3 Crowsatedappletart (IRE) 63/4l

TFRHHIII BHA132

FORM 1230P-2 D

TIMEFORM VIEW Resumed in good heart last season, winning well at CarlislebeforesecondintheArkleTrialhere.Runofgoodformcametoahalt after but enhanced good record fresh on debut for new yard when second in first-time cheekpieces at Haydock 24 days ago Needs to back that up 14Feb Hay 19f HcpC soft 2/11 The Bluesman (FR) 31/2l Apr25 Ain 21f HcpC gd-sf P/30 Gentleman de Mee (FR)Mar25 Chl 15f HcpC gd-sf 17/20 Jazzy Matty (FR) 39l

TFRHHIII BHA131

FORM 0P-F03P

TIMEFORM VIEW Useful chaser who isn’t always the most fluent but he took step backinrightdirectionwhenthirdinaPremierHandicaphere(20.6f)onNewYear’sDay. Seemingly amiss when pulled up in race won by Guard Your Dreams at Warwick last monthbutpercentagecalltolookelsewhereinanycase.

7Feb War 20f HcpC heavy P/7 Guard Your Dreams1Jan Chl 20f HcpC good 3/9 Matata (IRE) 11l Nov25 Nby 25f HcpC gd-sf 17/24 Panic Attack (IRE) 64l

TFRHIIII BHA130

FORM 010P20 D

TIMEFORMVIEWWonaclaiminghurdleandhandicapchaseinIrelandfor Eric McNamara last summer but finished well held on his stable debut in veterans’handicap chase at Exeter (19.2f) 4 days ago and he looks firmly up against it back up markedly in class Blinkers replace usual cheekpieces

6Mar Exe 19f HcpC gd-sf 7/9 Genois (FR) 25l

10Feb Lim 21f Hdl heavy 2 Rocky’s Howya (IRE) 20l Nov25 Crk 21f HcpC yield P Iceberg Theory (IRE) -

TFRHHIII BHA125

FORM 005600 C

TIMEFORM VIEW Fairly useful hurdler/chaser who was well served by run of the race when landing a good handicap here (20.6f) in January 2025. Proved more miss than hit over both sets of obstacles since though and work to do from out of the weights in new headgear

2Mar Leo 21f HcpC yd-sf 10 O’Toole (IRE) 14l

31Jan Mus 20f HcpC gd-sf 7/8 JPR One (IRE) 16l

24Jan Chl 20f HcpC soft 6/11 Donnacha (IRE) 15l

TFRHIIII BHA123

FORM P11-P34

TIMEFORM VIEW Won pair of handicap chases around 2m on joining Martin Keighley last spring. Lightly raced and easily his best effort since following a breathing operationwhenfourthatKempton5weeksagobutanotherwholookstohaveplentyon hisplateinthismuchmoredemandingcontest.

2Feb Kmp 20f HcpC gd-sf 4/7 Issam (FR) 81/4l Oct25 Chp 16f HcpH good 3/6 Washington 42l May25 Ntn 20f HcpC good P/6 Light N Strike (IRE) -

DECLARED RUNNERS 23 2025: JAGWAR (FR) 6 10 10 Jonjo O’Neill Jr 3-1 (Oliver Greenall & Josh Guerriero) 20 ran

Stewards Note: GRANDEUR D’AME: Following its run on 7/2/2026 it was reported that the horse stopped quickly

Probable S.P’s: 9-2 Madara (FR), 5-1 McLaurey (IRE), 10-1 Will The Wise (IRE), 14-1 Down Memory Lane (IRE), Zurich (FR), 16-1 No Questions Asked (IRE), Downmexicoway (IRE), 18-1 O’Moore Park (IRE), 20-1 Booster Bob (IRE), 22-1 Jipcot (FR), 28-1 Dee Capo (FR), Guard Your Dreams (GB), 33-1 Peaky Boy (IRE), 40-1 Midnight It Is (GB), 50-1 Boombawn (IRE), Theatre Native (IRE), 66-1 Jungle Boogie (IRE), Riskintheground (IRE), Western Zephyr (IRE), Grandeur d’Ame (FR), Moon D’Orange (FR), 100-1 Yes Indeed (FR), 150-1 Embittered (IRE)

PLAY SMARTER

Having shaped well in the Paddy Power and December Gold Cup here upon joining Dan Skelton in 2024, MADARA arrives on the back of a very eye-catching second at Kempton 5 weeks ago and this will have been on his radar for some time. With refitted cheekpieces likely to put an extra edge on him he looks very interesting. McLaurey has fewer miles on the clock than the selection and is feared for the stable who won this in 2021. Zurich and Will The Wise are just a couple of the others to consider

TIMEFORM PREDICTION: 1.MADARA (FR) 2.MCLAUREY (IRE) 3.ZURICH (FR)

SRACESPONSOR

out y’

find out more about s race sponsor at th uk

GREATBRITISHBONUSSCHEME

The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.

Ifyou would like your message to appear here, please email Cheltenham.racecard@thejockeyclub email Cheltenham.racecard@thejockeyclub.co.uk Chelt Congratulations to David Poque from Belfast attending the Cheltenham Festival 2026 for his 50th visit.

LOW FARES & ON-TIME FLIGHTS TO SPAIN

ALICANTE, MALAGA, PALMA

FA CT S AN D ST AT IS TI CS

RACE SEVEN

THE NATIONAL HUNT CHALLENGE CUP

NOVICES’ HANDICAP

CHASE

RACE DESCRIPTION

The National Hunt Chase has seen multiple alterations over the years but none so significant as the new format introduced in 2025. Formerly a novice chase for amateur riders, this year it will be open to professional jockeys. That is not all, the race is now 0-145 handicap open to five-year-olds and upwards and as such will work like any other handicap of this type. With horses rated higher, due to carry more weight than a rival rated inferior. See how Wade Out is rated 144 and will carry 12st, compared to Pic Roc rated 141, who carries 11st 11lb.

