YourNorthernHorizonTeam
Dan PRZYBYLSKI Heather ANDERSON
Sales/ClassifiedsCirculation (250)784-4319handerson@farmmedia.com dcsales@glaciermedia.ca
Pleasedirectallaccountinginquiriestoap@farmmedia.com
THENORTHERNHORIZON (PublishedbyGlacierFarmMedia)1666DublinAve, Winnipeg,ManitobaR3H0H1
TheNorthernHorizonretainsfull,completeandsolecopyrightofanyadvertisement, writtenorphotographicmaterialpublishedintheNorthernHorizon.Reproduction isnotpermittedwithoutthewrittenpermissionoftheNorthernHorizon. AllcontributedmaterialwillbeincludedintheNorthernHorizonasspacepermits. Wereservetherighttoeditorre-writeanyaspectofcontributedcopytomakeit suitableforpublishing.
OURNEXTISSUE:FRIDAY,MAY 22ND, 2026
REGULARADDEADLINES:
Bookingdeadlineforregulardisplayads: Noonon TUESDAY,MAY 12TH,2026
Admaterialdeadline: Noonon THURSDAY,MAY 14TH,2026
CLASSIFIEDADDEADLINE:
AnysubmissionsforClassifiedAdsshouldbemadetoDanPrzybylski byphoneat(250)784-4319oremailatdcsales@glaciermedia.ca
Allclassifiedadsubmissionsmustbereceived by theNorther nHorizon by10:00a.m.(BCtime)on WEDNESDAY,MAY 13TH,2026
SUBSCRIPTIONS
SubscriptionstotheNorthernHorizonare available by contacting DanPrzybylski by phoneat(250)784-4319oremailatdcsales@glaciermedia.ca orHeatherAnderson by emailatheather@fbcpublishing.com
Theannualsubscriptionrateis $150.00 (GSTincluded) withfullpaymentdueattimeofsubscription.
Beaverlodge 4-H Club Readies for Their Achievement Day, Show & Sale May 25th
Submitted by Keaton Tarnowski, Beaverlodge 4-H Club
The month of April contains the bustle of 4H Members readying their steers for the big day on May 25th and the prepping of your BBQ parties this year to homegrown beef from the next generation of cattle raisers.
As we prepare to wrap up another year of 4H, the club has been able to get helpful info and insight in both
Judging and the Butchering process. I would like to thank both Shelby DeSmet and Alberta Select meats for giving our club knowledge that we can use both within the club and as we grow in the cattle industry.
Marketing is a key aspect that our 4H Members need to sell our steers this year and Yancy Crosier with VJV shed light on both what we as
To Canada Post, your Mailbox orSuperboxis designatedinoneof four ways -House,Apartment, FarmorBusiness.
Justheaddown to your localpostoffice andask your Postmaster to have yourMailbox/Superbox designatedasa“Farm”. Youshouldstart receiving your copy oftheHorizon withina coupleof weeks. 98907416JAN26
members need and what they as a Marketing company needs to sell and auction.
All these workshops were immensely helpful as we round the corner to our Achievement Day, which is on May 25th. The day consists of Members showing their steers for Showmanship, Conformation, and Grooming. The shows will start at 11:30 for anyone interested in watching. A complimentary supper for all who come is at 5:00, during this time interested buyers are able to walk out back and see the steers close up and talk with their young owners before the sale. The sale, at 7:00, will cap
the day off.
If you are interested in coming but do not know how the process works please contact Renee Millar (Club Leader) on 780-832-8029. Purchasing a steer is a worthwhile investment as the buyer is getting a full steer that was homegrown locally and raised with arduous work and understanding of the industry.
If you would like to host the summer BBQ and blow others away with a lip-smacking brisket then this is your chance. This is Keaton Tarnowski and my club and I hope to see you out there! NH
Cranberry LakeRodeo
June19,20,21,2026
• FridayEvening –Chuck Wagons,RanchRodeo
• Saturday –LocalRodeo/WRARodeo,Chuck Wagons,Dance
• Sunday –LocalRodeo/WRARodeo,& Chuck Wagons
00 ,D eBolt,Alber ta ,T 0H1B 0•
SUPPORTING COMMUNITIES AGAINST DROUGHT AND FLOODS
Alberta’s government will invest more than $28 million to help protect families,
Many communities face challenges keeping up with water demand, drought-proofing their infrastructure or preventing floodwaters from damaging homes and critical infrastructure. That’s why Alberta’s government is investing $25 million for 12 projects through the Drought and Flood Protection Program and $3.5 million for projects through the Watershed Resiliency and Restoration Program. With this funding, communities and other partner organizations will build projects designed to keep homes and businesses dry, roads accessible, and criti-
•Builttohangattheendofthe augerorbelt
• Weigh18pounds
•Includes20’of chainand 4stainlesshooks
•1/2”screenletsnearlyallofit throughwithbig chunks comingoffthesideofyourtruck
•BuiltinthePeaceCountry Call/TextRobat(780)740-5048
cal infrastructure operating safely during an emergency. Water supply and storage infrastructure will be expanded and watershed health will be improved so growing communities have the water they need, even during periods of drought.
