Skip to main content

Rural Living - August/September 2022

Page 1

www.ruralliving.co.nz Rural Living — August/September 2022 — 1 August/September 2022 FREE! KARAKA COUPLE’S WOWSHINESPOWERON MIKE BREWER: VIEWS FROM THE BLINDSIDE GEOFF DICKEY: (FISH &) GAME FOR A CHAT CNAAwards 2021 Voted best magazine THINKING

AUGUST/SEPTEMBER

August 20 – October 8 & August 23 – September 13, Franklin Arts Centre, Massey Ave, Pukekohe

Two new exhibitions are set to challenge perceptions. While Lissy Robinson-Cole and Rudi Robinson explore matauranga Maori (Maori knowledge) with Auaha Haukura, Awhitu’s Phil Jordan employs geometric shapes to present visual puns in his exhibition, Geometricks. See www.facebook.com/FranklinArtsCentre for details.

We Read Auckland – Dr Janine Irvine

August 18, 11am-12pm, Pukekohe Library, Massey Ave, Pukekohe Dr Janine Irvine will share insights and tips about researching and writing family and local histories. Part of the We Read Auckland series and Family History Month, this discussion will involve Dr Irvine drawing on extensive experience helping people (including Franklin locals) discover more about their heritage and preserving it in writing. Details via www.aucklandlibraries.govt.nz.

Franklin Club – Centenary celebrations

2 — Rural Living — August/September 2022 www.ruralliving.co.nz

Because hard work is not its own reward, this event also features a morning tea and sausage sizzle. So, grab those gumboots summon up that community spirit and get ready to help plant trees, maintain trails and clean up local reserves. For more information and to register (required) contact Awaroa ki Tuakau Ward Councillor, Jacqui Church, via www.facebook.com/iamjacquichurch.

Auaha Haukura & Geometricks

August 19-21, Franklin Club, 7 East St, Pukekohe

August 28, 8.30am-1.30pm, from Tuakau Hotel, George St, Tuakau

For 100 years, the Franklin Club has been at the centre of the local community. To mark its century, this popular spot is rolling out a full weekend of celebrations, with live music, a gala dinner and dance (Aug 20) and more. For a full programme of events visit www.franklinclub.co.nz.

Tuakau Clean Up, Planting & Trails

2022

Orchids are not exactly 'garden variety', so it’s no wonder these blooms garner specialist attention. Featuring displays by growers from throughout southern Auckland, this show includes plant sales as well as top tips for growing and caring for orchids. For more details visit www.orchidcouncil.org.nz/news/shows

South Auckland Orchid Society Show September 3, 10am-3.30pm, Pukekohe War Memorial Town Hall, Cnr Massey Ave and Edinburgh St, Pukekohe

This year the roar of V8s will prove a swan song for the Supercars Championship at Pukekohe. From April, the Auckland Thoroughbred Racing (ATR) will call a halt to motorsport at Pukekohe Park, so this will be the last Supercars round held at our local track. Visit www.supercars.com/auckland for details and see page 15 to read more about ATR’s decision.

PLEASE NOTE: information regarding times & dates of these events was correct at the time this issue went to print. However, due to the pandemic, events may be postponed or cancelled. In some cases, tickets may be limited or social distancing measures employed as appropriate. Readers are advised to check events online for updates.

www.ruralliving.co.nz Rural Living — August/September 2022 — 3

Pukekohe Cardboard Car Rally September 9, from 3:15pm, Pukekohe Town Square, King St, Pukekohe Roll over van Gisbergen and give McLaughlin the news – you’re not the only Kiwis who can fly around a track! Wearable cardboard cars (or trucks, vans or any other 'vehicle') are the order of the day during this popular event, with categories for businesses as well as little locals. Further information is accessible via the 'PukekoheCardboardCarRally' page on Facebook.

Auckland Supersprint September 9-11, Pukekohe Park, 242-250 Manukau Rd, Pukekohe

Photo Wayne Martin

Mad Doggerel Cabaret August 31, from 7.30pm, OSPA Theatre, Hall Rd, Onewhero Lyrical, comical and musical, this show features poets Daren Kamali and David Eggleton alongside classical guitarist, Richard Wallis. With their talents combined, this trio of modern bards presents a creative portrait of New Zealand and its place in the South Pacific, with laughter par for the course. For additional information visit www.ospa.org.nz.

The funny thing, I think, is that certain stereotypes are still widely accepted –even among those with more modern views on gender roles – provided they’re about men. So, if I was to say that ‘men work and women nurture’, I would only be roundly drummed out of town for part of that statement! It does seem as if the ‘norms’ of household roles have blurred, with men more involved indoors as well as out –whoever works outdoors should take note of our Thinking Spring feature, by the way. There was a time when women were keepers of the home, but these days most two-parent families may often require both parents bring home the bacon as well as cook it. So, while this edition is intended to give the boys a bit of a break (with some reading liable to appeal to dads, granddads, poppas, pas and the like), we’re sure mums will enjoy it too. For a start, we feature a former All Black, Mike Brewer. And, as if one ‘man in black’ wasn’t enough, we also had a little chat

Design: Claire media@ruralliving.co.nzRobertson

Editor:info@ruralliving.co.nz

DISCLAIMER: Articles published in Rural Living do not necessarily reflect the views of the publishers or editor. All material is provided as a general information service only. Times Media Ltd does not assume or accept any responsibility for, and shall not be liable for, the accuracy or appropriate application of any information in this magazine. All the material in this magazine has the protection of international copyright. All rights reserved. No content may be reproduced without the prior written consent of Times Media Ltd.

ACE OF SHEERS? Spring is the time to cut many a project down to size. In some cases, work can be undertaken without calling in the professionals. However, as our Thinking Spring pages (see pages 22-29) reveal, it’s useful knowing our region has plenty of experts able to help. This issue’s cover is intended to celebrate the new season and all those who’ll now get down to work, even if only by picking up the phone. Speaking of which, if anyone has this handsome chap’s number, some members of our team would be most grateful! the district's regional townships, including their key community of Pukekohe. with Keven Mealamu about local What's more, those looking for Father’s Day gift ideas will find more than a just a few on our books and win pages where there are no socks in sight! In addition, just to flip the script, we caught up with a local couple (the Van Der Wats) who have their eyes on the WOW (World of Wearable Arts) awards and Pukekohe’s Jan Richardson who’s long been working on the fashion front too, albeit in a di erent way. Returning to my earlier train of thought, I think this quote sums up what it is to be both a son and a father rather nicely: “When I was a boy of 14, my father was so ignorant I could hardly stand to have the old man around. But when I got to be 21, I was astonished at how much he had learned in seven years.” Well said, Sam! Jon Rawlinson, Editor

COVERSHOT

Aaron Cruden was a good player, just not the All Blacks’ first choice. Coming o the bench whenever Dan (oh, he’s just so gorgeous!) Carter needed a little lie-down, Aaron was a worthy replacement. Similarly, as a dad, that’s how I often feel. However, sometimes being in the shadow of a legend (as mums are) isn’t such a bad thing – it’s great when we can focus more on the fun than the hard work in respect to Withparenting.regards to Father’s Day (September whatever it is, but don’t worry too much because the old man won’t mind!), it is interesting to note the type of gifts advertised. While popular Mother’s Day pressies are all about pampering, dads get socks, undies, smellies and tools. The impressions one could draw from this are: 1) mums work hard so they need a break, 2) dads work but need gifts as encouragement to work harder, and 3) dad’s a bit of slob!

Settling Indesign build SOUTH EAST FRANKLIN O h M g W m R g O C W hangama no s B k W g T n w ha O kae a Po r W a M a o O G M y O p T K h g O h P k R g W M a hu W o o d e W a m a m a T k k T g Te Kauw ha a M WLakeaikare g G N O O W M P E P G B B B G W W S P A W a uku Tu kau P ek e y P p M nu ew a A U CKLA N D D D16 D Big Bay Orua Bay Waitemata Harbour R ower Huia Upper Nihotupu T Tau Bank ake WairoaWairoaBay Mangatangi A WahC n T a m a k i Str a it TamakiRv WaioaRer WukR W t k W d Wa em a a and Gu War dA ber t Eden Rosk War d O k W d H k W d Whau War d Pick-up points in Pukekohe, Waiuku, Tuakau, Pokeno, Drury, HomeArdmore,Kauwhata,Clevedondeliveryareas Distribution A TIMES MEDIA PUBLICATION Freephone: 0800 456 789 • www.ruralliving.co.nz Rural Living is a FREE monthly lifestyle magazine delivered to RD 1,2,3 and 4 rural lifestyle properties in the greater Franklin district and beyond – Pokeno to Drury/Karaka and Clevedon to Waiuku. It is also available from businesses throughout

Jon Rawlinson DDI 09 271 editor@ruralliving.co.nz8036

politics.

4 — Rural Living — August/September 2022 www.ruralliving.co.nz

Sales: Kelly Cooke DDI 09 271 kellyc@ruralliving.co.nz8026 Art Director: Clare McGillivray DDI 09 271 clare@ruralliving.co.nz8067

Publisher: Brian Neben 151 King Street, Pukekohe, POAucklandBox38 232 Howick, Auckland 2145

GOING FOR ‘BLOKE’ from the EDITOR

www.ruralliving.co.nz Rural Living — August/September 2022 — 5 KAT6907-v30 SOLD 23 Kaipo Flats Road, Onewhero Get ready for the spring market today.. R.M. WILLIAMS • BERLIN • BREAKAWAY • CAMBRIDGE • FARAH ... AND MANY MORE QUALITY LABELS 122/124 KING ST PUKEKOHE | PH 0274 549 930 www.lewisforfashion.co.nz Lewis’ for Fashion (on King Street) has styles fit for a king. From hats to coats, suits, belts, socks, boots and shoes – with brands exclusive to Pukekohe including R.M. Williams and Cambridge, as well as Wild Rhino, Breakaway, Farah, Colorado footwear and Silverdale knitwear with R.M. Williams boots and vests for the girls – we’ve been keeping Franklin locals looking sharp for decades.

ASTROANHEADSETA10

COMPOST BINS FROM MITRE 10 MEGA PUKEKOHE Visit www.ruralliving.co.nz to enter our prize draws and be in to win. One entry per person/email address; close September 20,

A BESTBARBER’SPOWER SHAVER

From building and plumbing to farming, having the right tools of the trade is essential. However, as Kane Brisco shows, ensuring those who work ‘on the tools’ are at their best is just as important. Drawing from his own experiences, Kane shares methods to help with the physical and mental demands that come part and parcel with life on the land.

Win!

6 — Rural Living — August/September 2022 www.ruralliving.co.nz

entries

Calling gaming dads, working dads and rocking dads – a new piece of kit has landed! Blending high performance technology with streetwear style and industrial design, the new ASTRO A10 delivers ‘out of this world’ performance. Whether for Zoom calls, gaming or music this headset (available at PB Tech, EB Games, JB Hi-Fi and via Mighty Ape, RRP $119) expects to prove a re-sounding success! While the ASTRO A10 makes the perfect gift idea for Father’s Day, we also have one to give away to a lucky reader. EB Don’t be caught out come spring, get stuck in now and your garden will thank you for it. Kiwis keen to grow their own vegetables at home need not be short on growing mediums thanks to these handy compost bins. Not only does home composting reduce waste sent to landfills, it also helps us turn waste into all manner of garden produce.

Thanks to Mitre 10 MEGA Pukekohe, we have 240 litre Compost bins to give away to THREE lucky readers. See our Jul-Aug e-edition (accessible via www.ruralliving.co.nz) for top composting tips.

Winners notified by phone or email.

Father may know best when it comes to some life lessons, but when choosing the right razor, it’s best to consult a barber. Developed to provide a barber’s shop quality shave at home, Remington’s Barber’s Best features precision, independent floating heads and a pivoting neck for a closer cut. In addition, thanks to its popup trimmer and turbo power function, this handy groomer can assist with delicate manscaping or tackle even the toughest of beards. While these razors make great gifts for Father’s Day, we also have a Barber’s Best to give away to one lucky reader.

2022.

Kane Brisco: Tools for the Top Paddock | RRP $37.99 | HarperCollins Publishers NZ TOOLS FOR THE TOP PADDOCK a Best

www.ruralliving.co.nz Rural Living — August/September 2022 — 7 KC15337-V4 Is your land title about to be issued? We are a dedicated team who live and breathe our passion for building homes for families. Let us help you to realise your dream of a wonderful new home built with care and a commitment to quality. It’s not just by chance that Jennian Homes has been building beautiful homes for Kiwi families for 40 years. • Fixed Price Master Build Contract for your assurance. • The Jennian Homes 100% Completion Promise. Louise Court P 021 645 748 E louise.court@jennian.co.nz Jennian Homes Franklin 2 Buddle Road, Paerata Rise P 09 238 6156 E franklin@jennian.co.nz jennian.co.nz PEACE O F MIND 63 M ONTHDEFECTSWARRA N YT MONTHS 36 Call us for a free site appraisal and design consultation today.