KEY TRENDS

Given the vastly different look to the race, we are starting again from scratch in terms of trends and statistics. Therefore there are no trends available for this race and we will need to build up a new body of evidence

LAST YEAR’S WINNER

HAITI COULEURS

Rebecca Curtis and Ben Jones cantered to victory in the new look finale on day one of the 2025 Festival He was well found in the market beforehand and was given a positive ride by Ben Jones, sitting in second behind Jupiter Allen for much of the contest. Halfway down the back-straight he jumped his way to the front and it was there that he would stay, comfortably putting to bed the rest of the field

NOVICE HANDICAP CHASE

Run over three miles, five furlongs & 201 yards. 21 Fences to be jumped

Total prize fund of £100,000 £51,440 to the winner

WINNING CONNECTIONS

Trainers and Jockeys with some of the strongest records in the race over the last 10 years.

TRAINER

Emmet Mullins 1 winner Today Emmet saddles Backmersackme

JOCKEY Ben Jones 1 winner Today Ben rides Pic Roc

Jockey J

Trainer T

Owner O

Breeder B

Sponsor S

Equipment E

for novice five yrs old and upwards ™ Total prize fund £100000 Owners Prize Money. 1st £39280, 2nd £19640, 3rd £9820, 4th £4910, 5th £2450, 6th £1230, 7th £610, 8th £310. (Penalty Value £51440) Weights raised 1lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable. 3m 5f 201y

Leading course trainer (20-25): N Henderson (34 wins from 240 runners, 14%) runs HOLLOWAY QUEEN Trainer-in-form (last 14 days): L Russell & M Scudamore (11 wins from 48 runners, 23%) runs KING OF ANSWERS Longest Travellers: ICEBERG THEORY trained by P Nolan, KURASSO BLUE & WILL DO trained by G Elliott, BACKMERSACKME trained by E Mullins, UNION STATION trained by G Cromwell - all Ireland.

1 WADE OUT (IRE) (51)

B g Shantou (USA) - Whats Up Britta (IRE) 7 12-0

J Sean Bowen E Cheek Pieces

T Olly Murphy, Wilmcote

O Ferguson, Mason, Hales & Done

B Stone Electrical Ltd

S Betano

2 PIC ROC (IRE) (38)

Ch g Mount Nelson - South Africa (FR) 8 11-11

J Ben Jones E Cheek Pieces

T Ben Pauling, Naunton

O Mrs Emma Kendall

B Mr Cian O’Doherty

S Fitzdares

3 KING OF ANSWERS (IRE) (25)

Br g Malinas (GER) - Queen of Questions (IRE) 7 11-10

J Derek Fox

E Cheek Pieces

T Lucinda Russell & Michael Scudamore, Kinross

O The Kings Counsel

B Denis Hoban

S Ian Macleod & Co Ltd

4

ONE BIG BANG (IRE) (46)

Gr g Masked Marvel - Boston du Berlais (FR) 8 11-9

J Alex Chadwick (3)

T James Owen, Newmarket

O Big Bang Racing

B Vambeck Bloodstock Ltd

S The Rare Breed Meat Company

5 KURASSO BLUE (FR) (60)

Ch g Masked Marvel - Speedy Blue Girl (FR) 5 11-8

J Jack Kennedy

T Gordon Elliott, Ireland

O Robcour

B Mr Yannick Fouin

S Bective Stud, Gordon Elliott

6 WILL DO (IRE) (47)

B g Walk In The Park (IRE) - Alleygrove Lass (IRE) 9 11-7

J Danny Gilligan E Blinkers

T Gordon Elliott, Ireland

O Gigginstown House Stud

B Mr Alan Loughlin

S Bective Stud, Gordon Elliott

7 GUARD THE MOON (GB) (53)

B g Pether’s Moon (IRE) - Polly Potter 8 11-7

J Sam Twiston-Davies E Cheek Pieces

T Nigel & Willy Twiston-Davies, Cheltenham

O James & Jean Potter Ltd

B James & Jean Potter

TFRHHHHI BHA144 FORM 616-114 C

TIMEFORMVIEWBagged3novicehurdleslastseasonandimprovedfortheswitch tothisspherewhenlandingWorcestermaidenandListedeventatCheltenhambefore Christmas Posted a solid fourth in Grade 2 event at Windsor (3m) last time and not ruledoutgoingup intripnowhandicappingwithcheekpiecestried.

18Jan Wdr 24f Ch soft 4/6 Salver (FR) 12l Nov25 Chl 25f Ch soft 1/5 One Big Bang (IRE) 31/4l Oct25 Wor 20f Ch good 1/5 Wendigo (FR) hd

TFRHHHII BHA141

FORM 6-U1501

TIMEFORM VIEW Finally opened his chase account at Huntingdon in November and got back on the up when easily adding to it in 3m Sandown handicap in January. Needs to take another step forward hiked up 7lb however 31Jan San 24f HcpC soft 1/6 Hunter Legend (FR) 13l

TFRHHHII BHA140

FORM P2-5141

TIMEFORM VIEW Upwardly-mobile young chaser who was fitted with cheekpieces for the first time when making all in 23f handicap chase at Kelso 25 days ago Has more to offer as he bids to go 3-5 in this sphere.In the mix.

13Feb Kel 23f HcpC heavy 1/6 Bill Baxter (IRE)

16Jan Wdr 24f HcpC

TFRHHHII BHA139

FORM 15-3213 BF

TIMEFORM VIEW Useful3mwinneroverhurdles andhasshownformatleastas goodoverfences,easilytaking3mSouthwellmaideninDecemberbeforefindingtrip onthesharpsidewhenthirdin2m3fDoncasternovicefollowingmonth.Inverygood hands so he’s no forlorn hope now tackling a marathon trip

TFRHHHHI BHA142

FORM 151-212

TIMEFORM VIEW Ex-French recruit who went 2-3 over hurdles Has made a very bright start over fences, landing maiden at Punchestown (23f) in December before takinganotherstepforwardwhensecondin3mnovicechaseatNaasfollowingmonth. Haspotentialfor more nowsteppingupintripforhis handicapdebut.

9Jan Naa 24f Ch soft 2 Flicker of Hope (FR) 23/

Dec25 Pun 23f Ch heavy 1 Ballygunner Castle (IRE)

Nov25 Thu 22f Ch yield 2 Eagle Fang (IRE)

TFRHHHII BHA137

FORM 0-0020P

TIMEFORM VIEW Remains winless over fences and he added to a patchy record when pulled up in Thyestes Chase (3m1f) at Gowran in January. Third in this last year however, so not one to totally dismiss if back on his A-game.