“Investing in drought and flood protection keeps communities safe, while allowing them to continue to grow and thrive. This helps ensure safe and reliable access to water while making Alberta more resilient to extreme weather events.” Grant Hunter, Minister of Environment and Protected Areas
Alberta’s government is investing $125 million over five years into the Drought and Flood Protection Program. Last year, the government delivered millions to counties, towns, cities and Indigenous partners for infrastructure projects, which are now underway. In total, $75 million has now been invested in 40 projects through the program.
Highlights from this round of Drought and Flood Protection Program funding include:
• The Municipal District of Pincher Creek will make improvements to the Therriault Dam’s emergency spillway to ensure safe operation during a 100year flood. Phase 2 of the project will explore ways to use water more efficiently to increase agricultural production.
• The Town of Drumheller will purchase Tiger Dams and other flood mitigation equipment for temporary use to provide additional protection during a flood emergency.
• Water supply capacity, storage and reliability will be improved in Foothills County, the Town of Okotoks, Mountain View County, Sylvan Lake and the Municipal District of Smoky River.
• Chronic issues with drainage and overland flooding will be addressed in Sexsmith, the Municipal District of Taber and on Samson Cree Nation, Alexander First Nation and Whitefish Lake First Nation.
“Because we’re in the headwaters of the Oldman River basin, our municipality feels the impacts of both drought and flooding. Drought and Flood Protection Program funding has been important in helping us manage those risks responsibly. This year’s funding will help protect our largest reservoir during flood years and help us make plans to use our water wisely
during dry times, especially for our agricultural community.” Rick Lamire, reeve, Municipal District of Pincher Creek
“As the managing partner of the Southern Regional Storm Drainage Committee – representing eight southern Alberta municipalities alongside the St. Mary River Irrigation District – the Municipal District of Taber is sincerely grateful for these funding approvals. These investments will strengthen watershed resiliency, enhance flood protection and support long-term water security for municipal drinking water, recreation, and agri-food production across the region. Most notably, this funding will significantly advance the Southern Regional Storm Drainage Committee toward completion of the critical final construction phase of the Horsefly Regional Emergency Spillway Project.” Tamara Miyanaga, reeve, Municipal District of Taber
Grants through the Watershed Resiliency and Restoration Program will support work to restore critical wetland and riparian areas and keep Alberta’s watersheds healthy and resilient so they can better hold water during times of flooding or drought. New projects include:
• Two wetland complexes will be restored in the Municipal District of Taber as part of a larger project to manage local drainage and runoff issues.
• The Riparian Management Society (Cows and Fish) will assess riparian health at six lakes west of Edmonton, with the restoration of degraded wetlands, riparian areas, shores and floodplains in priority areas.
• Rocky View County, Alberta Conservation Association, North Saskatchewan Watershed Alliance, Starland County, Waterton Biosphere Reserve Association and Red Deer County will work with private landowners to restore streambanks and shorelines and implement best management practices at multiple sites in the North Saskatchewan, South Saskatchewan and Red Deer river basins.
• Training on restoration techniques will be provided for community members on Kapawe’no First Nation and volunteers with the Wabamun Watershed Management Council.
Quick facts
• Six municipalities, three First Nations communities and two regional service commissions will receive Drought and Flood Protection Program funding for new projects. Funds will be paid out in 2026-27.
• Program eligibility was expanded in the fall to include regional service commissions and tribal councils.
• The next round of funding applications will open in October, with $25 million available to protect businesses, families and communities.
• Five municipalities, two First Nations and five environmental non-government organizations received grants through the Watershed Resiliency and Restoration Program in 2026.
• More than 90 different organizations have received over $55 million to support more than 200 projects over the program’s history.
• The program has helped support the restoration and conservation of 5,400 hectares of wetlands as well as more than 2,300 hectares of riparian areas covering more than 320 kilometres of streambank. NH
Proudly serving the BC and Alberta Peace Region Since 1977
USASK Researching Sustainable Bison Grazing Management
A new research project led by the University of Saskatchewan (USask) is laying the groundwork for more sustainable bison husbandry through grazing management and
Matt Olson, Research Profile and Impact, University of Saskatchewan, College of Agriculture and Bioresources, www.agbio. usask.ca, Jan 22, 2026 | Dr. Trever Crowe (PhD), acting dean of USask’s College of Agriculture and Bioresources, is working with Livestock and Forage Centre of Excellence (LFCE) Director Dr. Scott Wright (PhD) and LFCE research scientist Dr. Eric van Cleef (PhD) on the project.