How important is the role that hunters play in pest control? Pest control is so important for all New Zealanders. We have been trapping a Fish & Game block for well over 10 years now and we have seen some remarkable catches during that time. If it is done properly, there are huge benefits and the more people who get involved with pest control the better. There are some great organisations o ering free traps, baits and advice to help get people started. Have government gun control e orts seen the number of hunters drop? If so, is this adversely impacting Pest Free 2050 targets? Sadly, the gun control measures have led to a decline in [the number of] hunters and this is continuing as we see the licencing process (for new licences and renewals) becoming more di cult to negotiate. Also, a lot of blocks are being cut up in size with no hunting then allowed. All things considered, I think that the Pest Free 2050 target is very ambitious. Including the Waikato River Delta and Whangamarino (near Hampton Downs), Franklin has numerous wetlands. How important are they and how vital is Fish & Game in preserving them? These areas are very important, not only as breeding areas for gamebirds and fish but also because they are the natural habitat for a massive amount of native trees and wildlife. Without these areas we would see this important ecosystem decline if not vanish forever. Fish and Game is very much devoted to preserving these areas and actually owns 1700ha of wetlands throughout the region, purchased thanks to hunting licence fees. These areas are well looked after by [Fish & Game NZ] sta as well as by the hunters.

8 — Rural Living — August/September 2022 www.ruralliving.co.nz

What does Fish & Game do? What does a Fish & Game councillor do? Fish and Game is mainly run by paid sta who do a fantastic job of analysing bird and fish numbers, looking after environmental issues, controlling regulations and generally making sure there is fish and game for generations to come. As councillors, we are here to make suggestions to sta about what we see as good policy going forward. Do you hunt, fish or both? Hunting has been a passion since my late uncle (Garry Clark) introduced me to it when I was about five years old. My three boys now also have the same passion. Before becoming a councillor, I'd never really thought about the fish side of ‘Fish & Game’, but I'm tempted to get one of the councillors on the ‘fish bench’ to educate me more through a day out fishing.

Over Geoff Dickey (FISH & GAME NZ) WITH Since 1990, the Fish & Game Council has been devoted to helping preserve New Zealand’s environment and wildlife. To answer more about what the organisation does and issues it is tackling, we reeled in long-time Pokeno local and Fish & Game NZ councillor, Geo Dickey, for a chat… over the gate.

Over THE GATE

To stay up to date with regular meetings and minutes, search 'Auckland Waikato F&G Councillors' on Facebook.

If you could grow any plant or raise any animal (real or imagined) what and why? There are so many animals out there that would be so great to raise, but I think that it would be really cool to raise a baby deer, which I'd then keep around home running free. However, I have to add that, as I currently live in [suburban] Pokeno, that would be a bit hard to do and not exactly practical!

Urban sprawl is changing the landscape of Franklin. How is this impacting the area’s wetlands? What more must be done? I’ve spent a lot of time in the Waikato delta over the years. These days, with more boats, jetskis, and leisure activities taking place there, we have seen the amount of wildlife decline. Many places where wildlife could hide (up the back streams etcetera) are no longer the safe havens that they used to be. As a result of the city 'moving closer', people have also been more inclined than in the past to take their pets for walks in these areas and, when pets are not controlled, they can damage wetlands and impact wildlife, especially young chicks. Sadly, it seems as though any piece of land that can be cut up [subdivided] is going to be. Overall, without a change in thought, and more e orts made to try and safeguard them for years to come, these areas will all be lost.

www.ruralliving.co.nz Rural Living — August/September 2022 — 9

Fish & Game seems to be to the fore during gamebird season, but how busy is the organisation in general?

The gamebird season is always an especially busy time for sta members as many of them are, generally, out in the field educating or enforcing various rules and regulations. Having said that, there is always plenty of additional work to be done across the organisation, which includes a number of meetings held throughout the year.

If you could be Minister for the Environment for one day, what would you do first and why? My first and only day as minister would result in the banning of 1080 across the whole of New Zealand. There are much better resources to be used and so many people out there who would be happy to help [with pest control]. If you could invite any three people (living or dead) to dinner, who and why? First of all, I'd invite my late Uncle Garry so I could show him how spit roasted duck (my favourite way of cooking it) can taste. Also, Laurence Rogers (a friend of mine) would be there as he’s always a good bugger to have around. Lastly, I know this is (technically) two more, but I’d invite the Sapich brothers, makers of the iconic Kiwi wine, Purple Death. Not only would I expect them to bring some bottles, but they’d probably bring a few ducks as well!

Geo Dickey

Invictus they were, but the Springboks were not alone in ensuring the pride of a nation would overcome the much-fancied ‘men in black’, Mike claims. On the eve of the 1995 Rugby World Cup final in Johannesburg, widespread illness in the All Black camp (thought to be caused by food poisoning) led to serious discussions as to whether the team would forfeit. The game went ahead but the result was a 15-12 loss to the 'boks. “Looking back, I think the right team won for the wrong reasons,” Mike pauses then adds: “And for the right reasons too, in a way. It was a great time for South Africa and I’ve never experienced anything like the atmosphere.” Mike pours cold water (hot co ee?) on the myth that the illness was caused by a ‘burger from Suzie’. “It was in the co ee – those who didn’t drink it were fine. Strangely, Jonah [Lomu] was okay. Years later, he finally admitted he didn’t have co ee at the hotel because he went to McDonalds (when he wasn’t supposed to) instead – he thought he wouldn’t have been selected again if he owned up!” he laughs. “It was the British

JOHANNES-BURG(ER)?

10 — Rural Living — August/September 2022 www.ruralliving.co.nz

Mike Brewer: On the loose Michael (Mike) Brewer never had the good graces to play for the Steelers, but we’ll forgive this Pukekohe progeny his oversight! When visiting family locally, the former All Black stopped by our o ces to chat (with JON RAWLINSON) about his career and the current state of play.

Asked if he considered Pukekohe’s Growers Stadium (now Navigation Homes Stadium) to be an ‘old stomping ground’ when he faced the Steelers (not that he ever played dirty!), Mike Brewer laughs. “We didn’t have much success when we [Otago] played Counties, they were our bogey province. I probably would’ve run around the athletic track at Growers more than I played rugby there, though.” Mike made his name sporting Otago’s blue and gold before his All Black debut, but his love of rugby was fostered locally. Considering he later proved to be worth his weight in the All Black lineout, it’s not surprising that he almost rose to great heights in a di erent sport. “I started playing rugby when I was only about three or four, over at Bledisloe Park. And, we had some accomplished coaches and solid teams at Pukekohe High too,” he recalls. “I was skinny as a rake and more into athletics back then, mostly high jump. When I was about to finish school, the NZ Athletic Association wanted me to train as a decathlete and go to Europe. My dad asked who’d be paying for it and the association guy said: ‘you are’. Dad said: ‘well, he’s not doing that then – he’ll play rugby!’ So, that was it, the end of my athletic career!” It was far from the end of Mike's career in sport. After a short stint working and playing rugby league in Australia, he moved to Otago to study. From there, he played for Otago and (later) Canterbury as well as the All Blacks. Oscar Wilde once quipped: ‘rugby is a game for barbarians played by gentlemen’, but (especially in the amateur era) it has been a game for scholars. An Otago University graduate, Mike believes the modern game could continue to benefit from the traditional connection between tertiary study and sport. “I don’t think [players] are no longer interested in studying, I just think New Zealand rugby has taken its eye o the ball. It doesn't really matter what type of degree you have; the biggest thing is the discipline it requires. Whether from studying or training, good discipline is essential to success.” Mike first donned the All Black jersey in 1986, grinding out the hard yards for a decade and claiming 32 test caps. Such a lengthy career can’t be summed up by focusing a single game, but one does stand out, the 1995 World Cup final.

All Blacks v Australia, July 1992 Photo Andrew Cornaga, Photosport

“Working with Murray Mexted, my key role was coaching coaches from around the world, which I really enjoyed. After that I was with NTT in Japan until it all turned to custard because of covid.”

bookies who were behind it. We were favourites going into that World Cup, so if we won, they would’ve lost millions. It’s sad, but whenever there’s betting in sport, things like that can happen.”

“The game's now all based on ‘shape’ [formation], which is a load of crap!” the former All Black says. “Rugby comes down to the speed of the ball from the ruck and players executing their core roles. It should be simple: win possession, go forward, support and score.”

Now based in Foxton, Mike is unsure when he’ll make his next move. “I am talking with a couple of clubs, in Japan and Europe, but I’m not too fussed," he adds. "I’m pretty despondent with the way the game is now for a lot of reasons. For example, although safety is important, players put heart and soul into the game but a slight slip, due to weather or someone falls over, and a red card can mean their whole season’s gone. That doesn’t make sense to me.”

www.ruralliving.co.nz Rural Living — August/September 2022 — 11

Selection from among the current crop should be relatively clear cut. “Pick the best players in their best positions. If that means we have three good openside flankers (Ardie Savea, Sam Cane and Dalton Papalii), pick who’s playing the best. For me, it’s Ardie at seven, [Hoskins] Sotutu at eight with Shannon Frizzell at six. The roles for all three differ, so I think playing Ardie at number 8 is just the wrong choice." Asked who he considers the greatest flanker of all time, Mike doesn’t hesitate and he's modest as to how he would rate. “Michael Jones. For sure. Because of his intuition, anticipation and skillset, other openside flankers at the time loved it when games were on Sundays [Jones didn’t play Sundays for religious reasons] because it’d mean they’d, finally, get a go!” he smiles. “Zinny [Zinzan Brooke] would be right behind him in my books, but I’d put myself way below them. If the current guys could follow their example, it would make a huge difference.”

An ex-blindside flanker, Mike believes games and even World Cups are won or lost up front.

In this year's Rugby Championship, as in Super Rugby, red carded players can be replaced after 20 minutes, but they may still face suspension.

COACH TRIPS

“You need hard, uncompromising workhorses in the second row [including] a real ‘bastard’ type of player. We need more of the likes of Patrick Tuipulotu, who’s a big, ball carrying lock and solid scrummager. Loose forwards should assist [the tight five] in gaining possession, only then becoming ‘looser’, so to speak, on attack. We’ve moved away from these very simpleFlankersprinciples.”(especially on the blindside) also need to be ruthless and intimidating, he“Wecontends.usedto have players other teams were scared of – such as Buck Shelford or even Liam Squire – who’d make the opposition think: ‘Oh hell, I don’t want to mark him again!’ We need more of those.”

HARD YARDS

Unfortunately, his Mancunian move lasted a mere nine matches. “About five English player salaries' took up about 65 per cent of their budget and they hardly played. If someone’s earning five times more than others, you expect them to be totally committed. When I started implementing changes, players [complained] and that was it. It wasn’t a kick in the guts, but it showed where rugby had gone professionally.”

Returning to New Zealand in 2011, Mike ran Golden Horse Feeds in Bombay for a few years. However, his role with International Rugby Academy (IRANZ), based at Massey University in Palmerston North, saw him move down the line before, again, heading overseas.

Considering recent losses, it’s almost unfathomable that the much vaunted All Blacks could claim the 2023 Rugby World Cup. And yet, the New Zealand Rugby Union need not reinvent the wheel to do so, Mike Brewer believes.

After two more All Black caps following the '95 World Cup, Mike embarked on a coaching career. “I married an Irish girl and based myself Dublin," he says. "When Michael Cheika joined Leinster I helped him turn things around, which wasn’t easy – we had a Rolls Royce backline but a bit of a Skoda forward pack.” Mike then (2008-09) undertook roles with Scotland and Fiji (briefly) before joining Sale Sharks as head coach.

FARROWING HARROWING, SAFE CONTENDS Photo

Recent action intended to rein in rodeos has failed to clear its latest hurdle. High Court Justice Peter Churchman has dismissed a review sought by the New Zealand Animal Law Association (NZALA) and SAFE (Save Animals from Exploitation).

12 — Rural Living — August/September 2022 www.ruralliving.co.nz

of SAFE/Farmwatch 1 Winstone House Road Wanting to build? Visit our showhome in Paerata Rise and talk to our team about creating a home designed around you. 0800 752 846platinumhomes.co.nz KC15305-v2

Farrowing crates are most commonly used to house sows before they give been weaned. However, a 2020 High Court decision confirmed their use is inconsistent with the Animal Welfare Act 1999, Ms Ashton states. “Farmers have an obligation to meet the needs of the Animal Welfare Act [and] failure to do so would mean that they will be breaking the law. A ban on farrowing crates is long overdue.”

Although the court found errors in government processes when reissuing the rodeo code of welfare in 2018, it asserted consultation through the National Animal Welfare Advisory Committee (NAWAC) would be ‘the proper place’ to challenge the legality of rodeo. Debra Ashton from SAFE asserts rodeos violate the Animal Welfare Act 1999 and confirms the organisation will bring voice its concerns to NAWAC. “We will not give up and we will continue to seek justice for the thousands of animals abused in rodeo each year,” she says. “It shouldn’t take legal action from charities to prompt NAWAC into action. We would urge them to not delay this review any further.” CHURCHMAN’SDECREE

Consultation, which could precede a ban, is underway with SAFE seeking support on a draft code of welfare for pigs. Visit www.safe.org.nz/take-action courtesy

RODEO:

Use of controversial farrowing crates could soon be limited to a maximum of 72 hours or banned entirely, Debra Ashton from SAFE (Save Animals From Exploitation)“Parliamentexpects.signalled, seven years ago, that farrowing crates would need to be phased out,” she says. “Alternative systems are already in use on nearly half of [all] pig farms in Aotearoa.”

The cause of abomasal bloat is likely multifactorial but, essentially, it’s the result of undesirable bacteria in the stomach feeding on lactose (the milk’s natural sugar) and producing gas. When the stomach receives large volumes of milk, these bacteria breed quickly, until a large milk feed produces so much gas that the stomach stretches irreversibly, bloating and killing the lamb. This condition is not seen in naturally reared lambs that drink very small amounts, continuously throughout the day. A week-old lamb on the ewe may drink up to 36 times daily! Even at seven weeks old, when many bottle-reared babies are gearing up to wean, they will still drink up to 14 times a day from ewes. It’s standard practice, but fewer feeds of large volumes is where these issues begin. Lamb or kid bloat is not always a straightforward abomasal bloat. An ultrasound or x-ray by an experienced small ruminant practitioner may identify another cause, including: intussusceptions, constipation, gut twists, intestinal infections or rumen

Although the exact bacteria responsible for abomasal bloat has not been conclusively identified, there are strong links with bacteria now covered in COVEXIN 10 vaccinations, so we recommend vaccinating animals from two weeks of age.