22Jan Gow 25f HcpC heavy P/18 Now Is The Hour (IRE)Dec25 Leo 24f HcpC yield 18 Favori de Champdou (FR) 22l Nov25 Fai 30f HcpC yd-sf 2/15 Better Times Ahead (IRE) nk

S Potter Group TFRHHHHI BHA137 FORM 0PF-1P1

TIMEFORM VIEW Improved when successful on his chasing debut at Aintree in December Pulled up after an early error at Newbury but quickly bounced back infirst-timecheekpieceswhenlanding3mWindsorhandicapinJanuary,riddenmore patiently than usual.Firmly

8

GRAND GESTE (IRE)

(24)

Gr g Cloudings (IRE) - Lake Cresent (IRE) 7 11-5

J Danny McMenamin E Cheek Pieces

T Joel Parkinson & Sue Smith, Bingley

O The Acre Bottomers

B Mr & Mrs James Hannon

S Tuffa Footwear Ltd

9 BACKMERSACKME (IRE) (37)

Ch g Getaway (GER) - Princess Dante (IRE) 7 11-5

J Donagh Meyler E Tongue Strap

T Emmet Mullins, Ireland

O Mr P. Byrne

B Brian Doran

10 HOLLOWAY QUEEN (IRE) (31)

B m Jukebox Jury (IRE) - Holloden (IRE) 6 11-4

J James Bowen

T Nicky Henderson, Lambourn

O Unique Financial Racing Partnership

B Victor Connolly S Unibet

11 ICEBERG THEORY (IRE) (107)

Ch g Flemensfirth (USA) - Joanne One (IRE) 7 11-3

J Conor Stone-Walsh (3) E Cheek Pieces

T Paul Nolan, Ireland

O Mr J. J. Brennan

B N. Heaney & K. Heaney

12 NEWTON

TORNADO (FR) (45)

B g Cokoriko (FR) - New Saga (FR) 7 11-3

J Sean Flanagan

T Rebecca Curtis, Newport

O Frobisher Hyde McDermott Outhart Waters

B Mr J. Gallorini & Mr C. Gallorini-Berger

S Express Contract Drying Ltd

13 FIRST CONFESSION (IRE) (35)

B g Affinisea (IRE) - Lough Derg Lily (IRE) 7 11-3

J Brendan Powell

T Joe Tizzard, Sherborne

O Kevan Leggett, Susan & John Waterworth

B Edward Ryan

S Coral Racing Limited

14 UNION STATION (IRE) (54)

B g Leading Light (IRE) - Acoola (IRE) 7 11-1

J Keith Donoghue

T Gavin Cromwell, Ireland

O C. Jones

B Declan Dorgan

15 WALKING ON AIR (IRE) (45)

B g Walk In The Park (IRE) - Refinement (IRE) 9 10-11

J Harry Cobden E Tongue Strap, Cheek Pieces

T Faye Bramley, Lambourn

O The Cheeky Pups

B Chelston Ireland, Ltd.

16 SILVER THORN (GB) (31)

TFRHHHHI BHA135 FORM P-221P1

TIMEFORM VIEW Has proven a different proposition switched to fences this season, landing Grand National Trial at Haydock last month having earlier taken the Tommy Whittle there. This likeable sound-jumping front-runner must enter calculations with his stamina proven.

14Feb Hay 28f HcpC gd-sf 1/11 Top of The Bill (IRE) 13/4l

24Jan Don 23f HcpC soft P/8 Dartmoor Pirate -

Dec25 Hay 25f HcpC soft 1/12 My Silver Lining (IRE) 61/2l

TFRHHHHI BHA135 FORM 6-00201

TIMEFORM VIEW Excellent second in 3m1f handicap here in October and (tongue tied) gained a deserved first chasing success in valuable 23-runner handicap at Leopardstown (2m5f) last month. Remains unexposed over staying distances and a likely player for his shrewd yard that took this in 2024.

1Feb Leo 21f HcpC soft 1/23 Win Some Lose Some (IRE) 1l

Dec25 Leo 24f HcpC yield 19 Favori de Champdou (FR) 27l

Oct25 Chl 25f HcpC good 2/18 Three Card Brag (IRE) 23/4l

TFRHHHII BHA134 FORM 4P-PU41

TIMEFORMVIEWLookedagoodprospectwhengoing2-2overhurdleslast term.Got back on the up when gaining her first victory since in 23f Newbury handicap chase last month, jumping well and quickening clear from 2 out. Hiked up 10lb but she can make her presence felt.

7Feb Nby 23f HcpC heavy 1/10 Knight of Allen (FR) 14l

Dec25 Nby 22f HcpC good 4/8 Calimystic (IRE) 5l

Dec25 Her 25f HcpC soft U/10 Lady Balko (FR) -

TFRHHHHH BHA133

FORM 36P2-11

TIMEFORM VIEW A useful winning hurdler who has made a very promising startoverfences,landingmaidenatLimerick(2m7f)inMaybeforereturningfrom 6 months off with an emphatic win in 2m5f Cork handicap in November This son of Flemensfirth has more to offer over staying trips Most interesting.

Nov25 Crk 21f HcpC yield 1 O’Toole (IRE)

May25 Lim 22f Ch good 1 Boston Rover (IRE) 2l

Mar25 Wex 25f Ch gd-yd 2 Majestic Force (IRE) 1

TFRHHHHI BHA133 (+2)

FORM 21-F1P1

TIMEFORM VIEW Ended last season on up over hurdles and it’s been a similar story over fences, making it 2 out of 2 completed starts in emphatic fashion in 3m Doncaster novice handicap in January.This sound jumper could have more to offer stepping up in trip and rates a big player for last year’s winning yard

24Jan Don 23f HcpC soft 1/6 Chasingouttheblues (IRE) 61/2l Dec25 Nby 22f HcpC good P/8 Calimystic (IRE)Nov25 Bgr 24f HcpC heavy 1/8 Laganhill 9l

TFRHHHII BHA133

FORM P-335F1

TIMEFORM VIEW Point/hurdles winner who has advanced his form in this sphere this term,getting off the mark at the fifth attempt in 2m5f maiden at Carlisle last month. This demands plenty more but he remains capable of better