As van Cleef puts it, the goal of this research will be to “start from the beginning” to develop scientifically-grounded feeding, grazing, and care techniques tailored specifically for bison populations living in modern “intensive” systems – meaning grazing within fences instead of being completely free-roaming.
“The first step is to generate science-based infor-
mation on how this grazing management affects forage and animal production, animal behaviour, the environment, and soil health,” van Cleef said.
“Then we’ll have new information that could guide us to the next level, like introducing new forage species to feeding systems.”
efforts and connections built in the community, USask researchers have access to a bison herd they can work with to create robust research to support sustainable bison production.
As Wright puts it, bison are different than beef cattle, from their behaviour to their preferences in food.
This project received support from the Agriculture Development Fund (ADF), a joint provincial and federal government-funded program intended to support innovative agricultural and agri-food research throughout the province.
USask has built a unique and robust catalogue of bison research, due in large part to the genetic research conducted through the Integrated Omics for Sustainable Animal Agriculture and Environmental Stewardship (IntegrOmes) project led by USask Distinguished Professor Emeritus Dr. Gregg Adams (PhD) with the Western College of Veterinary Medicine.
Peace Countr y Se ed
Grower Direct
LUNDGARD TAPALFALFASEED
The next step for researchers is to bring knowledge of best practices for raising and feeding bison to producers that are built directly from researching bison instead of building off beef cattle techniques. Due in large part to past
multi-cut,highestyieldsandlongevityinvarietytrials YELLOWBLOSSOM(FALCATA)ALFALFASEED extremelylong-lived&highyielding,singlecut,excellentbloat-freepastures CICERMILKVETCH
Long-lived,perennial,non-bloatlegume,Vigorouscreepingroots
ALSO AVAILABLE
MULTI5301ALFALFA (multi-leaf,rapid re-growth)
MATRIXALFALFA (strongcreeping root)
MEADOWBROMEGRASS (excellent re-growth,highyielding,long-livedbunchgrass)
SMOOTHBROMEGRASS (highyielding,long-lived,creeping root)
TIMOTHY•ORCHARDGRASS•ALSIKECLOVER•REDCLOVER HAYBLENDS& PASTUREBLENDS
Callforinformationabouthayorpasture establishmentandyourforagecropseed requirements
SoilHealthServiceprovidedby Regen Eco Ag
SOILANALYSIS formineralbalancingandnutrientavailability (basedonWilliamA.Albrechtprinciples) COMPLETESOILAMENDMENT andnutrient recommendations (basedonlabanalysisandover45yearsoffielddata)
ENHANCEDSOILMICROBIOLOGY•ENHANCEDCROPHEALTH
Suppliersof MARL, ahighqualitycalciumsourcethatis
Peter780.835.1765|plundgard@telus.net
The overall aim of the project is to build a base for sustainable bison production now and into the future. Wright included five different factors to consider when pursuing sustainability: environmental, ecological, economic, social, and cultural.
Examples of environmental and ecological impacts to consider include the kinds of plants required for the bison to be able to feed and graze, and the literal impact the hooves of bison will have on the already-existing plants and soil. In addition, Wright and van Cleef both noted that as soon as bison are brought into a paddock, their social behaviour among the herd changes, which is another consideration for safe and healthy bison production.
Economic considerations come into the overall cost-effectiveness of raising bison in paddocks. van Cleef, who has a background in economics, will also explore the impact of bison on rangeland and the direct value of having bison as part of a production strategy.
Due in large part to past efforts and connections built in the community, USask researchers have access to a bison herd they can work with to create robust research to support sustainable bison production. (PHOTO: CHRISTINA WEESE)
“We’re trying to understand the impacts of moving animals to a very intensive system,” van Cleef said. “Is it economically feasible or not? How can we bring Indigenous communities and groups of producers on board and show them we can do this and be sustainable? I think that’s what’s important.”
Crowe stressed the level of importance in getting the input of Indigenous communities and listening to the cultural underpinnings of their work, noting that this project would help bridge a gap between anecdotal evidence and hard scientific evidence that could help support Indigenous knowledge and methods for bison production for today’s producers.
“It is about bison, but we’re thinking about plants, plant viability, rangeland soil viability, soil health.
It’s that relationship between the bison and their space,” said Crowe.