Looking

Aleading cause of sudden death seen in young lambs, as well as those around weaning, abomasal bloat typically occurs within a couple of hours of a warm milk feed. Some may notice a slow smouldering over a few days as bellies empty slower after each feed.

KAT5238-v22 LATE

PREVENTION Feed animals 10-15% of their body weight (adjusted as they grow), divided into as many small feeds throughout the day as practical. When held at a 45 degree angle, the teat should drip milk, but not flow. Likewise, cracked or damaged teats can lead to a quicker flow, resulting in ruminal bloat.

A potentially fatal condition that may put fear into the heart of any lamb rearer, abomasal bloat is avoidable and treatable if caught early, as Dr Sarah Clews (BScexplains.BVSc) for a healthcare solution that includes EVERYTHING your lifestyle block animals need on an annual basis? TO US TODAY. CALL: 09 298 8575 EMAIL: lifestyle@fvs.co.nz www.franklinvets.co.nz WINTER/EARLY SPRING CHECKLIST ➜ Pregnant sheep & goats –maintain pasture 4cm long from four weeks before labour, through the first six weeks of lactation. Add in pellets for those carrying twins or triplets. Vaccinate and treat for lice 3-4 weeks before lambing. ➜ Weaned youngsters – drench with an oral, combination drench ➜ Alpacas dose with Vitamin D throughout winter, to prevent deficiencies ➜ Pigs – provide extra food and shelter to keep warm ➜ Young chickens – may need worming or coccidia treatment. Monitor closely for diarrhea or weight

ABOMASAL BLOAT IN LAMBS & KIDS

www.ruralliving.co.nz Rural Living — August/September 2022 — 13 VET TALK bloat. Rumen bloat is when milk spills from the baby’s stomach (abomasum) into the adult’s stomach (rumen). If your little one starts bloating, especially with sudden onset, call a vet immediately.

CAUSES & SYMPTOMS

TALK

Provideloss.animals with ‘creep feed’, a highly digestible grain, from five days old. This will help stomachs adjust to adult food and prevents Ruminal Atony, commonly seen in older animals following a sudden change of diet – this causes the rumen (stomach) to become distended and dysfunctional. Yoghurtising milk is still the only proven method for the prevention of abomasal bloat as, by turning milk into yoghurt, lactose (the food source for bacteria) is removed. Adding probiotic yoghurt to milk at the time of feeding does not prevent bloat, however, and may actually increase the risk because some bacteria in probiotic yoghurt also produce gas. Instead, see our website (www.franklinvets. co.nz) for a quick and easy yoghurt recipe. A new milk product on the market, Spray-Fo claims it can help reduce the risk of abomasal bloat. It does so by moving milk through the stomach faster than usual, so there’s less time for bacteria to feast on lactose. Please note that although this product will ensure animals receive everything they need, they will feel hungrier (due to quickly emptying tummies), so access to grass and creep feed is a must! Get this part right and you may notice better growth around weaning as well.

Jockeys, Jason and Alysha (who featured in our previous issue) are both following the family’s long a nity with racing. While the property could be repurposed, Richard is hopeful new owners will make use of it as a training facility. “It is a specialised property, which does narrow down the type of person who would consider buying it. I would like to see it carry on as a racing stable or at least something similar in the equestrian field.”

After 36 years, Richard and Judy Collett may be selling up, but the couple is not yet destined for retirement. Prior to the auction (August 10) for the 4.39 ha Buckland Road property, Richard confirmed Collett Racing Stables will continue operating from a new base across the ditch. “It’s as much a family move as anything else. Our daughter, Alysha, and our son Jason (who now has a child) are both based in Sydney, and there’s more growth in racing over there,” he confirmed. “We’ve subdivided the property over the last few years and now’s the right time to, finally, make the move.”

“We were absolutely thrilled with the results!”

If the new custodians do carry on developing champion horses, Rural Living will seek to speak with them… down the track. More information about the property is accessible via www.barfoot.co.nz. set sale

for

“Their knowledge and calm, mature manner assured us they would always be working to provide the best possible outcome for us. The diligence, professionalism and enthusiasm shown were second to none, and they went above and beyond our expectations throughout the entire sale process. We were absolutely thrilled with the results and would highly recommend these two to anyone who is seeking genuine, hardworking and successful agents. They really are that good!” – Trewren & Natalie So if you’re thinking of buying or selling – call us!

KC15360-v4

14 — Rural Living — August/September 2022 www.ruralliving.co.nz

COLLETT COUPLE

Craig Ashby M 021 998 605 Neil Sharpe M 021 278 6006

See www.pukekohemotorsport.co.nz

www.ruralliving.co.nz Rural Living — August/September 2022 — 15 Ought to be in pictures! To help us share the memories, please send your motorsport photos from Pukekohe Park toWeeditor@ruralliving.co.nz.plantorunaphotospreadaheadofthecurtaincallinApril. P. 09 267 9100 M. 021 842 475 E. info@drillforce.co.nz www.drillforce.co.nz Domestic to Irrigation Water Bores Free Pump Consultation with Local Agents Water Diving Service Available All Workmanship & Materials Guaranteed Free On-site No Obligation Quote WATER BORES NK0252 BIOROCK (NZ) Limited 0800 370 007 Phone: 021 645 717 P O Box 46234 Auckland 1147 Email: dhivesh@biorock co nz AS/NZS 1547:2012 NON ELECTRIC WASTEWATER TREATMENT WWW BIOROCK CO NZ KC15323 It may benefit thoroughbred racing, but a recent decision has left at least one fanAuckland“devastated”.Thoroughbred Racing (ATR) has confirmed 'the chequered flag' for motorsport at Pukekohe Park will 'wave for the last time', a breezy statement from the organisation confirms. “Our purpose is to facilitate thoroughbred racing, [providing] a sustainable future for our sport,” ATR’s Paul Wilcox elaborates. “We need to increase the training density in the region and our site at Pukekohe Park [is] an ideal location… unfortunately, it is not conducive to have both motorsport activities and increased numbers of horses stabled on site.” Pukekohe Park has hosted motorsport since the 1960s and it will likely continue beyond the Auckland Supersprint (September 9-11), right up until the deadline of April 2, however the event calendar will now be reorganised. “I’ve gone back to clubs and promoters to discuss with them how we can celebrate the history [of the track] and have a strong send-o ,” Pukekohe Motorsport’s Gary Stirling says. “I’m devastated for my team, the fans and the future of motorsport in New Zealand. [ATR] has made the right decision for the horse racing community, in my opinion, but it is not a good decision for motorsport. We’ve lost an iconic track.”

Despite the decision, Mr Wilcox has extended his thanks to Mr fanavidfraternity.motorsportandStirlingthelocal“Beinganmotorsportmyself,Iwill always carry great memories of motorsport at Pukekohe Park,” Mr Wilcox adds. “However, I have always said: ‘you don’t live your history, you live your future’, and for our club to ensure sustained long-term success, this change [is needed].”

details of events still set to go ahead.

PUKEKOHE PARK: 'Whoa' Motorsporton DunellTrishPhoto

for

•

Fortunately, awareness has been growing among doctors and patients, she asserts, an important step towards accessing the valuable medicinal cannabis export market. “Slowly but surely, the lift in both patient appetite and doctor awareness is starting to show. Challenges around access continue, but New Zealand’s newest industry is making good strides.”

Septi-cureTM is: Cost Effective • Easy to use Improves Soakage Solids and Scums Eliminates Nasty Odours Reduces Costly Pump-outs need weed?for

KAT6661 A

In previous issues, Rural Living explored the benefits of industrial hemp as a new cash crop. However, medicinal cannabis could also prove a boon for our primary industries, if red tape can be cut, Carmen Doran from Helius Therapeutics explains. “Unlike approved synthetic drugs – marketed on billboards and on television, often with happy senior citizens on bikes – medicinal cannabis products can’t be promoted due to regulations,” she says. “This is despite meeting strict standards ensuring consistency and confidence.” Auckland based Helius secured the brass ring as the first New Zealand business to gain GMP (Good Manufacturing Process) certification from Medsafe, producing medicinal cannabis products for Kiwi patients since October 2021. And yet, as the Medicines Act still prohibits advertising, awareness remains limited, Ms Doran contends. “Kiwi doctors can simply scribble on their prescription pad and o you go to the pharmacy. However, doctors are not going to prescribe if they don’t know enough, and many still don’t,” she says. “This is not about growing pot, this is about pharmaceutical grade medicines manufacturing.”

WOOL

•

16 — Rural Living — August/September 2022 www.ruralliving.co.nz 0800 109 202 Also Available at:  Cost Effective  Easy to use  Impr Soakage  Reduces Solids and Scums  Eliminates Nasty Odours  Reduces Costly Pump outs Septi cureTM is: www.ecoworld.co.nzATTENTIONSEPTICTANKOWNERS Breakthrough Product Developed for your Septic Tank Breakthrough Product Developed for your Septic Tank SEPTICATTENTIONTANKOWNERS

COMEBACK?MAKING

Millennials appear to be taking a ‘back to the future’ view when it comes to floor coverings. An appreciation of sustainability seems to be behind the results of a survey commissioned by a leading carpet producer and could benefit farmers. “Cost has been a key di erentiator in the local market,” Greg Smith from Bremworth says. “However, that was before there was recognitionwidespreadoftheenvironmental impact synthetic or plastic productsTrackingcreate.”perceptions over the past three years, the study found wool is recognised as ‘environmentally friendly’ by 77 per cent and ‘sustainable’ by 69% of respondents surveyed. New Zealand’s wool product exports (mostly carpet) have fallen by 44% over the past six years, Mr Smith says, but forecasts indicate export revenue is poised to increase.

• Reduces

“If we can’t educate domestic consumers on the benefits of wool in a country where it is produced e ectively, we will have little chance of growing o shore markets, [but] the research has shown us the industry is making significant advances on this.”

•

Should Kiwis continue to favour wool, it could fuel a worldwide resurgence. “From the research we know that half of those in the market for renovating or refurbishing their homes are now in the millennial age bracket,” Mr Smith adds. “This is a market segment looking to wool for a range of reasons that weren’t priorities for the generations that preceded them.”

•

for You! KAT5314-v23

It’s not always the fastest horse that finishes first. As our previous issue went to print, a trusted local pony, Dancer, was named New Zealand Riding for the Disabled Association’s (RDA) Horse of the Year for 2021. “I’m very passionate about our horses and riders, so when I heard Dancer had won, I had the happiest of hearts,” says Loraine Grant from Totara Park RDA. “She’s such a beautiful horse and deserved the recognition.”AlthoughDancer is now enjoying a wellearned retirement in Karaka, her sensitive temperament was an asset for 11 years as she helped disabled people experience the joy of riding, Loraine asserts. “From therapy to recreational riding, she was amazingly sensitive. She senses when riders need her to help their confidence by gently responding to tentative instructions. Dancer was an all-time favourite at Totara Park; everyone involved knew, loved and respected this horse. Without seeking or knowing it, she’s become a legend!”

SMITH MAKES CUT Irish eyes were smiling following recent rugby victories over the All Blacks, but this year’s Sharp Blacks are aiming to turn that Emerald Isle smile upside down. Achieving selection in the Sharp Blacks (again!), Franklin’s James ‘The Tattooed Butcher’ Smith and team will need to be on top of their 'game’ in California (September 3) during the World Butchers’ Challenge. Teams will be required to undertake tasks putting their butchery skills to the test, competition organiser, Ashley Gray, confirms. “[It] is a one-of-a-kind experience seeing the sheer strength of these butchers as whole sides of beef are broken down in mere minutes, to witnessing the delicate flair and speed of products being plated up.”

CHITTY BANGS GONG

For more information about riding for the disabled visit www.totaraparkrda.org.nz. Also see Angela Kemp’s article (June-July 2019), e-edition via www.ruralliving.co.nz.

WAIT, THERE’S MORE! Horticulture New Zealand (HortNZ) has been honouring growers (and growing concerns) with its annual awards, including an Environmental Award presented in Pukekohe to Penrosebased Market Gardeners (MG). Details are available via www.hortnz.co.nz. And, more top growers received accolades through the Arable Awards of New Zealand –see www.fedsnews.co.nz. In addition, Warkworth Butchery brought home the bacon while Westmere Butchery raised the (ham) steaks winning Supreme honours in the recent Bacon & Ham Awards.

Dancer – NZ RDA Horse of the Year for 2021.

www.ruralliving.co.nz Rural Living — August/September 2022 — 17 Plaudits a-plenty!

Products for your Pets Coffee

Locals and others in the primary industries have been on a roll (and on the honour roll) recently, including: Mark Chitty PhotographyCornegePhoto

and

Visit www.worldbutcherschallenge.com for further information. And, to read more about James Smith, see Rural Living’s June-July 2018 and Nov-Dec 2020 e-editions, via www.ruralliving.co.nz.

GOLD & SILVER SERVICE

Other locals in the winners’ circle recently were Mark Chitty and Jaimee Gowler from Karaka’s Haunui Farm. The pair claimed Personality of the Year and Young Achiever awards (respectively) at the Breeder of the Year Awards. Matamata’s Waikato Stud claimed the highest honours, overall Breeder of the Year, among other titles. Details at www.nzthoroughbred.co.nz.