3Feb Car 20f Ch gd-sf 1/4 Della Casa Lunga (IRE) 10l 9Jan Exe 24f HcpC gd-sf F/6 Silver ThornDec25 Chl 25f HcpC gd-sf 5/8 Zertakt (FR) 27l

TFRHHIII BHA131

FORM 26-2P2U

TIMEFORM VIEW Fairly useful maiden hurdler/chaser who posted his best effort when second of 13 in 3m handicap chase at Leopardstown in December Racedtoofreelyincheekpiecesandwellheldwhenunseatedrider last at Fairyhouse (2m) since.Has work to do

15Jan Fai 16f Ch soft U I Am Lorenzo (IRE)Dec25 Leo 24f HcpC yield 2 Kish Bank (IRE) 3/4l Nov25 Nav 24f HcpC heavy P/19 Answer To Kayf -

TFRHHHII BHA127

FORM 3F0P-03

TIMEFORM VIEW Formerly very useful hurdler/chaser for Gary Brown. Easily best run for his new yard in first-time cheekpieces (tongue strap also refitted) when third of 8 in Great Yorkshire at Doncaster (3m) in January. Not dismissed if building on that over this longer distance.

24Jan Don 23f HcpC soft 3/8 Dartmoor Pirate 41/2l Dec25 Nby 19f HcpC gd-sf 8/9 Knight of Allen (FR) 76l

Apr25 Ayr 31f HcpC gd-sf P/23 Captain Cody (IRE) -

Gr g Martaline - Miracle Maid 7 10-8

J Jonathan Burke

T Emma Lavelle, Marlborough

O Syders & Burkes

B Whitley Stud

S Hatherden Horse Transport

TFRHHHII BHA124

FORM 2P-5114

TIMEFORM VIEW A fairly useful winner over hurdles and he advanced his form when making all in 3m handicap chases at Doncaster and Exeter either side of Christmas Not so good when fourth to Holloway Queen at Newbury last time and needs to bounce back.

7Feb Nby 23f HcpC heavy 4/10 Holloway Queen (IRE) 25l

9Jan Exe 24f HcpC gd-sf 1/6 El Granjero (IRE) 2l

Dec25 Don 23f HcpC gd-sf 1/6 Ladronne (FR) 13l

17 HOLOKEA (IRE) (24)

B g Diamond Boy (FR) - No Plain Jane (IRE) 7 10-8

J Shane Fenelon (5)

T Mickey Bowen, Haverfordwest

O Miss Jayne Brace & Mr Gwyn Brace

B G. Aherne

S Adept GRP Cabinets Ltd

DECLARED RUNNERS 17

TFRHHHII BHA124 FORM 21222P

TIMEFORM VIEW Got off the mark over fences at Ffos Las (3m1f) in October and ran well in finishing runner-up next 3 starts Pulled up in Haydock’s Grand National Trial last time but he’s proven at the trip and is the sort to bounce back quickly

14Feb Hay 28f HcpC gd-sf P/11 Grand Geste (IRE)18Jan Wdr 28f HcpC soft 2/16 Neo King (FR) 11/2l Dec25 Chl 25f HcpC gd-sf 2/8 Zertakt (FR) nk

2025: HAITI COULEURS (FR) 8 11 4 Ben Jones 7-2 (Rebecca Curtis) 18 ran

Stewards Note: WADE OUT: Following its run on 18/1/2026 it was reported that the horse lost a shoe.

WALKING ON AIR: Following its run on 24/1/2026 it was reported that the horse lost its left-fore shoe.

HOLOKEA: Following its run on 14/2/2026 it was reported that the horse ran flat.

Probable S.P’s: 11-2 Backmersackme (IRE), 7-1 Newton Tornado (FR), 17-2 Iceberg Theory (IRE), 10-1 Wade Out (IRE), 11-1 Kurasso Blue (FR), 16-1 One Big Bang (IRE), Holloway Queen (IRE), 18-1 King of Answers (IRE), Grand Geste (IRE), Walking On Air (IRE), 20-1 Pic Roc (IRE), Guard The Moon (GB), 28-1 First Confession (IRE), 33-1 Will Do (IRE), 40-1 Union Station (IRE), Silver Thorn (GB), 50-1 Holokea (IRE)

ICEBERG THEORY is taken to emerge on top in a fascinating finale with this marathon trip likely to play very much to the strengths of this son of Flemensfirth. Paul Nolan’s 7-y-o hasn’t been out since coming home very strongly to score over 2m5f at Cork in November and can improve again. Emmet Mullins’ Leopardstown winner Backmersackme rates a big threat and the lightly-raced Kurasso Blue could bring up a 1-2-3 for Ireland. Newton Tornado rates the pick of the home runners.

CHANCETOWIN HOSPITALITYFORTWO

IMPORTANT NOTICES

Abandoned Racing

Full refunds for tickets will be given if racing is abandoned before the first race A 50% refund will be given if racing is abandoned before the third or feature race, whichever is later. No cash refunds will be given on the day, but will be administered by post after the meeting. Applications for refunds should be sent within one month after the fixture except for The Festival when refunds will be processed automatically. No refunds will be given for tickets that are purchased and then not required or used Hospitality customers have separate T&C’s

Admission Policy

The management reserves the right to refuse admission to anyone, and to remove any person, without assigning a reason if their behaviour is considered to be antisocial or likely to be disruptive.

Alcohol

Please would racegoers kindly note that the bringing of your own alcoholic drink into the Racecourse is strictly prohibited For your own enjoyment and to avoid disappointment please observe this restriction. Please respect our neighbours when leaving the racecourse.

No alcohol is to be taken off site

Benches

Please would racegoers refrain from standing on the benches on the lawns in front of the grandstands. As well as an obvious safety risk, it also blocks the view of a number of your fellow racegoers

HBLB

The Horserace Betting Levy Board prize fund schemes provide for the estimated inclusion of £1,830,504 in ratecard and incremental prize money at this racecourse from 1st January to 27th March 2026

Dogs

Regrettably, dogs other than guide dogs are not allowed within the enclosures

E-Cigarettes

Please note, e-cigarettes are not permitted to be used inside.