Candace Wasacase, the former USask director of Indigenous Engagement and the current CEO of Kahkewistahâw Economic Management Corporation, has worked with bison numerous times through her career and is deeply familiar with the importance of bison to Indigenous communities. A member of Kahkewistahâw First Nation, Wasacase said bison are not simply animals – they are family to First Nations in Saskatchewan. And research into bison care and production helps to create knowledge for the university and community alike.
“There’s a re-emergence and a renewal of the bison spirit back to our community, and I think projects like this will help the co-creation of a new knowledge base about bison, the land and all its people, First Nations and not,” she said.
Wasacase is currently working on a project that would bring a bison herd to Kahkewistahâw First Nation. She is working with numerous organizations to ensure the land they’ve secured for the bison is appropriate and sustainable for a herd and said this kind of project could help support this kind of initiative.
“This work is absolutely critical to the mission of both First Nations and the university,” Wasacase said. “Bison are a keystone species to the province and this land. They’ve had a relationship with First Nations for thousands of years, and it’s important we treat them as the relatives they are.”
The research team lauded the support of the ADF for this unique project, calling it a clear signal that the provincial government understands the importance of bison in Saskatchewan and believes in USask and the LFCE to lead this kind of work.
“To me, fundamentally, it gives industry options
and answers. It allows the livestock industry in Saskatchewan to make choices based on science,” Wright said.
The ADF is supported through the Sustainable Canadian Agriculture Partnership (S-CAP), an investment of $3.5 billion over five years from federal, provincial and territorial governments with the goal of supporting the agri-food and agri-product sectors across Canada. The Sustainable CAP includes $1 billion in federal programs and activities and a $2.5 billion commitment for programs designed by provinces and territories that is cost-shared 60 per cent by the federal government and 40 per cent by provincial/territorial governments. NH
FORAHAY MIX#1- $3.46perpound
60%RanchersAlfalfaBlend 25%SmoothBrome |5%Timothy 5% TallFescue|5%MeadowFescue 12poundsperacre
FORAHAYMIX#2- $3.68perpound
85%RanchersAlfalfaBlend |10%Timothy 5% TallFescue 10poundsperacre
HAY/PASTUREMIX- $4.25perpound
20%RanchersAlfalfaBlend |20% YellowAlfalfa 20%MeadowBrome|20%SmoothBrome 10%AlsikeClover |5%OrchardGrass |5%Timothy 10poundsperacre
HAYMIX(LOWLAND)- $4.28perpound
40%AlsikeClover|20%SmoothBrome
20%Timothy |20%ReedCanaryGrass 10poundsperacre
FORA PASTUREMIX- $3.65perpound
50%MeadowBrome |30%Rancher’sAlfalfa Blend |10% TallFescue |10%OrchardGrass 12poundsperacre
COMMUNITY PASTUREMIX$3.97perpound
30%MeadowBrome |30%SmoothBrome 10%Rancher’sAlfalfa |10% YellowAlfalfa 10%RedClover|5%CicerMilk Vetch 3%MeadowFescue |2%Timothy 12poundsperacre
Pleasebeadvisedthatallpricesaresubjecttochangewithout priornotice. We continuously reviewandadjustourpricingto provideyouwiththebestpossiblevalue.
BENEFITSOFCOVERCROPS
Reducefertilizercosts |Preventerosion |Conserve moisture |Reducetheneedforherbicides Improveyieldsbybuildingsoilhealth
PEACECOUNTRYTOTALMIX$55peracre
20%ForageOats,14%Barley,15%Forage Triticale, 20%ForagePeas,6%Hairy Vetch,4%FabaBeans, 3%RedProsoMillet,4%ItalianRyegrass,2% Sunflower,2%Flax,3%Sudangrass,2%Daikon Radish,1%Purple TopTurnip,1%7-Top Turnip,2% CrimsonClover, 1%BerseemClover 65lb.seedingrate |Availableintotesor50lbbags. PEACECOUNTRYSILAGEMIX$42peracre
45%ForageOats,15%Barley,19%Forage Triticale, 11%ForagePeas,4%Hairy Vetch,5%FabaBeans, 1%7-Top Turnip 90lb.seedingrate |Availablein TotesorBulk Tofollowupwithgrazing,add3lbsCrimsonClover & 4lbsItalianRyegrassat15$peracre
We arecommittedtohelpingfarmers &rancherstouse regenerativefarmingpracticesinordertodiversifyfarmland ecosystemswhileenhancingefficiencyandprofitability.Wecan custommixmostanycovercropmixthatyouwouldlike,at competitivepricing.
USask has built a unique and robust catalogue of bison research, due in large part to the genetic research conducted through the Integrated Omics for Sustainable Animal Agriculture and Environmental Stewardship (IntegrOmes) project led by USask Distinguished Professor Emeritus Dr. Gregg Adams (PhD) with the Western College of Veterinary Medicine.