RIGHT ON, DANCER!

Finally, although they aren’t related to the rural sector, Pukekohe Swimming Club’s Andrew Je coat won gold with Tupou Neiufi securing a silver medal, both in backstroke, at the Commonwealth Games. Well done!

The perfect opportunity for children to learn about the responsibilities involved with rearing animals, Calf Club events (as well as Agricultural Days, Country Days and the like) are set to take centre stage again soon. For more information, visit www.calfclubnz.co.nz, www.lic.co.nz/about/calf-club or contact your local school. And, don’t forget to send us your photos or little ditties related to these events (to editor@ruralliving.co.nz) as we’d love to share them in print or online.

Public feedback is welcome until August 31 and the plan will be reviewed in September with a new design presented in February. More information is accessible via www.ekepanuku.co.nz/Pukekohe.

RURAL TOWN GROWS UP!

Commuters expecting to hop on a train at Pukekohe station are in for a long wait – until 2024 at least. Although the diesel trains between Pukekohe and Papakura have now ceased rolling, work to electrify the line is set to ensure a faster service in future. The project includes redevelopment of the Pukekohe station and the addition of three new stations, two in Drury and one in Paerata. The final section of Auckland’s network to be electrified, Pukekohe-Papakura is expected to be running again from late 2024. Until then, Auckland Transport has extended the 394 bus service as a replacement. 'BITES'

#BREAKING

RAIL – WORKS ‘STATIONARY’

“We’re growing because people want to live in a place that still has that country feel, but we can’t pretend we aren’t changing,” Franklin Local Board Chair, Andy Baker, says. “Our population will nearly double over the next 20 years so now’s the time to plan for the changes needed to make our town even better.”

MartinWaynePhoto

For the most part, news cannot be served in bite-sized pieces. However, in e orts to serve readers a balanced diet of news (is there any such thing?), we’ve included the following matter-of-fact morsels to chew over. A ‘masterplan’ designed to ‘drag shoppers’ into Pukekohe is unfolding. In addition to the new health hub (under development on Manukau Road), intended work includes new leisure facilities and community spaces, roading and wider footpaths with upgrades to shop fronts and the local markets.

18 — Rural Living — August/September 2022 www.ruralliving.co.nz Phone 09 238 4047 or 021 987402 601 Buckland Rd, RD2, CraigExperiencedPukekoheOperator35years+NicholsonEarthmoving&GeneralCartage l Tree Removal l Drainage l Roading l Stopbanks l Building sites l Demolition l Horse arenas l Metal/sand/slagsupplied l General cartage l 1.7 to 26 tonne diggers • Rollers l Tip trucks & trailers l D65 Bulldozer & scoop l Low loader l Grader l Excavations l Dams KAT5289-V2 CHRIS JULIAN Freephone (0508) RURAL H20 (0508) 787 254 Chris mobile 021 765 629 Water Tank Cleaning (While full or empty) Water Tank Maintenance Water Deliveries ~ Swimming Pools Filled KAT5306 Grant EscottCONTRACTORFENCING • Decks • Post Driving • Retaining Walls • Rural & Residential Fencing 027 236 8753 • 09 236 grant.kylie@xtra.co.nz8753 Free quotes – Competitive rates KAT5317 SST SERVICES 21E Ryan Pl, Manukau p: 09 294 7611 e:e:sstseptictanks@gmail.comjohn@drurytrucks.co.nzJohn:0274923669Robbie:0274967430 SEPTIC TANK GREASEANdTRAPCLEANING KAT5226-v3

CALF CLUB DAYS ARE NEAR AGAIN!

FED (UP) FARMER, RACY REACTION Franklin’s rural residents may be lucky compared to their Taranaki counterparts, recent comments from Mark Hooper (Federated Farmers Taranaki) suggest. Fortunately, he stops short of advocating vigilantism as the answer to his region’s ‘boy racer’ “Farmersproblem.areincreasingly frustrated and disappointed by what appears to little or no action taken against the boyracer behaviour,” he exclaims. “While we wouldn’t recommend any farmer taking matters into their own hands with unruly individuals and groups, we understand farmers’ anxiety about their personal safety, tra c safety, harm and stress to livestock, and damage to property.”

FARMER LESSONSTIME:ONLINE

FAIR CALLS STOP ROT Fair Food is calling on Kiwis to help ensure fruit feeds need rather than be left to rot. The food rescue charity, which donate.fruitanyoneyear,millionwithcommunitysuppliesgroupsmorethan2.4mealsperisencouragingwithsurplustopickandInaddition,we can all learn how to make the most of seasonal produce through Fair Food’s new Conscious Kitchen workshops. For more information see www.fairfood.org.nz.

Cherry Cooper &Alison Kemp YOUR VISION ... OUR MOTIVE! Cherry: 021 955 141 Alison: 021 848 888 Extraordinary Reach Extraordinary Results! 40yrs combined experience in unique lifestyle living. ‘UNIQUE DUO’ KAT7821-v3

We may not be able to teach old farm dogs new tricks but youngsters could learn a thing or two from farmers, a new programme aims to prove. “Farmer Time [the programme] puts actual farmers in front of children and gives them genuine insights into how our food is being produced,” Kit Arkwright from Beef + Lamb explains. “The feedback from both teachers and farmers has been incredible.”Although the ‘actual farmers’ are real people, they share wisdom through virtual classroom sessions. Originating in the UK, Farmer Time is intended to help students gain an understanding of farming throughout the seasons. Following a pilot version of the programme, which began earlier this year, Farmer Time is set to be expanded nationwide. For details, visit www.farmertime.co.nz.

www.ruralliving.co.nz Rural Living — August/September 2022 — 19

If any Franklin farmers are concerned about such behaviour, please email: editor@ruralliving.co.nz.

Despite Rural Living’s glib introduction, Mr Hooper is raising a serious issue; Taranaki’s ‘illegal congregations of boy racers’ is ‘an unwanted perverse outcome of government cutbacks,’ he adds. “The lack of rural policing in this situation is forcing otherwise law-abiding farmers being labelled as ‘the bad guy’.”

Falsespring?

20 — Rural Living — August/September 2022 www.ruralliving.co.nz Control and achievable Pest Solutions & Biosecurity Services Professional Experience Mob: 027 393 2125 KAT5292 community – trapping, shooting, rabbit control is available. Stoats & Weasels • Rats & Mice Pest Bird Control • Wasps all animal pests, call us today! www.coastalpestsolutions.co.nzRabbitControl is fast, efficient and achievable Protect your land and environment from all animal pests, call us today! • Possums • Rabbits & Hares • Ferrets, Stoats & Weasels • Rats & Mice • Feral Cats • Goats • Pigs • Deer • Pest Bird Control • Wasps www.coastalpestsolutions.co.nzCoastalPestSolutions Wild Animal Control & Biosecurity Services 23 Years’ExperienceProfessional Tel: 09 536 6020 Mob: 027 393 2125 Email: info@coastalpestsolutions.co.nz KAT5292-v2 Coastal Pest Solutions are working in your community – trapping, shooting, poisoning and dog work. Non toxic rabbit control is available. P a u l Vo o r b u rg | 021 029 05733 | paul.voorburg@bayleys.co.nz BAYLEYS REAL ESTATE LTD, PUKEKOHE, LICENSED UNDER THE REA ACT 2008 YOUR LIFESTYLE PROPERTY EXPERT PAUL VOORBURGERT Looking to buy or sell? Call your local “good guy” for all your real estate needs. P a u l Vo o r b u rg | 021 029 05733 | paul.voorburg@bayleys.co.nz BAYLEYS REAL ESTATE LTD, PUKEKOHE, LICENSED UNDER THE REA ACT 2008 YOUR LIFESTYLE PROPERTY EXPERT PAUL VOORBURG Looking to buy or sell? Call your local “good guy” for all your real estate needs. KC15446-v2

I’ve come across lots and lots of possums lately – they’re usually well under control by this part of the season but they just keep showing up (on grass, anything flowering or budding) and it’s worse now that certain trees, such as pines and willows, are coming into flower/bud, which is also happening super early. Then, as I’m gutting rabbits, I start seeing that all the female bunnies are pregnant too, at a time when we rely on rabbit numbers declining. If we really are going into a pattern of higher winter temperatures, we could very easily lose this important natural control with the problem getting bigger each season. Damn, it looks like the climate change folks have finally got my attention! That’s it from me for now. Go and get your predator traps dusted o as it looks like the summer season may start sooner than you think!

By Ditch Keeling, Coastal Pest Solutions Gidday Folks. I got a call from a mate recently who’s usually a forestry consultant up here, but he has been working in Otago. He was crying down the phone about slogging away with the temperature at -4 degrees – I bet you’re not in your stubbies now, aye Grunter? Anyway, his call’s had me thinking about conditions around Auckland at present – has anyone else noticed how ‘springish’ it’s been lately? We’ve certainly had the wet, and I had the quad inextricably stuck twice in the last month just to prove it, but it’s been very mild overall. I’m starting to see lots of spring-type pest movement, which really is a bit of a worry. For a start, it changes a lot of our plans and brings the urgency of spring work forward by two months. These conditions are also starting to look similar to significant seasonal shifts seen around the world. Personally, I’d rather avoid all discussions around global climate change, but it’s quite in your face when you’re up to your knees in mud, in short sleeves and perfectly warm at 2am!

Soon enough, farmers may not need dig too deep (in one way) to help reduce some negative environmental impacts. “We need innovative tools and technologies to help farmers reduce nitrogen fertiliser use while maintaining production and profitability,” Mr O’Connor said. “Finding new methods for the health of our soils, waterways and climate will pave the way towards a healthier future for us all.”

Pukekohe

Damien O’Connor

Sharleen Buchanan Branch Manager | 021 404 871 | sharleen.buchanan@bayleys.co.nz KC15361-v4

NEXT GEN', REGEN'?

“Because this trial is being run at a whole-farm scale, it will provide especially useful information for farms of a similar size," Mr O'Connor added. "We are investing to help lift sustainability in ways that capture value in markets abroad. When we get this right, we become the best farmers for the world.”

Lyn Penney Takanini Branch Manager | 021 194 1700 | lyn.penney@bayleys.co.nz

Responsible for portfolios including Trade and Export Growth, Biosecurity, Agriculture and more, Damien O’Connor is a minister with more than one ‘primary’ concern, as our summations of reports from his o ce confirm.

www.ruralliving.co.nz Rural Living — August/September 2022 — 21

CAN YOU DIG IT?

As mentioned in Rural Living’s July-August issue, Biosecurity NZ has employed new measures at the border in e orts to ensure the FMD outbreak does not spread to Kiwi farms. More information about FMD is accessible via www.mpi.govt.nz.

SELLING? LET US SHOW YOU HOW. LICENCED UNDER THE REA ACT 2 008 ALL LIFESTYLEOVER

WHAT’S UP WITH D.O’C...

D.O’C ON FMD Billed as a “doomsday disease” by Damien O’Connor, foot-and-mouth (FMD) must be kept out, he asserts. “We strongly urge anyone who [has been] in contact with livestock in Indonesia, to stay away from farms and animals in New Zealand for one week,” he said with regards to the recent outbreak aborad. “We also ask if anyone sees their pigs, goats, alpacas, llamas, cattle, sheep or deer with symptoms including high fever, mouth and feet blisters or erosions and lameness, to call their veterinarian or MPI’s exotic pest and disease hotline on: 0800 80 99 66.”

A new trial in Canterbury could yield profitable outcomes for dairy farmers nationwide, Mr O’Connor expects. “Called ‘Te Whenua Hou Te Whenua Whitiora (The New Land, The New Horizons), the programme will [assess] the impacts of regenerative farming,” he said earlier this month (August). Results from regenerative practices will be compared with those at a neighbouring, conventional farm. The trial should demonstrate enhanced soil health, lower environmental footprint, reduced water use and more, while remaining profitable.

The N-Vision NZ programme features N-Retain, N-Test and N-Bio Boost. Combined, these ‘technology streams’ are intended to reduce nitrous oxide emissions and nitrate leaching, as well as reduce reliance on nitrogen fertiliser and increase the e ciency of nitrogen in soil. The $22 million programme is a collaborative e ort between government, Ravensdown, Lincoln University and Plant & Food Research.

THINKING

cut down to size.

Apoor workman blames his tools; poor workmen don’t last long on the land! Fortunately, whether we’re after state-of-the-art tractors and machinery, pest control products, or even just a trusty spade or tools for DIY around the home, our region has many businesses with the right gear to get the job done. For farmers and lifestylers, spring is the perfect time to address certain maintenance projects. Ensuring machinery is in top form, fences are up to scratch and many other ‘I’ll get to that when I have five minutes to spare’ projects are now topping that ‘to do’ list. In addition to servicing trusty equipment and machinery, it’s also the perfect opportunity to look at what’s new on the market. As sustainability and e ciency are becoming driving factors when working on the land – and because Kiwis have always been top drawer when it comes to No.8 wire thinking – chatting with experts about new technology is now more important than ever. As we can’t even run a lifestyle block these days without dealing with politics, expert advice from the likes of Federated Farmers, Dairy NZ, Pukekohe Vegetable Growers Association and other industry groups can go a long way.