Gambling

It is illegal for persons under the age of 18 to bet on the horses gambleaware.co.uk

Health and Safety Notice

The Racecourse would be grateful if you would observe all Health & Safety requirements whilst you are at Cheltenham Racecourse The emergency exits from the bars onto the grandstand steppings are painted yellow and we would request that you do not stop whilst in this area We would also request that only those that are disabled use the disabled viewing ramp and that parents keep a close eye on all children and prevent them from climbing the running rails and getting on to the actual racecourse We would also like to remind racegoers that the first aid room is located above the parade ring behind the See You Then Bar

Feedback

We are always pleased to hear from our customers and are grateful for any feedback you can provide about your visit today. There is a short Feedback Form available by scanning the QR code below:

Notices

Weights, Pedigrees, Trainers’ Names, Descriptions, Performances and Values of races have been added for the convenience of the Public, but are subject to alteration All horses must parade in the Parade Ring except by permission of the Stewards, but in all cases must pass through the Ring on the way to the Post. The Management reserves the right to refuse admission to anyone without assigning a reason for so doing.

Parade Ring Access

In the interests of safety, access to the parade ring is strictly limited to Owners and Trainers with runners in the race, British Horseracing Authority Officials and Racecourse Officials who are on duty at the meeting and Emergency Service Personnel. Those people holding badges or accreditation that allow access to the Parade Ring are asked to refrain from entering this area unless it is absolutely necessary in the course of their business.

In-Running Betting

Please note that in-running betting is not allowed in any public areas of Cheltenham Racecourse. Any racegoer found to be in breach of this rule will be removed from the racecourse

For the full terms and conditions of entry, please visit the racecourse website.

Touts

JCR is taking strong action against touts

Touting is seen by some as a legitimate way of buying or selling last minute tickets but many tickets sold by touts are fraudulent or counterfeit An injunction has been issued preventing touting at the Racecourse.

You could yourself be breaking the law by dealing with a tout Genuine tickets sales are available at all the entrances or in advance via the Racecourse website.

Terms and Conditions

All you do at the Racecourse including transactions as well as entry onto the Racecourse are subject to the Terms and Conditions For details see the Racecourse Website www.cheltenham.co.uk. A copy is also available at the Racecourse Office

Racehorse & Jockey Welfare

The welfare of the sport’s equine and human participants is paramount to British Horseracing.

All racehorses trained in Britain are stabled at the premises licensed by the British Horseracing Authority (BHA). The standards demanded by BHA of licensed racehorse trainers far exceed those prescribed by animal welfare legislation.

Similarly, BHA licenses every racecourse, setting high standards for the racing surface and all parts of the course used by competitors, both human and equine. BHA Officials and Cheltenham Racecourse staff work in conjunction to ensure that the highest standards are met. In addition Cheltenham Racecourse employs eight veterinary surgeons, whose sole responsibility it is to provide care to the horses throughout their time at the racecourse

In the event of an incident on the racecourse, any horse affected will receive immediate attention and treatment from the racecourse’s veterinary team Qualified paramedics and doctors are also on hand in the case of any incident involving a jockey.

If any incident occurs during a race it is routine practice for screens to be erected around the horse or jockey receiving treatment This is to allow the veterinary or medical personnel to make a safe and accurate diagnosis and so that they may perform any treatment in a private and calm environment If necessary, horses and riders will be transported from the course to receive further treatment at the most appropriate equine hospital or Accident & Emergency Hospital. NEEDTO

Want to know about Racing Language, Hints & Tips, New to Racing, Betting information and much, much more visit our website below or scan our QR code www.thejockeyclub.co.uk/the-experience/racing-explained/

CONDITIONS

First Race 1.20 - THE SKY BET SUPREME NOVICES’ HURDLE RACE (CLASS 1) (Grade 1) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £84405 to the winning horse The second to receive £31800, the third £15915, the fourth £7950, the fifth £3990, the sixth £1995, the seventh £990 and the eighth £510. for novice four yrs old and upwards, which are allotted a rating or an assessment of 110 or more by the BHA Handicapper, taking account of races run up to and including the day prior to confirmation. Enter by noon, January 20th and pay £185 stake, Scratch by noon, February 10th or pay £380, Confirm by noon, March 4th and pay £185, Supplementary Entry by noon, March 4th and pay £5400 stake, Declare by 10.00 a.m. March 8th. Weights: 4-y-o 10st 11lb; 5-y-o and up 11st 7lb Fillies and mares allowed 7lb SKY BET has generously sponsored this race Presentations will be made to the winning owner, trainer and jockey and the stable employee responsible for the winning horse. A £200 cash prize will be presented to the stable employee in charge of the horse judged to be the best turned out in this race and a further prize to the second and third placed in the best turned out. A voucher will be presented to the stable employee responsible for the winning horse. They will also present a voucher and sponsored jacket to the stable employee responsible for each runner in this race All number cloths to be carried in this race have been sponsored and will carry the name/logo of SKYBET The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code. PLEASE NOTE: A Declaration to Run will not be accepted for any horse if, at the time fixed for declaration, it has been declared to run in any other race at this year’s Cheltenham Festival, which has yet to take place. (This will apply whether or not the horse is subsequently declared a non-runner, unless the horse has been eliminated from a race, or declared as a reserve and not been made a non-runner.) ELIMINATION: If elimination is necessary from this race, the elimination sequence shall be determined by the Elimination and Balloting Procedures (contained in the Race Administration Code) A Confirmation of Entry will not be accepted for any horse for which Medical Records are not submitted to the BHA by 3rd March, 2026 with a further update to be submitted by 6.00pm on the day before the race 64 entries, 19 at £185, 25 at £565, 20 at £750. - Closed January 20th, 2026. Owners Prize Money. Winner £64560; Second £26610; Third £13305; Fourth £6660; Fifth £3330; Sixth £1665; Seventh £825; Eighth £420. (Penalty Value £84405) A SEE PAGE 26 FOR THIS RACE.