(PHOTO: CHRISTINA WEESE)
Alberta Canola Producers Commission(http://dashboard.albertacanola.com/reports/weekly-grains)
ACHIEVEMENT DAY IN YOURAREA
Monday,May11,2026
DrysdaleCenter,Foster’sPavilion, EvergreenPark,GrandePrairie,AB
Bezanson4-HMultiClub,KleskunMulti4-HClub
Show: 9:30a.m.•Supper:5:30p.m.•Sale:7:00p.m.
Friday,June5andSaturday,June6,2026
GrandePrairie4-HMultiClub
LewisHawkesArena&DrysdaleArena, Foster’sPavilion,EvergreenPark,GrandePrairie,AB
OnOffer: 38MarketSteers
Contact: Jeff Warkentin(780)832-7426| TaraBullen780-832-1556
Saturday,May23&Sunday,May24,2026
DCCRidgevalley4-HMultiClubShow&Sale
CranberryLakeRodeoGrounds,DeBolt,AB
OnOffer: MarketSteers,MarketSheep,Chickens FridayShow&Sale: Friday,June5•Show:10:00a.m.•Sale:7:00p.m. Saturday: Archery,BenchShow&Equine
Contact: JulieBudgell(780)380-5958
Saturday,June6&Sunday,June7,2026
OnOffer: 24MarketSteers,10MarketLambs,4MarketSheep
SaturdayShow: 12Noon
SundayShow: 12Noon•Buyer’sSupper:6:00p.m.•Sale:7:00p.m.
Contact: ChelsieDillabough(780)402-9578
Monday,May25,2026
Beaverlodge4-HBeefClubAchievementDay
EdBrown&EdHotteAgComplex,Beaverlodge,AB
Show: 11:30a.m.•Supper:5:30p.m.•Sale:7:00p.m.
Contact: ReneeMiller(780)832-8029|AndreaConrad(780)518-5706
beaverlodgebeef4h@4hab.com
Sunday,May31,2026
CoyoteAcres4-HAchievementDayShow&Sale
HighPrairieAgriplex
Show: 1:00p.m.,SupperandSaletofollow
OnOffer: MarketSteers,MarketLambsandPoultry
Contact: LeighBlackhurst780-536-6735
Monday,June1,2026
Montagneuse4-HMultiClubAchievementDayShow&Sale
DaveShawMemorialArena,HinesCreek,AB
Montagneuse4-HMultiClub
Show: 10:00a.m.•Buyer’sSupper:5:30p.m.•Sale:7:00p.m.
OnOffer: MarketSteersandMarketSwine
SaddleChamps4-HClub& YoungHearts&StrongHooves4-HClub AchievementDays SunsetPrairieRecreationGrounds,SunsetPrairie,BC SaddleChamps4-HClub& YoungHearts&StrongHooves4-HClub Beef,LeatherCraftsandCloverbud ShowStartsat10:00a.m.BothDays SaddleChampsContact: AmandaStafford250-262-9624
YoungHeartsBeefContact: Beef– TalonGauthier250-219-3944
YoungHeartsLeathercraft/CloverbudsContact:Jenn Teuling250-219-9217
Monday,June8,2026
AnnualAchievementDay,Show&Sale PioneerMuseum,LacCardinalGrounds,Grimshaw,AB Berwyn4-HMultiCoveralls&Dixonville4-HMultiClub OnOffer: MarketSteers,MarketLambs,Chickens Show: 2:00p.m.•Sale7:00p.m.
Contact: PaulFranz(780)618-5983orAlisonGreenwald(780)360-3694
Monday,June8,2026
EastPeaceInterclubAchievementDay,Show&Sale SprucePointParkMulti-Plex,HighPrairie,AB KinusoLakeside4-HMultiClub&MirrorLanding4-HMulti-Club OnOffer: MarketSteers,MarketLambs&Hens Show: 10:00a.m.•Sale7:00p.m.
Contact: LyndsayFleming(780)821-2596
Monday,June8,2026
Contact: BobbiJoRowe(780)772-1424
Monday,June1,2026
ThreeRivers4HClubAchievementDay&Sale
BattleRiverAgGrounds,Manning,AB
ThreeRivers4HBeefClub-Manning
OnShow: MarketSteers,EquineandCleavers
Lakeview4-HMulti-ClubAchievementDay,Show&Sale TireProEventsCentre, TeepeeCreek,AB
OnOffer: 14MarketSteers,3MarketLambs,4CleaverLambs,6Pensof3 ButcherChickenProjects Archery: 11:00a.m.•Show:1:00p.m.•Buyer’sSupper6:00p.m. •Sale7:00p.m.