And, of course, there’s work to be done on the ‘home front’ too. Whether landscaping new gardens or revitalising older spreads, it’s important to look before your leap if you’re planning to avoid common pitfalls. Indoors, renovating tired-looking rooms is more suitable now that there’s finer weather ahead as we may avoid muddy tradesmen’s boots! Once again, local retailers can help with what needs to be done and how to do it, from floor to ceiling. So, if your focus is reaping, rearing, mowing or renovating, spring is a time for many purposes and, in Franklin, there’s a place to get everything you’ll need. farms, cuttheThanksmuch-neededtounits,villasblocks,greenhousesorchards,andlifestyletobackyards,countryandevenapartmentsorcomespringweallneedgetstuckinwithsomemaintenance.tolocalexperts,evenbiggestprojectscanbedowntosize. MAINTENANCE

From

Gearing up! SPRING

22 — Rural Living — August/September 2022 www.ruralliving.co.nz deutz nz PERFECT FOR HILL COUNTRY RAMMERREADY READY CHAINSAW MULTI-FASTENERSELFCHAINSAWPACKAGEMOUNTLEVELLINGLOADERTRACTORREARGUARDUPGRADEDTRIMAQ4PROREARWHEELBALLASTWITHTHIRDSERVICE,EUROHITCH,&BOOMSUSPENSION$1000 Terms and conditions apply. Images may differ from products advertised. For a limited time and while stocks last. AGROFARM 100G Power Farming Auckland 7 Adams Drive, Pukekohe | 09 239 1200 KC15404-v4

Ravensdown’srisingstar

Of her challenges to date, she says spending 122 days of 2021 in lockdown was one of her toughest, one many of her colleagues based elsewhere in the country largely avoided. “I found di erent ways to do things. One

“While I might undertake a fertiliser recommendation for an Awhitu Peninsula dairy farm in the morning, after lunch I may switch to working out how to maximise growth for a horticulture crop such as broccoli, or head out soil testing. In every case our emphasis is on providing sound and consistent, expert advice.”

example was better utilising HawkEye, our mapping software, which enables us to assign fertiliser to specific paddocks and blocks with much greater accuracy. That was beneficial for many customers, particularly livestock farmers, who are now legally required to calculate and account for their nitrogen use.”

Originally from Southland, Claire grew up on a dairy farm before attaining a Bachelor of Agricultural Science (Honours) at Lincoln University. A little over three years after completing Ravensdown’s graduate programme, she gained her prestigious Agri Manager of the Year title from a field of approximately 90 Ravensdown“Agricultureprofessionals.wasalwaysmy most likely career,” she adds. “While becoming established in my career, I have everything to gain by being courageous, going hard and staying open-minded; that’s my philosophy and I love it!”

Claire Verhaegh Sponsored content

Claire says she tries not to 'bombard' her customers with too much information and focuses on accurate background work to deliver simple solutions. “In this job removing customers’ stress is critical. Fortunately, Ravensdown has some highly respected scientists and introducing their expertise is usually the best way to set clients right.”

Ayoung, primary sector professional and keen advocate for agriculture, Claire Verhaegh (Ravensdown’s Agri Manager of the Year 2022) works with approximately 150 Franklin farmers and growers. In addition to dairy and sheep and beef, her customers farm everything from goats to lettuces, plums, watermelons, broccoli, macadamias and more.

www.ruralliving.co.nz Rural Living — August/September 2022 — 23 KC15510

Claire’s primary expertise involves soil nutrients. She provides advice regarding tailored fertiliser requirements for each individual enterprise, including methods to optimise productivity, while abiding by environmental regulations. As land use in Franklin is so varied, her patch is one of the most diverse in Ravensdown’s network.

CLAIRE VERHAEGH:

24 — Rural Living — August/September 2022 www.ruralliving.co.nz KC15495 Ph 09 237 0048 | sales@countieshonda.co.nz | www.countieshonda.co.nz | 19 Massey Ave, Pukekohe HONDA RUNRUN2022SERVICESFULLENGINESMARINEANDMECHANICALCRFRANGEOUTOUT On Now! WHILE STOCKS LAST Available Now! • MOBILE MARINE SERVICING • MARINE REPOWER SPECIALIST Counties Honda

◆ Vinyl: A relative newcomer to the market as a fencing material, vinyl can be designed to resemble wood or metal without rotting, rusting or becoming a home to pests. In addition, a good wash once a year will keep it looking good as new

◆ Pressure-treated wood: Wood fences o er a sense of timeless style. Although pressure-treated wood can last decades, it does require annual maintenance, such as painting and staining to ensure it goes the distance Regardless of your choice in terms of materials, it pays to opt for quality; cheaper materials can save money in the short term only to cost more in general upkeep, repairs or even replacement. in? 296

www.ruralliving.co.nz Rural Living — August/September 2022 — 25

6435 • www.clevedoncounty.com easier gardening DY0716 CLEVEDON COUNTY PAPAKURA NEW! Fruit & GathererNut Finance conditions are on 1 - 6 Series tractors currently in-store only. * Conditions apply. Finance available through John Deere Financial Limited to approved commercial applicants only. O er is based on; 20% deposit, GST back and 36 month term. Fees and charges of $425 apply. Expires on 31st August 2022. KC15523 09 238 3281 | 143 Manukau Rd, Pukekohe Celebrating 65 years Brands in store: • King Tony • Makita • Enzed • CRC • Strata • Koken • Knipex Come in store for: - hydraulic hose and seals servicing - a wide range of bearings and bolts - wall to wall quality tools ...and many more! See our workshop for : - PrecisionEngineering - Machinery Repairs - Hydraulic Servicing - Steel sales - Site work 09 238 3281 | 143 Manukau Rd, Pukekohe Celebrating 65 years Brands in store: • King Tony • Makita • Enzed • CRC • Strata • Koken • Knipex Come in store for: - hydraulic hose and seals servicing - a wide range of bearings and bolts - wall to wall quality tools ...and many more! See our workshop for : - PrecisionEngineering - Machinery Repairs - Hydraulic Servicing - Steel sales - Site work 09 238 3281 | 143 Manukau Rd, Pukekohe Come in store for: • Hydraulic hose and seals servicing • A wide range of bearings and bolts Brands in store: • King Tony • Makita • Enzed • CRC • Strata • Koken • Knipex ....and many more! See our workshop for: • Precision Engineering • Machinery Repairs • Hydraulic Servicing • Steel sales • Site work • toolsqualitytoWallwall NK0210

◆ Brick or masonry: Such fences can also withstand the test of time and are relatively easy to maintain. Having said that, they can be pricey and must be installed by professional masons

On farms or lifestyle blocks, function often trumps form when it comes to fences. On the home front, in addition to providing privacy and security, they can also add to a property’s value through ‘kerb appeal’. In either case, spring is the perfect time to nail such projects. While some take the DIY approach, others will call in the professionals, but knowing what type of fence you’re after is an important first step. So, here are some pros and cons of the most common fencing materials: ◆ Wrought iron: These fences can last for hundreds of years if regularly maintained. However, iron is prone to rust so it must be repainted regularly

◆ Aluminium: lightweight and easy to install, aluminium fences are unlikely to rust. As an added bonus, aluminium requires little-to-no maintenance and it can also be painted in order to match a home’s exterior

FENCES: you

Ph 09

26 — Rural Living — August/September 2022 www.ruralliving.co.nz KC15512

www.ruralliving.co.nz Rural Living — August/September 2022 — 27

www.ruralliving.co.nz www.timberlinecontracting.co.nz Making your ‘growing problem’ our concern! Your local tree professionals • LARGE SCALE TREE WORK • TOPPING/REMOVALSHELTERBELT • WHOLE CHIPPINGTREE • LAND CLEARING • MULCHING • LOGGING • STUMP GRINDING Providing professional (and fully insured) services throughout the north Waikato and Auckland regions, we've been rising to the occasion since 2008. As an industry leader in shelter belt topping, tree removal and whole tree chipping, Timberline Contracting Ltd consists of a small team of tree professionals who take pride in a job well done. Our state-of-the-art machinery is designed specifically for efficient, cost-effective tree removal, even when working in the tightest of spaces. In addition, as we provide complete clean-up solutions, you will hardly know your trees were ever there by the time our work is done. MEET THE TEAM Get in touch for an obligation free quote Check out our website for further information, including photos!

Rural Living — August/September 2022 — 29 0800 FOR WOOD 88 Ararimu Road, Ramarama Open 7.30am – 5pm Weekdays, 8am – 2pm www.timberlinecontracting.co.nzSaturdays Your local supplier of all things landscaping Timberline Landscape Supplies o ers quality products, top notch service, helpful advice, free loan trailers, delivery options, bulk discounts and much more. • MULCH/WOODCHIP • AGGREGATES/GRAVEL • SOILS/GARDEN MIX • PEA STRAW • SLEEPERS/EDGING • FIREWOOD TinSuppliesLandscapeimberlinelaunched2015,selling mulch and firewood as a by-product.Sincethen we have grown significantly and now stock more than 50 products.Wellknown by locals, the friendly and helpful team at our landscape supplies yard is proud to have built a reputation of trust and respect within our community. Located right next to the motorway in Ramarama, we have a large range of landscaping and gardening supplies such as: MEET THE TEAMSOUTHERNMOTORWAYSOUTHERNMOTORWAY ARARIMURD ARARIMURD HILLVIEWRDMCELDOWNIERD MAHER RD WEHEREARE DRURY BOMBAY

30 — Rural Living — August/September 2022 www.ruralliving.co.nz

Animals or not, Snivelling Snoo-galas, Bouncing Boo-galas and even Twohorned Trumpeting Sea Rompsters are curious creatures and some of them could be living in your house! Because good little girls certainly don’t make messes, there must be some explanation for all the disorder. But who’s the real Messyo-saurus? All is revealed in this wildly imaginative children’s book. .

More than just a ‘good, keen man’, Barry Crump was a rugged outdoorsman and an adept writer. In this book, his sons (Ivan, Martin, Stephen, Harry, Erik and Lyall) step into Barry’s titanic gumboots to tell their stories about growing up in (and out) of the shadow of a legend in this in-depth ‘warts and all’ chronicle.

Rachel Weston & Scott Tulloch (illustrator): Messy-o-saurus | RRP $22 | Weston Books A OFLOADBULL

After falling in love with a Kiwi farmer, Amanda King became infatuated with country life too. Combining these passions with her talent for photography has led her to produce a book that’s full of… bull! But this is not just a collection of stunning photos, it also includes stories behind her subjects, including information about the breeds themselves and more.

The Crump Brothers: Sons of a Good Keen Man | RRP $38 | Penguin MESSY-O-SAURUS

Ross Taylor (with Paul Thomas): Black & White | RRP $49.99 | Mower/Upstart Press THE MONKEY AND THE MOONBEAM NicNic is on an adventure, but can this little monkey ever reach the brightest of all jewels? In this children’s book, Jonathan Smith gently reminds young readers about the importance of the simplest things in life during a magical journey through an amazing part of the world.

SONS OF A GOOD KEEN MAN

ROSS TAYLOR –BLACK & WHITE

Jacqueline Harvey: Willa and Woof – Mimi is Missing | RRP $15.99 | Pu n

Amanda King: A Load of Bull | RRP $50 | Penguin WILLA AND WOOF –MIMI IS MISSING In the first instalment of what promises to be an imaginative series, eight-yearold Willa and her best friend, Woof, have an intriguing mystery to solve. From the bestselling Queenstown-based author of the popular Alice-Miranda series, Willa and Woof books are intended for readers aged six or above.

Some children can boast that their old man was an All Black (or a Black Cap), but there are very few who can say their dad is Ross Taylor. One of the greatest to play for the Black Caps, Ross’ record speaks for itself, with more runs in international cricket than any other New Zealander. In this autobiography, Ross shares stories from behind the scenes about the challenges of top-level sport.

Jonathan Smith: The Monkey and the Moonbeam | RRP $30 | Little Love

ANIMALANTICS BOOKS –DAD'S FAVOURITESDAY

Phone Bru

www.ruralliving.co.nz Rural Living — August/September 2022 — 31

Every homeowner wants to enjoy a feeling of pride and comfort when driving up to their home not just for the first time, but every time. And, that’s exactly what the team at Homes by Nest works hard to create – even the name reflects that sense of warmth and snugness which envelops homeowners when they walk through the front door into their very own living space. Goldfinch 021 215 8368 www.homesbynest.nz

• Email bru@homesbynest.nz •

What a busy month we’ve had, so busy that I didn’t get to the Elvis movie (mentioned in our last issue), unfortunately. So much has happened, however, with the jewel in the crown on August 2 the birth of our great-grandson. What joy there is when a baby arrives and everyone’s mood is raised. We feel so very blessed that this wee man, Bentley, and his mum are both well and, while I am biased, he is just beautiful! It is twenty-one years since we had a baby born into our family so there has been much excitement. I went into a few baby shops to see what I would buy him, which is a whole new type of shopping experience for me. As I write this, Bentley is only a week old so there is plenty of time for me to shop. And, as the family lives in Hamilton, it’s not too far for us to pop in for visits, and cuddles, of course. It has been a time for family in more than one way as, the weekend before Bentley’s arrival, we had family from Tauranga up to stay with us, which is always fun. I took the opportunity to utilise my big, strong son in lifting bags of potting mix and plants upstairs so I could start planting on my deck – more on that later. When they were visiting last year, our visitors had to get away fast before the borders closed due to the Auckland lockdown – it was the second such Reay Neben, Logan Bennett, Beth Neben, Brian Neben with baby Bentley. ‘escape’ they had to make. We were a bit nervous on this occasion in case something happened yet again, but it didn’t, thank heavens! It’s nearly a year since the Auckland border last closed. At that time, we had to visit Waikato Hospital to see Brian’s eldest son who was seriously ill, and it involved quite a procedure obtaining the necessary permit to cross the border. Looking back, it seems incredible, and I know so many people had such sad experiences because of those borders. On our trip to visit the baby recently, we drove through Mercer and that is what brought us reminisce about some very crazy times. Anyway, back to my gardening. I have never had quite so many plants on my deck before but, other than bringing them up the stairs, it has been easy and, surprisingly, I managed to keep most of those I planted last year alive. I am now looking forward to planting salad greens and some tomatoes in pots soon enough; I hope that works out well, but I’ll be sure to let you know. That’s it from me this month, so happy gardening and be sure to make the most of every moment with loved ones because we never know what the future may bring. Reay Neben is the publisher of Rural Living CITY LASS Brian Neben wth great-grandson Bentley.