Second Race 2.00 - THE SINGER ARKLE CHALLENGE TROPHY NOVICES’ STEEPLE CHASE (CLASS 1) (Grade 1) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £112540 to the winning horse The second to receive £42400, the third £21220, the fourth £10600, the fifth £5320, the sixth £2660 and the seventh £1320. for novice five yrs old and upwards, which are allotted a rating or assessment of 120 or more by the BHA Handicapper, taking account of races run up to and including the day prior to confirmation. Enter by noon, January 20th and pay £250 stake, Scratch by noon, February 10th or pay £500, Confirm by noon, March 4th and pay £250, Supplementary Entry by noon, March 4th and pay £7000 stake, Declare by 10.00 a.m. March 8th. Weights: 11st 7lb each Mares allowed 7lb SINGER CAPITAL MARKETS has kindly sponsored this race. Presentations will be made to the winning owner, trainer, jockey and member of racing staff A £200 award will be given to the member of racing staff responsible for the horse judged to be the best turned out in this race The Challenge Trophy has been presented by Anne Duchess of Westminster as a tribute to ARKLE, and is to be held by the winning owner until February 1st, next year All number cloths to be carried in this race have been sponsored and will carry the name/logo of SINGER CAPITAL MARKETS. The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code. PLEASE NOTE: A Declaration to Run will not be accepted for any horse if, at the time fixed for declaration, it has been declared to run in any other race at this year’s Cheltenham Festival, which has yet to take place. (This will apply whether or not the horse is subsequently declared a non-runner, unless the horse has been eliminated from a race, or declared as a reserve and not been made a non-runner.) ELIMINATION: If elimination is necessary from this race, the elimination sequence shall be determined by the Elimination and Balloting Procedures (contained in the Race Administration Code) A Confirmation of Entry will not be accepted for any horse for which Medical Records are not submitted to the BHA by 3rd March, 2026 with a further update to be submitted by 6.00pm on the day before the race 23 entries, 4 at £250, 5 at £750, 14 at £1000. - Closed January 20th, 2026. Owners Prize Money. Winner £86080; Second £35480; Third £17740; Fourth £8880; Fifth £4440; Sixth £2220; Seventh £1100. (Penalty Value £112540) A SEE PAGE 32 FOR THIS RACE.

Third Race 2.40 - THE MCCOY CONTRACTORS JUVENILE HANDICAP HURDLE RACE (CLASS 1) (PREMIER HANDICAP) (Registered as the FRED WINTER JUVENILE HURDLE) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £45016 to the winning horse The second to receive £16960, the third £8488, the fourth £4240, the fifth £2128, the sixth £1064, the seventh £528 and the eighth £272. for juvenile four yrs old, which before February 23rd, 2026, have Started in a minimum of three Hurdle Races in Great Britain, Ireland or France. Enter by noon, February 17th and pay £100 stake, Confirm by noon, March 4th and pay £300, Declare by 10.00 a.m. March 8th. Lowest weight 10st 2lb; Highest weight 11st 12lb Penalties, after February 22nd, 2026, a winner of a hurdle race 5lb No penalty to increase a horse’s weight above 11st 12lb McCoy Contractors has kindly sponsored this race Presentations will be made to the winning owner, trainer, jockey and member of racing staff A £200 award will be presented to the member of racing staff responsible for the horse judged to be the best turned out in this race All number cloths to be carried in this race have been sponsored and will carry the name/logo of MCCOY CONTRACTORS. The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code. The British Horseracing Authority will amend paragraphs 28 to 32 of the Weights and Handicapping Code and the Declaration of Jockey section of the Race Entries Code in the event that raising of the weights at the 24-hour stage proves necessary. PLEASE NOTE: A novice or juvenile horse shall only be qualified to run in this race if it has run a minimum of three times in Hurdle Races in Great Britain, Ireland or France in accordance with paragraph 15 of the Weights and Handicapping Code This race will be restricted to 22 runners plus two reserves The two reserves will be nominated as R23 and R24. The procedure for the allocation and operation of the reserves protocol will be as detailed in the notice headed ‘Reserves’ which has been published in The Racing Calendar and which also appears in the reserves notice in the Conditions For Entry Section, accessed from the Information menu on the BHA Racing Administration Internet site. Trainers are reminded of the provisions of paragraph 41 of the Race Entry Code which require that they MUST notify the Racing Calendar Office IMMEDIATELY when the decision has been made not to run. This will maximise the list of runners and determine whether the weights will need to be raised. The British Horseracing Authority will modify the Rules of Racing as a consequence of providing two reserves for this race The non runner penalty will be waived for any horse which is deemed a non-runner by 1.00 p.m. on the day before the race. PLEASE NOTE: Any horse for whom a confirmation of entry has been submitted will not be permitted to declare to run if, at the time fixed for declaration, it has been declared to run in any other race at this season’s Cheltenham Festival, which has yet to take place. (This will apply whether subsequently declared a non-runner or not, unless the horse has been eliminated from a race, or declared as a reserve and not been made a non-runner.) The British Horseracing Authority has modified paragraph 6 of the Weights and Handicapping Code for the purposes of this race, such that racecourse performances up to and including Sunday after Closing may be taken into account. A Confirmation of Entry will not be accepted for any horse for which Medical Records are not submitted to the BHA by 3rd March, 2026 with a further update to be submitted by 6.00pm on the day before the race 37 entries, 12 at £100, 25 at £400. - Closed February 17th, 2026. Owners Prize Money. Winner £34432; Second £14192; Third £7096; Fourth £3552; Fifth £1776; Sixth £888; Seventh £440; Eighth £224. (Penalty Value £45016) Weights raised 2lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable. 27 Eliminated Under Rules (I)9 and (I)10.

SEE PAGE 40 FOR THIS RACE.