Show: 1:00p.m.•Sale:7:00p.m.
Contact: ChrisGraw(780)836-0888
Monday,June1,2026
Valleyview&District4-HBeefAchievementDay
HollingsworthArena, Valleyview,AB
Wildrose4-HMultiClub,PrairieRose4-HMultiClub
Show: 12:00Noon•Sale:7:00p.m.
Contact: JenniferDavis(780)524-9643orjenncowgirl@hotmail.com
Wednesday,June3,2026
Savannah/East West/EagleshamShow&Sale
Savanna4-HMulti-Club,East/West Woking4-HClub,Eaglesham4-HBeefClub
SavannaRec-Plex,Savanna,AB
Contact:JeffBinks780-228-3975
Saturday,July4,2026
Groundbirch4-HMulti-Club11thAnnualAchievementDay DawsonCreekExhibitionAssociationBeefBarn,DawsonCreek,BC Beef,Sheep,SmallEngines,LeatherCrafts,Foods,Cloverbuds Show: 10:00a.m.• Supper: 5:00p.m.•Sale:6:00p.m.
Contact: ChantelOdden250-219-1823
OnOffer: 27Steers
Show: 1:00p.m.•KingoftheRing:6:45p.m.•Sale:7:00p.m.
ShowContact: TerriFitzpatrick780-864-5466|SusieJack780-499-9699
ShowContact: AdamFitzpatrick780-864-1235|JaceEarl780-864-5827
Friday,July3,Saturday,July4&Sunday,July5,2026 NorthPeaceDistrict4-HAchievementDays NorthPeaceRegionalPark,RosePrairie,BC Green Valley4-HClub,Lakeshore4-HClub,PrespatouCommunity4-HClub, SilverWillow4-HClub, Wonowon4-HClub Beef,Dairy,Sheep,Swine,Dogs,Alpacas,SmallEngines
OnOffer: 58MarketSteers,26MarketLambs,17MarketHogs ShowFri: 5:00p.m.|Sat&Sun:9:00a.m. •Sale(Sun):4:00p.m.
Contact: AngelaBriltzab.4hswine@gmail.com
Oops,didwemakeamistake?Orworse,wasyourclubleftoffthelist? CallDantodaytogetintothenextissueoftheNorthernHorizon.(cell)250.784.4319•(email)dcsales@glaciermedia.ca
Judith “Judy” Elizabeth Van Den Bosch
December 20, 1956 –January 11, 2026
Judy Van Den Bosch, 69, beloved wife of Tony Van Den Bosch, passed away on January 11, 2026 in Vernon, BC surrounded by her family.
Born December 20, 1956, Judy’s life was a testament of faith, love, laughter and dedication to her family.
She leaves behind her husband Tony, son Marty (Aranza), granddaughters Brooklynn and Charlie, sisters Shirley (Henry) Reddekopp and Susie (Ben) Braun, and many nieces and nephews. Predeceased by her parents Henry and Elizabeth Wiebe.
Judy loved to travel whether it was cruising, travelling by motorhome, or just camping with family and friends.
She was the backbone in their business and Tony says they won’t be where they are today without her.
Tony had a nickname for her “Suiker Plumetje” Dutch translation is Sugar Plum.
There will be a memorial at the Grandview Chapel (900-94th Avenue) in Dawson Creek, B.C. at 1:00 p.m. on Saturday, June 6th, 2026.
Some Important Points to Remember When Using Vaccines
This article is a part of the article “Vaccination of the Beef Herd” published by the Beef Cattle Research Council on their website beefresearch.ca, and is reprinted with permission of the publisher.
1. Read the label! The dose, withdrawal times, expiration date, timing, route of administration and safety information are all there.
2. Don’t combine vaccines! Mixing various vaccines together in one syringe can inactivate both vaccines. Multiple vaccinations should be spaced apart in separate locations. Follow the label directions.
3. Mix enough vaccine for only one hour or less. Keep the vaccine away from extreme heat or cold.
4. Get the air out of your automatic syringe. Trapped air can dramatically affect the amount of vaccine you are actually administering.
5. Keep your equipment clean. Use hot water only for cleaning automatic syringes. Soaps and disinfectants can leave a residue that destroys modified live vaccines.
6. Use an appropriate sized needle for the job. For cattle >500 lbs, usually an 18-16-gauge needle
that is ½” – ¾” long for subcutaneous injections and 1” – 1 ½” long for intramuscular injections.
7. Change needles frequently (at least every 10-15 animals) and give all injections in the neck area. Don’t contaminate your vaccine bottle by utilizing a used dirty needle when you load your syringe. Only sterile needles should be used in the vaccine bottle.