Oh, baby!

for

AS LITTLE AS 10% DEPOSIT* Quality House and Land Packages available NOW! *lending criteria applies navigationhomes.co.nz0800303207

No Payments until you move in 365-day Maintenance Period 10 Year Standard Master Build Guarantee can work with you through the entire process, from Design to Build. This could be an excellent opportunity for you to build the home of your dreams.

NAVIGATING NEW BUILDS Here at Navigation Homes Counties we are aware that building your dream home is one of the largest investments you will make. Established in Pukekohe in 2007 and now operating 11 branches around the country – Navigation Homes has helped many kiwis into their dream homes. The ability to offer quality homes with a 10 year Master Builders guarantee on only a 10% Deposit is something the team is proud of. Locally owned and operated from Karaka, Navigation Homes Counties has been in Franklin for over 15 Years and has two amazing showhomes. WE BUILD HOMES YOU’LL LOVE TO LIVE IN SHOWHOMES OPEN: Thurs Fri: 10am 3pm | Sat Sun: 11am 4pm

PAERATA RISE SHOWHOME 1 Jonah Lomu Drive, Paerata Rise AS LITTLE AS 10% DEPOSIT* Quality House and Land Packages available NOW! *lending criteria applies

Former All Black (and Papakura politician), Keven Mealamu, will contest the Franklin Ward Auckland Council seat at October’s local elections. However, Franklin Local Board Chair, Andy Baker, says he is match fit and ready to take Mr Mealamu on. “I’m born and bred here and, as a former dairy farmer, I have rural experience. If we only have urban councillors, we’ll be in trouble,” Mr Baker, says. “I’m not sure how relevant being an Auckland All Black is down here, but I take nothing for granted; I’m confident I’ve done enough [to prove] I understand and care about the area.”

WE BUILD HOMES YOU’LL LOVE TO LIVE IN SHOWHOMES OPEN: Thurs Fri: 10am 3pm | Sat Sun: 11am 4pm AS LITTLE AS 10% DEPOSIT* Quality House and Land Packages available NOW! *lending criteria applies

FRANKLIN WARD RACE: hooker v Baker See

Mr Baker has been on the Franklin board since 2010; his opponent was elected to the Papakura Local Board in 2019. The 132 Test-cap All Black says the retirement of current Franklin Ward Councillor (Bill Cashmore) motivated him to stand in the Franklin, rather than Manurewa-Papakura, Ward. He believes his prior career has provided some transferable expertise.

HUNUA VIEWS SHOWHOME 13 Kohukohunui Lane, Hunua Views navigationhomes.co.nz0800303207

HUNUA VIEWS 13 Kohukohunui Lane, Hunua Views navigationhomes.co.nz0800303207

“Although I live in a semi-rural area, [near Ardmore], not coming from a farming background will be a challenge, but I want to be a voice for everyone –country or city folk, they’re all people,” Mr Mealamu says. “I thought Bill retiring would be the perfect opportunity. We’re heading into some hard years so fresh eyes could be needed. One of the key things I bring from sport is the importance of teamwork at a high level. I can’t do everything myself, but I know what can be achieved with a good team.” www.aucklandcouncil.govt.nz details of all candidates standing in the upcoming elections.Andy Baker Keven Mealamu

HUNUA VIEWS

DY0588 www.navigationhomes.co.nz

Here at Navigation Homes Counties we are aware that building your dream home is one of the largest investments you will make. Established in Pukekohe in 2007 and now operating 11 branches around the country – Navigation Homes has helped many kiwis into their dream homes. The ability to offer quality homes with a 10 year Master Builders guarantee on only a 10% Deposit is something the team is proud of. Locally owned and operated from Karaka, Navigation Homes Counties has been in Franklin for over 15 Years and has two amazing showhomes. WE BUILD HOMES YOU’LL LOVE TO LIVE IN SHOWHOMES OPEN: Thurs Fri: 10am 3pm | Sat Sun: 11am 4pm

NAVIGATING NEW BUILDS Here at Navigation Homes Counties we are aware that building your dream home is one of the largest investments you will make. Established in Pukekohe in 2007 and now operating 11 branches around the country – Navigation Homes has helped many kiwis into their dream homes. The ability to offer quality homes with a 10 year Master Builders guarantee on only a 10% Deposit is something the team is proud of. Locally owned and operated from Karaka, Navigation Homes Counties has been in Franklin for over 15 Years and has two amazing showhomes. WE BUILD HOMES YOU’LL LOVE TO LIVE IN SHOWHOMES OPEN: Thurs Fri: 10am 3pm | Sat Sun: 11am 4pm AS LITTLE AS 10% DEPOSIT* Quality House and Land Packages available NOW!

AS LITTLE AS 10% DEPOSIT* Quality House and Land Packages available NOW! KAT7811-v5 navigationhomes.co.nz0800303207

13 Kohukohunui Lane, Hunua Views *lending criteria applies 0800 303 navigationhomes.co.nz207 PAERATA RISE SHOWHOME 1 Jonah Lomu Drive, Paerata Rise HUNUA VIEWS SHOWHOME 13 Kohukohunui Lane, Hunua Views NAVIGATING NEW BUILDS Here at Navigation Homes Counties we are aware that building your dream home is one of the largest investments you will make. Established in Pukekohe in 2007 and now operating 11 branches around the country – Navigation Homes has helped many kiwis into their dream homes. The ability to offer quality homes with a 10 year Master Builders guarantee on only a 10% Deposit is something the team is proud of. Locally owned and operated from Karaka, Navigation Homes Counties has been in Franklin for over 15 Years and has two amazing showhomes. WE BUILD HOMES YOU’LL LOVE TO LIVE

32 — Rural Living — August/September 2022 www.ruralliving.co.nz

NAVIGATING NEW BUILDS Here at Navigation Homes Counties we are aware that building your dream home is one of the largest investments you will make. Established in Pukekohe in 2007 and now operating 11 branches around the country – Navigation Homes has helped many kiwis into their dream homes. The ability to offer quality homes with a 10 year Master Builders guarantee on only a 10% Deposit is something the team is proud of. Locally owned and operated from Karaka, Navigation Homes Counties has been in Franklin for over 15 Years and has two amazing showhomes.

www.papakura.co.nz Tracy Shackleton Papakura Town Centre Manager

WELCOME: We welcomed another new business to our community recently. We're sure Crown Cutz Barbershop (Great South Rd) will become a popular spot for locals.

Gift baskets are another popular option – you can pick and choose his favourites from our local chemists or any other retailer for that matter. Alternatively (or as well), why not take him out for a special meal with brekkie, lunch or dinner at one of our many restaurants and cafes? In addition, a relaxing massage or a stylish new haircut might be just the Howeverticket.youchoose to spoil ‘dad’, you’ll find numerous ways to make his day here in Papakura.

ADVERTORIAL

AUGUST-SEPTEMBER IN PAPAKURA

Matt Hoyes

Everything a dad could want, or need, is almost certainly available from our wonderful retailers right here in Papakura.

www.ruralliving.co.nz Rural Living — August/September 2022 — 33

Tracy Shackleton shares the latest news about Papakura’s thriving business hub. Papakura Business Association PO Box 272 1783 Papakura 2244, Auckland Phone 09 298 8996

EYES

FATHER’S DAY IN PAPAKURA: There’s no need to travel far from home to find the right gifts for Father’s Day – Sunday, September 4, by the way! Everything a dad could want, or need, is almost certainly available from our wonderful retailers right here in Papakura, from sports gear, books, aftershave and clothing to new appliances and gadgets, or even gift vouchers from his favourite store.

www.papakura.co.nz.There’sno

@livepapakurapapakura.town.centre

andPapakuraImplementedthankstotheLocalBoardPapakuraBusinessAssociation(PBA).

There’s no substitute for having top cops on every block, but the latest CCTV technology is helping ensure the safety of locals throughout Papakura. “Having [the system] located and monitored at the Papakura Police station has been a major advantage for Papakura,” Inspector Matt Hoyes from Counties Manukau Police says. “Operators are vigilant and dedicated, and thorough monitoring is delivering benefits to businesses and our [wider] Featuringcommunity.”36cameras and four automatic number plate recognition devices, the network has already proved instrumental in dealing with major inquiries as well as minor incidents. It was implemented with funding from (and at the request of) the Papakura Local Board and Papakura Business Association (PBA). “I have to thank the board for joining the association and investing in it to enhance the safety and security of our town,” Tracy Shackleton from PBA adds. “Stolen cars, burglaries, shoplifting and other unacceptable behaviour has all been captured on this system which is proving an e ective tool in bringing o enders to justice. Our system is now one of the best in the country.” ON CRIME: LIGHTS, CAMERAS… LESS ACTION

PAPAKURA ONLINE: Don’t forget to check us out on Instagram (at #LivePapakura) and like us on Facebook – we have two fabulous pages: Papakura.Town.Centre and LivePapakura. These pages are all intended to keep locals up to date with events, news and more. And, for comprehensive business listings (including all necessary contact info), visit

When they are not helping address Auckland’s housing shortage, Karaka couple Karl and Erna Van Der Wat use their imagination and construction skills to create wearable art that is simply out of this world. The busy pair (briefly) laid down tools to tell ANGELA KEMP about their endeavours.latest WOW-sers,whatapair! imagination wearable Erna Van Der Wat Photo Wayne Martin

2018 entry: Le Spectacle! Karl Van Der Wat Photo Wayne Martin

www.ruralliving.co.nz Rural Living — August/September 2022 — 35 113 Great South Road, Papakura Phone 09 298 www.mareelouiseunderfashions.co.nz0999 CR0155-v3

MareeUnderfashionsLouise Medical Hosiery Maree Kay

WOW aside, Erna says her dream is to be a stylist as she thrives on giving friends and family ideas on how to style their specialMeanwhileoccasions.Karlsays he enjoys restoration of all sorts but he has a special interest in vintage cars. He’s currently working on a 1934 Ford Coupe, a 1928 Model A Ford and a 1937 Daimler limousine. But that, as we say, is another story.

“Among others, we found tiny little baby tees through to worn through grandpa t-shirt vests. We were surprised at how much we were touched and a ected by it. Covid does not discriminate between culture, gender, ethnicity or demographic borders.”Theentry is a finalist in the Open section as well as a contender for the Sustainability award, winners of which will be announced at the September WOW show. “We just love to tinker and create all sorts of things and to try di erent arts and crafts,” says Erna. “We are both ‘active relaxers’ and at our happiest when we’re creating or fixing stu . Karl is the energetic, pro-active force of the team while I try to keep everything organised, structured and together. We complement each other’s strengths and weaknesses very well.”

Specialising in: Fittings for Bras • Undergarments • Breast Prostheses •

ATM BCorsetiereQualifiedCL They’ve been entering the World of Wearable Art (WOW) for the past 16 years where they have both won and been commended in several categories. In between creating fantastical outfits, Erna and Karl Van Der Wat's ‘down to earth’ property development company has been busy building homes in southern Auckland for more than a decade. Their most recent development is a 35-apartment block in Papakura and work has now started on a 16-unit residential subdivision. However, it’s the WOW factor which makes lead designer Erna’s heart beat faster and she found a willing collaborator in Karl to turn her dreams into a reality. “I usually tell him about a crazy idea or concept and he comes up with brilliant ways to actually make it happen,” says Erna. “He calls them my NASA dreams because most of the time they are impossible to create; only NASA could pull them o . Usually, within a few minutes, I've inspired him so much with an idea that he comes up with a genius way to construct it. He never fails to impress me.” Erna entered her first garment, titled ‘In-Trigued’, into the Illumination Illusion section in 2006 and was stunned when it was named runner-up. “Once you’ve experienced the thrill of seeing a creation of your own exhibited on stage alongside the world’s best designers, you’re hooked,” she says. “After that thrill, well there was no turning back.” In 2010 the couple entered as a team and used their complementary abilities to create even more technical and elaborate entries. Their 2011 WOW Factor Award winning garment ‘Reflection’ was chosen as one of the 100 most loved garments from the WOW archives and featured in a spectacular show at the world-renowned Hong Kong Arts Festival. This year, the couple are finalists with: ‘UNRAVELLING – Been there. Done that. Got the “We’vet-shirt’.allbeen there – a ected by Covid-19; we’ve all done that – unravelled in some way and continue to experience the e ect it has on daily life. And we all 'got the t-shirt’ which is figurative speech on how we continue to figure out a way forward within this new normal,” Erna explains. “We used up-cycled t-shirts to create the garment pieces which were collected locally and from around the world. As we worked through bags of pre-loved t-shirts the reality of how and who were a ected over the past two years became very real to us.

“Seeing a creation of your own exhibited on stage garmentsalongsidebysomeoftheworld’sbestdesigners[and]you’rehooked!”

The Faulkners later gave me a knitting machine, which I used a bit, but I’ve always preferred hand knitting.”