Fourth Race 3.20 - THE TRUSTMARQUE ULTIMA HANDICAP STEEPLE CHASE (CLASS 1) (PREMIER HANDICAP) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £84405 to the winning horse The second to receive £31800, the third £15915, the fourth £7950, the fifth £3990, the sixth £1995, the seventh £990 and the eighth £510. for five yrs old and upwards, which before February 23rd, 2026, have Started in a minimum of four Steeple Chases in Great Britain, Ireland or France. Enter by noon, February 17th and pay £225 stake, Confirm by noon, March 4th and pay £525, Declare by 10.00 a.m. March 8th. Penalties, after February 22nd, 2026, a winner of a steeple chase 5lb No penalty to increase a horse’s weight above 12st. TRUSTMARQUE ULTIMA has generously sponsored this race. Presentations will be made to the winning owner, trainer, jockey and member of racing staff. A £200 award will be given to the member of racing staff responsible for the horse judged to be the best turned out in this race All number cloths to be carried in this race have been sponsored and will carry the name/logo of ULTIMA BUSINESS SOLUTIONS The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code. The British Horseracing Authority will amend paragraphs 28 to 32 of the Weights and Handicapping Code and the Declaration of Jockey section of the Race Entries Code in the event that raising of the weights at the 24-hour stage proves necessary. PLEASE NOTE: The BHA has modified paragraphs 13 to 15 of the Weights and Handicapping Code such that a horse shall only be qualified to run in this race if it has run a minimum of four times in Steeple Chases in Great Britain, Ireland or France. This race will be restricted to 24 runners plus two reserves The two reserves will be nominated as R25 and R26. The procedure for the allocation and operation of the reserves protocol will be as detailed in the notice headed ‘Reserves’ which has been published in The Racing Calendar and which also appears in the reserves notice in the Conditions For Entry Section, accessed from the Information menu on the BHA Racing Administration Internet site (www2.racingadmin.co.uk). Trainers are reminded of the provisions of paragraph 41 of the Race Entry Code which require that they MUST notify the Racing Calendar Office IMMEDIATELY when the decision has been made not to run. This will maximise the list of runners and determine whether the weights will need to be raised. The British Horseracing Authority will modify the Rules of Racing as a consequence of providing two reserves for this race

The non runner penalty will be waived for any horse which is deemed a non-runner by 1.00 p.m. the day before the race PLEASE NOTE: Any

horse for whom a confirmation of entry has been submitted will not be permitted to declare to run if, at the time fixed for declaration, it has been declared to run in any other race at this season’s Cheltenham Festival, which has yet to take place. (This will apply whether subsequently declared a non-runner or not, unless the horse has been eliminated from a race, or declared as a reserve and not been made a non-runner.)

The British Horseracing Authority has modified paragraph 6 of the Weights and Handicapping Code for the purposes of this race, such that racecourse performances up to and including Sunday after Closing may be taken into account. A Confirmation of Entry will not be accepted for any horse for which Medical Records are not submitted to the BHA by 3rd March, 2026 with a further update to be submitted by 6.00pm on the day before the race 62 entries, 27 at £225, 35 at £750. - Closed February 17th, 2026. Owners Prize Money. Winner £64560; Second £26610; Third £13305; Fourth £6660; Fifth £3330; Sixth £1665; Seventh £825; Eighth £420. (Penalty Value £84405) SEE PAGE 46 FOR THIS RACE.

Fifth Race 4.00 - THE UNIBET CHAMPION HURDLE CHALLENGE TROPHY (CLASS 1) (Grade 1) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £262077 to the winning horse The second to receive £98738, the third £49416, the fourth £24684, the fifth £12388, the sixth £6194, the seventh £3073 and the eighth £1583. for four yrs old and upwards, which are allotted a rating or an assessment of 130 or more by the BHA Handicapper, taking account of races run up to and including the day prior to confirmation. Enter by noon, January 13th and pay £560 stake, Scratch by noon, February 10th or pay £1130, Confirm by noon, March 4th and pay £560, Supplementary Entry by noon, March 4th and pay £18000 stake, Declare by 10.00 a.m. March 8th. Weights: 4-y-o 11st; 5-y-o and up 11st 10lb Fillies and mares allowed 7lb. UNIBET has generously sponsored this race. Presentations will be made to the winning owner, trainer and jockey and Unibet will also present £100 to the stable employee responsible for the winning horse and a £250 award to the stable employee in charge of the horse judged to be the best turned out in this race Racing Staff responsible for runners will be provided with a sponsored jacket. The winning owner is to hold a perpetual Challenge Cup until February 1st, next year All number cloths to be carried in this race have been sponsored and will carry the name/logo of UNIBET The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code. THERE WILL BE A PARADE FOR THIS RACE. Horses will be led past the stands and then allowed to canter to the start. (No confirmation of entry is required for Supplementary entries). PLEASE NOTE: A Declaration to Run will not be accepted for any horse if, at the time fixed for declaration, it has been declared to run in any other race at this year’s Cheltenham Festival, which has yet to take place. (This will apply whether or not the horse is subsequently declared a non-runner, unless the horse has been eliminated from a race, or declared as a reserve and not been made a non-runner.) ELIMINATION: If elimination is necessary from this race, the elimination sequence shall be determined by the Elimination and Balloting Procedures (contained in the Race Administration Code) A Confirmation of Entry will not be accepted for any horse for which Medical Records are not submitted to the BHA by 3rd March, 2026 with a further update to be submitted by 6.00pm on the day before the race 17 entries, 3 at £560, 5 at £1690, 8 at £2250, 1 at £18000. - Closed January 13th, 2026. Owners Prize Money. Winner £200459; Second £82624; Third £41312; Fourth £20679; Fifth £10340; Sixth £5170; Seventh £2562; Eighth £1304. (Penalty Value £262077.52) A SEE PAGE 58 FOR THIS RACE.