8. Keep detailed records. Keep track of what vaccines you use including exact product name and serial and lot numbers. Records should include the data and clear descriptions of the group of animals vaccinated as well as the route of administration. NH
ANGUS Cattle Directory
Broken Stick Ranch
Black Angus for Sale off the Farm Tom & Amber Ditner, Baldonnel, BC 250-794-7105
Excel Ranches
Ron & Barb Miller, Westlock, AB Cody & Amy Miller, Westlock, AB 780-349-0644
Fourth Creek Angus Ranch
Ryan Lacey & Lucie Coche, Spirit River, AB Ryan 780-864-7753 Lucie 780-517-3507
GRA-TAN Farm
Grant & Tanya Chittick, Mayerthorpe, AB 780-284-0684
Crystal Chittick, Mayerthorpe, AB 780-204-2005
GRA-TAN Farm
Grant & Tanya Chittick, Mayerthorpe, AB 780-284-0684
Crystal Chittick, Mayerthorpe, AB 780-204-2005
Harvest Angus
Tom & Carolyn Dewaal, Prince George, BC 250-960-0022 | 250-562-5200
Heart Valley Angus
Nat Tschetter & Chris Tschetter Wanham, AB 780-978-6407 / 780-978-6406
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Kjos Black Angus
Marty & Miriam Kjos, Fort St. John, B.C. 250-787-0970
Kleskun Lake Farm
Brady Fraser, Sexsmith, AB 780-505-1734
Lakeroad Black Angus
Jim & Donna Rowe, Worsley, AB Jim 780-835-0455 | Donna 780-835-9588
Lazy B Livestock
Trevor Binks & Melanie Klassen Grande Prairie, AB Trevor 780-518-0630 Melanie 780-518-0230
Lazy S Ranch
Stewart Ainsworth, Mayerthorpe, AB 780-785-3136 or 780-786-4150
M.C. Quantock
Mac & Pat Creech, Lloydminster, AB 800-561-2855
Northway Cattle Co.
Hwy 64 & RR 94.5, Cleardale, AB Albert 780-834-7055 Peter 780-835-8291
RR Forty Angus
Danny Waluk/Lorinda Wold, Clairmont, AB (D) 780-296-3460 (L) 780-402-1445
Silent K Stock Farms
Delano & Megan Kjos, Tomslake BC D 250-467-9450 / M 403-804-1107
Sorensen Cattle Co.
Murray & Nicole Sorensen Teepee Creek, AB Murray 780-831-6332 Nicole 780-832-1189
Towaw Cattle Co.
Kirk & Jill Wildman, Sangudo, AB 780-305-1661 | 780-305-1146
Dave & Gail Wildman, Sangudo, AB 780-305-1145
Willow Creek Simmentals
Mike & Mari Klassen, Crooked Creek, AB Colby&Tiffany Klassen,Crooked Creek, AB Mike 780-832-7343 Colby 780-832-6714
Pinnacle View Limousin
Rob & Cheryl Swaan, Quesnel, BC
Erin & Eric Kishkan, Quesnel, BC Erin 250-991-6654
Rosebud Creek Charolais
Dan & Holly Schleppe, Dawson Creek, BC 250-786-5698/250-219-5698
Schweitzer Ranch
Troy & Kristina Schweitzer Dawson Creek, BC Troy 780-814-3598 | Kristina 250-219-4429
CHAROLAIS GELBVEIHS
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
CELL:(780)402-5617
HOME:(780)356-3611
RaisingQualityCharolaisCattletomeet theneedsofthe Commercial Industry!
8WAY CHAROLAIS
Nikki,Kristin,Whitney& CourtneyDrschiwiski Box18,CecilLake,BCV0C1G0 Ph:250-785 -6362 Cell:250-261-0876(Nikki) Cell:250-329-4816(Courtney eightway@pris.ca wanderlust_blues@yahoo.ca )
Blondie Cattle Co.