In 1993, Jan was called in for another ‘knitathon’ at Middlemore Hospital. She surpassed her previous record and raised $1400 for laundry appliances, which allowed baby clothes to be washed in-house rather than being sent to a commercial laundry.

“When I first learnt to knit I made items for myself, but I preferred small items – I was impatient and wanted to finish pieces quickly – so I started making baby clothes to help my older sister. When I married I made layettes for friends, then for my own children and, later, grandchildren. I haven’t stopped since.” As a Waikato farmer’s wife for many years, Jan says knitting was always welcome in her rural community. She has also knitted for charities such as the former Hector Trust which supported heart research. Later, when living in Pukekohe, she set out on a knitting marathon sponsored by former Bernina shop owners, Stan and Mavis Faulkner, and promoted by untiring Plunket volunteer Audrey Copsey. “As a young mum I especially valued the support and advice from Plunket and felt they did a wonderful job without government funding. I decided I should do something to help,” Jan explains.

36 — Rural Living — August/September 2022 www.ruralliving.co.nz

RICHARDSONJAN dyed in the wool

“Audrey arranged for me to sit in the window of the former Keven’s furniture shop where I knitted for 90 hours, setting a new record in The Guinness Book of Records. All money raised went to Plunket.

Now aged 75, with 18 grandchildren plus great-grandchildren and great-greatgrandchildren, Jan is totally invested in knitting.“I’malways sad when seeing infants without warm hats, footwear or suitable winter clothing,” she says. “I used to sell baby knitwear at the Clevedon market, but the early start and long days were getting too tough. So, when my sons set me up with a small shop in the rear of their Pukekohe pet food store eight years ago, I wasRecentlydelighted!”Jan relocated to the front of the store and now opens Wednesday and Friday (10am-12pm) where the array of garment colours and patterns o er ample choice, including full baby layettes for (approx.) $20. Amazingly Jan has no interest in making a profit, instead she prices all garments just to cover the cost of wool, buttons and ribbons.

Now ensconced in her Pukekohe shop, Jan has no plans to lay down her needles. “I still love making warm, practical and beautiful garments for babies. I stock up on yarn at sales and everything I make is in an acrylic/wool mix so it's easy care. I want my work to be a ordable and to please, so I don’t think I’ll be stopping any time soon.”

Jan Richardson’s passion for knitting started nearly 70 years ago when a neighbour o ered to teach her. “She sent me to the butcher shop to pick up two meat skewers,” the Patumahoe local says. “I was about seven years old and the skewers were my first knitting needles. At the end of just one day, I was on my way and excited. Even though my mother knitted, she didn’t have the patience to teach me – I was left-handed and kept wanting to work in reverse – so I’ve been grateful to that neighbour ever since.”

There was a time when most women could, and would, knit but in today’s busy world store-bought is often cheaper or more convenient than handmade. However, not a day goes by that Jan Richardson doesn’t pick up her knitting needles, as she explained to HELEN PERRY.

Jan Richardson Photo Wayne Martin

Bedrock by Melanie is a new range of natural, vegan, cruelty-free, New Zealand made cosmetics. Enriched with skin loving vitamins and antioxidants, products are intended to be sustainable, so they're clean and green for our skin. The Bedrock by Melanie formulation o ers buildable coverage to blur out any imperfections while enhancing our skin’s natural beauty with a lasting and high-end finish.

SUSTAINABLEBEDROCKFORSKIN

SPECIALIST SURGICAL SERVICES IN: – Orthopaedics – Gynecology – Plastic surgery – General Surgery – ENT – Maxillofacial – Dental Proudly healthcaretransforminginFranklin 12 Glasgow Road, Pukekohe 2120 Email: contact@franklinhospital.co.nz Main reception: 09 220 4800 www.franklinshospital.co.nz KC15302 Franklin Hospital SUBWAYCROSBIEROADROADMANUKAUROADGLASGOW ROADJOHNSTREET The newest surgical facility in Auckland, located right in the centre of Pukekohe • Two operating theatres • A dedicated endoscopy theatre • 14 single rooms Beauty COUNTER Enjoy salon quality nails thanks to this handy Gel iQ nail polish kit. Products in the home gel starter kit (RRP $99.99) and 20 new colours (RRP $12.99 each) have been formulated for easy application, a glossier finish and easier removal. What more could you ask for in a home nail kit? These kits are available from department stores nationwide. HARD LACQUER LOCKSLUSH During cooler weather, we know our hair becomes more vulnerable to damage as the dry air strips it of its moisture. So, if your unruly locks need some TLC, American Cream (RRP from $15.90) by LUSH may be the answer. A gloss-giving conditioner made with natural ingredients, the sweet strawberry and cream scent flirts with fresh fruits, honey and lavender oil to make hair soft, shiny and easy to manage. LUSH

Medical Centre and Henderson

Natasha recommends those with lighter hair play around with a gloss to help achieve a lower maintenance copper look. This means there will be no root grow-out or ‘lines of demarcation’ (unlike when using traditional colour) and gloss will fade out gradually instead. However it’s achieved, our expert stylists will be happy find the right way to make copper work for you. you Greenlane at Waitemata Specialist

COPPER TREND: DARE TO EXPLORE!

Consulting. We welcome self-referrals and health care provider referrals. Do you have any of the following symptoms? Restless legs • Heavy, achy or tired legs • Night cramps • Leg ulcers • Poor leg wound healing • Darkening leg and calf skin • Leg discomfort after sitting or standing for a long time • Itchy legs • Spider veins • Ankle swelling • Varicose veins • Past history of DVT You may be suffering from varicose vein disease 18 August 1 September 15 September 29 27September13OctoberOctober For referrals/enquiries reception@delphiclinic.co.nzemail Phone 021 667 www.delphiclinic.co.nz701 CLINIC DATES: reception@delphiclinic.co.nz www.delphiclinic.co.nz Dr Zach Kidman MBChB; BA; RNZCGP Fellow of Australasian College of Phlebology KC15527

The copper family works better for those with natural to warmer skin tones, in which case it can be very complimentary. It’s especially flattering for people with green eyes, but these colours also work well with brown eyes for whom they bring out the amber cast.

38 — Rural Living — August/September 2022 www.ruralliving.co.nz boyce@barfoot.co.nz Trudy Boyce 021 898 483 TOP 5% . I'm always available, call me anytime to discuss further Individual Salesperson Spring is near and always a great time to sell. LOOKING FOR MORE PROPERTIES TO SELL NOW Specialising in Lifestyle & Rural Sales KC15373-v4

Natasha Harris (Alberts Hair Salon) reveals how copper is fast becoming good as gold.

For enquiries and bookings contact: Alberts Hair Salon Shop 2/23 Hall St, Pukekohe Ph: 09 238 7576 Shop online www.alberts.co.nzat: Copper is often presented as a seductive palette creating e ects such as tangerine, mango and brighter shades of red across all depths. These radiant colours of a sunset marry with the warmth of reds to intensify colour. We have seen this trend grow in popularity and acceptance among designers and consumers alike – at the recent Prada show, Kendall Jenner practically owned the catwalk thanks to her new copper tresses.

Having said that, copper may not work perfectly for absolutely everyone, but there’s still hope! For example, rather than concentrating on any specific shade, consider a blush tone, which can have a red, copper, pink, or an orange undertone. The intensity and placement of the shade are completely up to you.

have Varicose Veins? UPCOMINGCLINICPUKEKOHEDATES: Delphi Clinic has clinics in Pukekohe at Franklin Specialists Suites, Remuera at

This adaptable colour range certainly looks beautiful in auburn or with blonde highlights, but copper can be suited to just about anyone, as evidenced currently on many TikTok and Instagram feeds.

Could

kg DY0668

FROND: NEW LEAF ON LIFE Starring Manuka Honey and cumin, Frond lozenges aren’t intended to sate the palate as such, but their tasty lemon and ginger flavours do help the medicine go down. Not only formulated for sore, irritated throats, they can help sooth coughs and deliver a healthy dose of immunity boosting vitamin C. These delightful little suckers are available online or at selected chemists, health and beauty and department stores, at the RRP of $9.95, large packs and $3.95, small.

What’s the best way to reduce pests? Eat them! BurgerFuel’s Wild Heart Venison Burger has been developed to promote reducing both food waste and the number of wild deer in Fiordland National Park. In addition to its venison patty, this sumptuous sandwich also stars Pukekohe carrots, tru e mascarpone and a host of other NZ-grown ingredients. The Wild Heart is available nationwide for a limited time only.

TIRED OLD TOM’? DO KETCHUP!

From tempting tipples to tasty treats, life can be ‘fare’ enough, thanks to these new (and recent) additions to shelves.

Don’t cry, boys – even if someone’s guzzled down all the kombucha, you betcha there will be more at the shops! Not content to let a good thing go to waste, the good folk at Good Buzz have launched a new addition to their range: Boysenberry Apple. Featuring organic ingredients (including cane sugar, spring water and tea), this new brew stars the sweetness of boysenberries and tartness of crisp Kiwi apples. Available nationwide; RRP $3.69 (328ml) and $7.99 (888ml).

Turning the tables on a quintessential Kiwi favourite, the Chantal Organics team has created a top tomato ketchup that's not laden with gluten and artificial colours, flavours or preservatives. Available (RRP $6.99) from selected supermarkets and health food stores, this table-topping 'tom' is also GMOfree and comes in upside-down,free'tom'stores,569grecyclableupside-down,bottles.thistable-toppingisalsoGMO-andcomesin OATS?WILD!

Some may think ousting cows from the chocolate making process is nuts – they’re right. Rather than milk made with the help of a milk maid (or farmer anyway), Whittaker’s Oat Milk chocolate leaves them out of the equation and includes the creamy goodness of Harraways oats instead. These nutty,

HEART!DEER

PEELER’S PICK…

www.ruralliving.co.nz

All's Fare

Serves four | Prep time: 5 minutes | Cooking time: 20 minutes cornflour. courtesyRecipe of Beef + Lamb New Zealand ◆ 2 broccoli heads, cut into small pieces ◆ 3 cups spinach or silver beet, chopped roughly ◆ 150g of feta cheese cut into 1cm cubes ◆ 4 eggs ◆ 250g of cottage cheese ◆ Pinch salt & pepper ◆ 1/4 cup grated Edam cheese

Looking for quick, easy and filling recipes using fresh, seasonal produce? If so, this one could well tick all the boxes. Ideal while broccoli is in ample supply, this onedish delight is perfect as a side or main.

Serves: 4 | Preparation: 10 minutes | Cooking: 30 minutes Recipe courtesy of 5+ A Day. forwww.5aday.co.nzVisitmorenutritiousmealideas.

INGREDIENTS

BroccoliBake

METHOD Warm up with the delicious and filling flavours of this classic, hearty dish.

www.ruralliving.co.nz Rural Living — August/September 2022 — 41 PalazzoRed Shed www.redshedpalazzo.co.nz Breakfast/Lunch – licensed 16 Jesmond Rd, Karaka Ph (09) 294 6687 Email: eat@redshedpalazzo.co.nz Sunday Market Weddings - Birthday or any special occasions OPEN 5 days Wed-Sun 8.30am-4.00pm KAT6959-V14 INGREDIENTS ◆ 600g Quality Mark beef steaks, sliced into strips ◆ 30g butter ◆ 1 onion, chopped ◆ 250g button mushrooms, sliced ◆ 3/4 cup beef stock ◆ 2 tbsp tomato paste ◆ 250ml sour cream ◆ 1 tsp cornflour To serve ◆ Pasta Coat the beef strips in a little oil. Season with salt and pepper. Preheat a non-stick pan to a moderate heat. Cook the beef in three batches. Cook one side until the first sign of moisture appears on the uncooked side, then turn and cook the other side. Remove each batch and set aside. Melt butter in the pan, add the onion and cook until soft. Add the mushrooms, cook until tender Add beef stock and tomato paste, stir to combine and bring to the boil. Reduce heat and simmer for two minutes. Stir in the combined sour cream and cornflour. Stir well, simmer for one minute. Return beef to pan and simmer for two minutes. Serve with noodles or pasta, and either salad or seasonal vegetables.

Easy StroganoffBeef

METHOD Preheat oven to 200°C. Place broccoli and feta cheese into the bottom of a lightly greased baking dish. Wilt spinach or silver beet by placing in a bowl of hot water and drain. Mix into the broccoli and feta. Beat eggs and cottage cheese together, season with salt and pepper, add to the vegetables. Sprinkle cheese over the top and bake for 25-30 minutes until golden and set.

17 Pararekau Road, Karaka

A solid concrete construction home, including reinforced flooring, is spread over 600 sqm, and indicates the superb quality in all respects. Built for a large family, the configuration of bedrooms allows for a guest suite on the ground floor with an additional 4-bedrooms on the upper floor.

This handsome house offers absolute street appeal behind the long street frontage and on 3,600 sqm of freehold flat land.

Framed by a tall stone fence with two angelic cherubs protecting the double entry gates, the property unfolds into a wonderland of impeccable garden splendour and sumptuous architecture.

A

... KC15515

The master bedroom, overlooking the pool and recreational area, has the charm and proportions of a luxurious hotel suite in TheTuscany.multi-award kitchen was designed to be sympathetic to the house style with an added wow factor. The kitchen is the central hub for family gatherings and can cater to large groups with ease, whilst still being a lovely family kitchen.