Sixth Race 4.40 - THE SUN RACING PLATE HANDICAP STEEPLE CHASE (CLASS 1) (PREMIER HANDICAP) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £84405 to the winning horse The second to receive £31800, the third £15915, the fourth £7950, the fifth £3990, the sixth £1995, the seventh £990 and the eighth £510. for five yrs old and upwards, which before February 23rd, 2026, have Started in a minimum of four Steeple Chases in Great Britain, Ireland or France. Enter by noon, February 17th and pay £225 stake, Confirm by noon, March 4th and pay £525, Declare by 10.00 a.m. March 8th. Penalties, after February 22nd, 2026, a winner of a steeple chase 5lb No penalty to increase a horse’s weight above 12st. Sun Racing has generously sponsored this race. Presentations will be made to the winning owner, trainer, jockey and member of racing staff An award of £200 will be presented to the member of racing staff responsible for the horse judged to be the best turned out in this race All number cloths to be carried in this race have been sponsored and will carry the name/logo of SUN RACING The sponsorship payment of £500 will be distributed equally amongst all horses starting in this race in accordance with paragraphs 24 to 27 of the Stakes and Prize Money Code. The British Horseracing Authority will amend paragraphs 28 to 32 of the Weights and Handicapping Code and the Declaration of Jockey section of the Race Entries Code in the event that raising of the weights at the 24-hour stage proves necessary. PLEASE NOTE: The BHA has modified paragraphs 13 to 15 of the Weights and Handicapping Code such that a horse shall only be qualified to run in this race if it has run a minimum of four times in Steeple Chases in Great Britain, Ireland or France. This race will be restricted to 24 runners plus two reserves The two reserves will be nominated as R25 and R26. The procedure for the allocation and operation of the reserves protocol will be as detailed in the notice headed ‘Reserves’ which has been published in The Racing Calendar and which also appears in the reserves notice in the Conditions For Entry Section, accessed from the Information menu on the BHA Racing Administration Internet site (www2.racingadmin.co.uk). Trainers are reminded of the provisions of paragraph 41 of the Race Entry Code which require that they MUST notify the Racing Calendar Office IMMEDIATELY when the decision has been made not to run. This will maximise the list of runners and determine whether the weights will need to be raised. The British Horseracing Authority will modify the Rules of Racing as a consequence of providing two reserves for this race The non runner penalty will be waived for any horse which is deemed a non-runner by 1.00 p.m. the day before the race PLEASE NOTE: Any horse for whom a confirmation of entry has been submitted will not be permitted to declare to run if, at the time fixed for declaration, it has been declared to run in any other race at this season’s Cheltenham Festival, which has yet to take place. (This will apply whether subsequently declared a non-runner or not, unless the horse has been eliminated from a race, or declared as a reserve and not been made a non-runner.) The British Horseracing Authority has modified paragraph 6 of the Weights and Handicapping Code for the purposes of this race, such that racecourse performances up to and including Sunday after Closing may be taken into account. A Confirmation of Entry will not be accepted for any horse for which Medical Records are not submitted to the BHA by 3rd March, 2026 with a further update to be submitted by 6.00pm on the day before the race. 66 entries, 27 at £225, 39 at £750. - Closed February 17th, 2026. Owners Prize Money. Winner £64560; Second £26610; Third £13305; Fourth £6660; Fifth £3330; Sixth £1665; Seventh £825; Eighth £420. (Penalty Value £84405) Weights raised 1lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable. SEE PAGE 64 FOR THIS RACE.

Seventh Race 5.20 - THE NATIONAL HUNT CHALLENGE CUP NOVICES’ HANDICAP STEEPLE CHASE (CLASS 2) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £51440 to the winning horse The second to receive £23650, the third £11830, the fourth £5910, the fifth £2960, the sixth £1470, the seventh £740 and the eighth £370. for novice five yrs old and upwards, Rated 0-145 which before February 23rd, 2026, have Started in a minimum of three Steeple Chases in Great Britain, Ireland or France, at least one of which must be during the current season, and which have been placed first, second, third or fourth in a Steeple Chase with an official distance description of ‘two miles seven and a half furlongs’ or more. Enter by noon, February 17th and pay £150 stake, Confirm by noon, March 4th and pay £350, Declare by 10.00 a.m. March 8th. Penalties, after February 22nd, 2026, a winner of a steeple chase 5lb No penalty to increase a horse’s weight above 12st. Jockeys must have ridden in a minimum of 20 steeple chases under the Rules of Racing, including a minimum of 5 wins in steeple chases (For the avoidance of doubt wins achieved in Point-to-Points do not count as wins under the Rules of Racing.). A Challenge Cup, originally presented by the late Col. P. M. Hamer, O.B.E., is to be held by the winning owner until February 1st, next year In addition, a Challenge Trophy, in memory of Major Sir Guy Cunard, will be presented to the winning rider , to be held until February 1st next year Presentations will be made to the winning owner, trainer, jockey and member of racing staff A £200 award will be presented to the member of racing staff responsible for the horse judged to be the best turned out in this race The British Horseracing Authority will amend paragraphs 28 to 32 of the Weights and Handicapping Code and the Declaration of Jockey section of the Race Entries Code in the event that raising of the weights at the 24-hour stage proves necessary. This race will be restricted to 18 runners plus two reserves The two reserves will be nominated as R19 and R20. The procedure for the allocation and operation of the reserves protocol will be as detailed in the notice headed ‘Reserves’ which has been published in The Racing Calendar and which also appears in the reserves notice in the Conditions For Entry Section, accessed from the Information menu on the BHA Racing Administration Internet site (www2.racingadmin.co.uk). Trainers are reminded of the provisions of paragraph 41 of the Race Entry Code which require that they MUST notify the Racing Calendar Office IMMEDIATELY when the decision has been made not to run. This will maximise the list of runners and determine whether the weights will need to be raised. The British Horseracing Authority will modify the Rules of Racing as a consequence of providing two reserves for this race The non runner penalty will be waived for any horse which is deemed a non-runner by 1.00 p.m. the day before the race PLEASE NOTE: A Declaration to Run will not be accepted for any horse if, at the time fixed for declaration, it has been declared to run in any other race at this year’s Cheltenham Festival, which has yet to take place. (This will apply whether or not the horse is subsequently declared a non-runner, unless the horse has been eliminated from a race, or declared as a reserve and not been made a nonrunner.) The British Horseracing Authority has modified paragraph 6 of the Weights and Handicapping Code for the purposes of this race, such that racecourse performances up to and including Sunday after Closing may be taken into account. A Confirmation of Entry will not be accepted for any horse for which Medical Records are not submitted to the BHA by 3rd March, 2026 with a further update to be submitted by 6.00pm on the day before the race PLEASE NOTE: The BHA has modified paragraph 15 of the Weights and Handicapping Code such that a novice horse shall only be qualified to run in this race if it has run a minimum of three times in Steeple Chases in Great Britain, Ireland or France. 45 entries, 21 at £150, 24 at £500 - Closed February 17th, 2026. Owners Prize Money. Winner £39280; Second £19640; Third £9820; Fourth £4910; Fifth £2450; Sixth £1230; Seventh £610; Eighth £310. (Penalty Value £51440) Weights raised 1lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable. SEE PAGE 72 FOR THIS RACE.

Unibet is the first bookmaker to bring you the revolutionary

digital racecard from the Racing Post.

Each Smart View racecard considers up to 8 attributes influencing a horse’s performance including its overall ability and jumping prowess, the trainer and jockey, the course, distance and ground. Expressed as an overall % – the higher the figure, the better the chance.