42 — Rural Living — August/September 2022 www.ruralliving.co.nz Michael Boulgaris REAA Exclusive marketing agent (021) 366 Michael@boulgaris.com366 330 Parnell Road, Parnell Details front page Boulgaris.com

The grand Italian country villa has beautiful proportions and is enhanced by the central location allowing for further redevelopment of the land with commercial activity.

The bedrooms are all beautifully proportioned and the house is fully insulated with two-way heating and cooling including underfloor heating. Call for price guide and viewing options. Tuscan Country Residence always to be admired

Table an ace for ‘kings’

OUT OF EUROPE

THE HOUSE WINS! Keen to chip in for a Father’s Day gift? If so, consider a gift that keeps on giving – to the house, that is. While existing designs may ensure kings of the card table receive their dues sooner, UK-based Hewitt Design also creates bespoke tables, should we be game to make a play for something a little moreProducedspecial.using a choice of wood finishes, cloth tops and Italian leather hide edging (available in a variety of colours), these tables may turn out tops for those who are more card blunts than card sharps. Alternatively, they can simply serve as stylish decorative pieces.

www.ruralliving.co.nz Rural Living — August/September 2022 — 43 KAT7723-v8

Hewitt Design’s card tables and other pieces can be ordered via London’s Charlton Island – visit www.charltonisland.com. However, as hand-crafted furniture can’t be produced overnight (especially when then shipped from overseas!), gift plans may be better revised so we're ‘all in’ for Christmas.

WHAT HAMPTONS’ISSTYLE?

ESTATE –ORDECLINEFALL?

Interior design expert, Rachael Buxton, focuses on a style common to the world’s most fashionable houses.

Hamptons Style has been called the American version of French Empire Style and is sometimes confused for French Country, but these decorating styles di er enormously. The Hamptons’ design style feels crisp, clean, light, fresh and new. In contrast, French Country has an aged, and sometimes earthier, feel due to the incorporation of antiques, natural stone and aged timber floors; it also has a ‘creamier’ colour palette with the option of introducing a variety of subtle colour notes. There is more attention to pattern and decoration than simplicity of form As for French Empire style, this is symbolic of the Napoleonic era and has bold use of strong, rich and (often enough) dark colours with clean lines, simple forms often gilt and embellished. To view beautiful coastal properties in Hamptons’ Style closer to home, visit Omaha (northeast of Warkworth). And, if you’re keen to employ any of these styles in your home, I’ll be pleased to help. Happy Decorating! 458 Karaka Road, Karaka P: 021 264 8432 E:www.interiorsetc.co.nzinfo@interiorsetc.co.nz

There is still a strong flow of new properties – we listed 1,177 new additions – reaching the market. This is lower than is usual for this time of year but, given slow sales, it is delivering new options to buyers. In total, at month end we had 4,567 properties on our books. The rural and lifestyle sectors have not experienced the same downward pressure of sales as the residential market. In contrast, July was the fourth best trading month of 2022 in this regard, with sales exceeding $78 million.

44 — Rural Living — August/September 2022 www.ruralliving.co.nz

Darren Szaszy

There has been greater movement when it comes to the average price (at $1,122,575), which is down 5.4% on the average for the previous three months. July sales data indicates the Auckland market is gradually readjusting to a lower sales price point in a controlled manner rather than vendors reacting impulsively to slower sales.

REAL

People often refer to ‘The Hamptons’ as a design style, but what is it exactly? The Hamptons comprises of small towns along the shore of Long Island. It's the ‘go-to’ getaway seaside destination for wealthy New Yorkers with three of its zip codes in the top 10 most expensive real estate areas in the USA.

Hamptons’ Style typically refers to light, bright and sophisticated interiors with a beachy e ortlessness and calming vibe. It is inspired by the beautiful beach houses of Long Island and typically features painted or stained weatherboard exterior cladding, gable rooves, painted shutters, light neutral exteriors and interior colours of white, cream, taupe and duck egg blue.

Retail Store Open Wednesday to Sunday 10am to 4pm NK0250-v3

Having said that, the number of sales we made in July (611) is the lowest in any July over the past 22 years. At present we have prices and sales out of sequence, as vendors and buyers seek to establish where the market is priced. Prices are definitely retreating but, at the current level, they would have been regarded as excellent just 12 months ago.

By Darren Szaszy, Barfoot & Thompson, Pukekohe The number of residential properties sold in Auckland fell significantly in July, however the median sales price retreated more slowly, and prices are not falling at the same rate as declining sales numbers. In fact, the median sales price for the month (at $1.11 million) has fallen by only 2.5 per cent on the average median price over the last three months – this is still 0.8 percent ahead of the median price in July last year.

THE LATEST ON REAL ESTATE

Rachael Buxton

‘July Aucklandindicatesdatathemarket is gradually readjusting to a lower sales price point in a controlled manner rather than vendors impulsivelyreactingtoslowersales.’

Vaulted ceilings, timber floors, abundant natural light with indoor/outdoor flow, via bifold doors and expansive decks, shaker style kitchens are also common, as are floor rugs, wicker and rattan furniture, and painted wall panelling for ceilings and interior walls. Brass, bronze or silver elements (particularly with lighting and architectural hardware) are most fitting. So too are nautical themes, accents of blue, black and darker neutrals such as chocolate, gunmetal and emerald green teamed with white, lanterns and feature lighting in traditional forms – not chandeliers.

◆ Dig compost and sheep pellets into garden beds

◆ Spray lawns for prickly Onehunga weed

◆ Feed lawns with a specialised lawn fertiliser

◆ Continue to protect frost sensitive plants

◆ Feed roses and apply a layer of mulch to protect roots

www.ruralliving.co.nz Rural Living — August/September 2022 — 45 KC15374 SPRING IN THE GARDEN: WE SAY 'POTATOES'! MITRE 10 MEGA PUKEKOHE MITRE 10 MEGA PUKEKOHE

◆ Scatter slug and snail bait to protect vegetable and flower seedlings

SPRING CHECKLIST good trenchstart.roughly

◆ Plant spring veggies including: beans, beetroot, broccoli, carrots, celery, lettuce, peas, potatoes, spinach and spring onions

Although it seems too early to be thinking about Christmas, now’s the right time for gardeners to plant if they intend to have fresh potatoes for festive feasts. After all, the good old potato can be enjoyed in many di erent ways, mashed, in salads or with Sunday roasts. There are three main types of potato: early, main crop, and salad. While early crops and salad potatoes should mature within three months, main crops take six months before they’re ready. The first thing you need to decide is which variety of potato to grow. Some, such as swift and rocket, keep their shape and are good for roasting and boiling; others, including agria, are floury which makes them ideal for mashing. Cli s kidney, Jersey benne and Nadine potatoes have white, waxy flesh so this means they are excellent when used in salads and casseroles. Desiree and Ilam hardy are good all-round varieties. Be sure to purchase certified seed potatoes at least one month before planting, giving them time to sprout – to do so, place them in trays in a dry, airy spot away from direct sunlight, until sprouts are approximately 20-40mm long. Potatoes can be planted once the risk of frost has passed, and they grow best in warm, sunny positions, sheltered from strong wind. To make sure soil is fertile, add in some vegetable mix and, as potatoes are hungry plants, top up the beds with potato food to give them a good start. To prepare the soil, dig a trench roughly 45cm deep. The exact length will depend on how many seed potatoes you’re planting. Place seed potatoes in the bottom of the trench spaced approximately 45cm apart. Cover each one with a mound of soil while being careful not to damage theirContinuesprouts.mounding soil over the emerging leaves as the plants grow, gradually filling up the trench; mounding helps to ensure abundant crops. Potatoes can tolerate reasonably dry conditions, but in very dry weather they’ll need regular watering. And, be sure to feed them every 3-4 weeks with good quality potato food. Early Crops will be ready as soon as the first flowers appear, with main crops to be harvested when their foliage dies o . To harvest, use a garden fork and your hands to, gently, lift plants and potatoes out of the ground. Store your produce in a dark place such as a sack or paper bag.

◆ Apply seaweed tonic once a month

Making the decision to either renovate or sell can be a tough one, especially when the sales market is quieter.

www.ruralliving.co.nz

When planning to sell your home, usually there will be a consideration around the current market conditions, the costs to sell and the emotional attachment that is within your home. Here are some things to consider when you are weighing up the renovating vs selling debate: WHAT ARE THE COSTS AND CONDITIONS TO RENOVATE

Jo-Ann Day-Townsend 0800 TOWNSEND or 021 1696 jo-ann.day-townsend@raywhite.com056www.joanndaytownsend.co.nz

BeginsRENOVATING

BE CAUTIOUS NOT TO OVERCAPITALISE

Work out what the benefits versus the disadvantages are when it comes to renovating or selling your property. Write out a list for each option and ask all the necessary questions that you need to consider to work out which option is the best for you and your Don’tcircumstance.forgetto include factors such as the location and its convenience to your current lifestyle, including access to work and school catchments. Also consider where you would like to relocate to, the reasons for moving and any costs that would be associated with upsizing or downsizing your home. Need some advice? Then give Jo-Ann a call – she is happy to help you work out what should or should not be done and where your house sits in the current market.

Determining the scope of your renovation will assist with planning and budgeting for major improvements to your home. Are you thinking about a larger renovation, including adding levels to your home and major structural work or is it a more modest kitchen or bathroom renovation? If there are larger improvements, you may also need to factor in a need to relocate during the renovations which may mean renting for a period and storing furnishings and other personal belongings. There may be conditions around the renovation that you choose including preparing documents and negotiating with the council to be granted permission to carry out the work.

–WHICH OPTION SHOULD

CHOOSE?

Before planning to renovate, it is a good choice to have an homethroughagentyourtogaina price estimate on your property in its current condition. One mistake that can be made during the renovation is to overcapitalise on the improvements which don’t lead to a higher return on your investment and can potentially cost you more in the long run. An agent can give you an estimate of the before and advice on improvements that have the potential to add or detract from your home and the eventual sale price. This estimate may also provide you with the information to decide armed with knowledge when you are choosing to renovate or sell the property.

MAKE A LIST AND CHECK IT TWICE

KAT5307-v56

COUNTRYSIDETHE with

Southern Corridor Realty Licensed Agent REAA 2008

Te Kauwhata, Lot A-G Oakridge Rise Pokeno, 390 Razorback Road Day-TownsendJo-Ann VS SELLING YOU

www.ruralliving.co.nz Rural Living — August/September 2022 — 47 compassionwarmth, 0266 CP1136-V2 Caring for you with warmth, honesty and compassion Phone 0800 276 420 or 09 527 0266 www.arohafunerals.co.nz DY0633 Ph 0800 276 420 | 23a Tironui Rd, Takanini www.arohafunerals.co.nz Caring for you with warmth, honesty and compassion Contact Toni Charteris M: 027 537 5252 The Bespoke Living Room 128 Stan Wright Road, Karaka Open: Tue - Thu 10am - 3pm (Weekends or after hours by appointment) KC15287 Contact us to plan ahead, or for guidance and support with all funeral arrangements Call: (09) 236 8919 Tuakauwww.grahamsfunerals.co.nz|Pukekohe|Waiuku 24 hours) KAT6214 GOOD GRIEF For a goodbye to remember let Grahams take care of your family Contact us to plan ahead, or for guidance and support with all funeral arrangements Call: 09 236 8919 (24 Tuakauwww.grahamsfunerals.co.nzhours)|Pukekohe|WaiukuContactustoplanahead, or for guidance and support with all funeral arrangements Call: (09) 236 8919 Tuakauwww.grahamsfunerals.co.nz|Pukekohe|Waiuku( 24 hours) Keith, Cody & Sandie Ralph Freephone:www.ciflooring.co.nz0508CIFLOOR|05082435667 KAT6566 Family business for more than 35 years • Wholesale Direct • On the floor prices will not be beaten • Free no-obligation measure & quote • In home sample service CARPET, VINYL, TIMBER, LAMINATE PESTWALKERSCONTROL • Insects and rodents • Domestic commercialand • Consultancy work Mobile 0274 789 857 Email 2trmn8@gmail.com Main Highway, Paerata YOU NAME IT – WE’LL KILL IT! Controlling your pests since 1988 BC0190-v3 DIRECTORY KC15303-V2 WE SPECIALISE IN SMALL CORPORATE AND PRIVATE FUNCTIONS THE FRANKLIN CLUB, WHERE YOUR COMFORT IS OUR PRIORITY HIRE CONFERENCEOURROOMS CALL US TODAY ON 09 238 9465 7 East St, Pukekohe KAT5297-V2 18 Elliot St, Papakura Phone: 09 298 7767 Mon-Fri 8am-5pm; Sat 8.30am-2.30pm MP3747 FOR THE BEST ADVICE & FRIENDLY SERVICE CALL US FOR ALL YOUR SUPPLYFARMINGNEEDS PROFARM RURAL & LIFESTYLE PH 09 237 0050 40 Crosbie Rd, www.aqualectrix.co.nzPukekohe Water Pumps KAT7412 • House Pumps • Farm Pumps 0800 SUCKA1 0800 782 521 Alan Wilson Plumbing 235 9066 Certified Plumbers and Drainlayers Or: KAT5287 A fresh approach to renovations Call Kim Reiche to get your project underway 0800 004 600 KAT7007-v2 DY0311 09 294 7378 | 021 072 info@apluswater.co.nz7163 www.apluswater.co.nz Household Water Deliveries Tank Cleaning Swimming Pool Fills Commercial – Industrial – Roading Tip Truck Hire Registered Water Carrier

48 — Rural Living — August/September 2022 www.ruralliving.co.nz KAT5286-v53

Turn static files into dynamic content formats.

Create a flipbook
Rural Living - August/September 2022 by Times Media - Issuu