Montana Fogle, High Prairie, AB 780-402-4009
Dry Creek Ranch
Seth Harmon, Cecil Lake, BC 250-793-1858
Evans Cattle Company
Glyn & Stephanie Evans, Doe River, BC 250-467-2275
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
JayDawn Farms
Jason & Nikki McQuaig, Sexsmith, AB 780-933-5530
KSL Simmentals
Keegan Scorgie & Brad Smith Beaverlodge, AB Keegan 780-518-6572 | Brad 587-202-0254
Landaker Charolais Farm
Alan & Shirley Landaker, Brownvale, AB 780-618-3928
Chittick Farms
Raymond & Mona Chittick Mayerthorpe, AB 780-305-3925
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Jonomn Hereford Ranch
Norm & Joanne Parrent, Clyde, AB 780-307-6586 | 780-348-5835 Mike Grimmeyer, Clyde, AB 780-307-3385
M.C. Quantock
Mac & Pat Creech, lloydminster, AB 800-561-2855
Rachido Ranch
Randy & Donna Chittick, Mayerthorpe, AB 780-674-1986
Reber's Polled Herefords
Serena & Kasey Reber, Woking, AB 780-518-2643
Whiskey Jack Black Herefords & Simmentals
Tamara & Darcy Kuriga, Whitelaw, AB 780-834-7108
Dry Creek Ranch
Gordon & Carla Harmon, Cecil Lake, BC 250-793-2384
Excel Ranches
Ron & Barb Miller, Westlock, AB
Cody & Amy Miller, Westlock, AB 780-349-0644
Hillview Farms
Sturgeon County, AB
Raymond & Corine Verbeek 780-982-2176 | 780-939-2173
Colin & Tessa Verbeek Colin 780-982-1676 | Tessa 403-636-1066 Pinnacle View Limousin
Rob & Cheryl Swaan, Quesnel, BC
Erin & Eric Kishkan, Quesnel, BC Erin 250-991-6654
Albrecht Farms
Steve & Tammy Albrecht, Sprit River, AB 780-832-0883
Ryan & Tara Albrecht, Spirit River, AB 780-933-5448
Blazin" J Simmentals
Darcy & Caitlyn Lind, Sunset House, AB D 780-536-5203 / C 780-552-4934
Blondie Cattle Co.
Montana Fogle, High Prairie, AB 780-402-4009
Clarkson Valley Simmentals
Kyle & Ashley Klassen, Crooked Creek, AB 780-933-8605
Clearwater Simmentals
Chad Smith, Olds, AB 403-586-4714
Crystal Springs Ranch
Eckbert & Crystal Weitzel
Georg & Sarah Weitzel
Charlie Lake, BC 250-263-8237
D.A.M. Livestock Ltd.
David Michalchuk, Keg River, AB 780-987-0938
GB Farms
Garrett Biggelaar, Lacombe, AB 403-877-7661
Harvest Angus
Tom & Carolyn Dewaal, Prince George, BC 250-960-0022 | 250-562-5200
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
KIN-KIN Cattle Co.
Gary & Faye Chittick, Mayerthorpe, AB 780-786-4500
KMR Simmentals
Kent & Robin Malcomson, Grovedale, AB 587-298-5404
Kruger Farms
Ryan & Chelsea Kruger, Sundre, AB 403-586-0125
KSL Simmentals
Keegan Scorgie & Brad Smith Beaverlodge, AB Keegan 780-518-6572 | Brad 587-202-0254
Lazy S Ranch
Stewart Ainsworth, Mayerthorpe, AB 780-785-3136 or 780-786-4150
M.C. Quantock
Mac & Pat Creech, Lloydminster, AB 800-561-2855
M J Simmentals
Joe & Marianne Gingles, Beaverlodge, AB Joe 780-354-8842 | Cell 780-814-2567
Montagneouse Creek Simmentals
Herman & Mark Giesbrecht, Worsley, AB 780-772-0488
Polar Farms
Joe, Lindsey, Riley & Kendal Loomis Peace River Regional District, BC 250-784-5150
Rachido Ranch
Randy & Donna Chittick, Mayerthorpe, AB 780-674-1986
Rosefield Simmentals
James & Martha Wiebe, Prespatou, BC 250-630-2621
Short Grass Farms
Kurtis & Chelsie Dillabough, DeBolt, AB 780-402-9578
Sorenson Cattle Co.
Murray & Nicole Sorenson Teepee Creek, AB Murray 780-831-6332 Nicole 780-832-1189
Southpaw Cattle Company
Ron & Tammy Daley, Carstairs, AB
Brandon & Shallaine Sharpe, Carstairs, AB 403-519-3401
Swantewitt & Sage Simmentals
Yellowhead County, AB Gerd 780-712-2096 Jordan 780-712-3600
Tri K Cattle
Beaverlodge, AB
Keiran Hodges 780-933-5637 Keith Hodges 780-831-7999
Whiskey Jack Black Herefords & Simmentals
Tamara & Darcy Kuriga, Whitelaw, AB 780-834-7108
Willowdale Simmentals
Dale & Judy Smith and Family Valleyview, AB
Dale 780-558-9337 | Kent 780-721-1109
Wolfe Farms
Tony Wolfe, Valleyview, AB 780-524-9322
Wolfe Lake Farms Inc.
Olin Rosvold, La Glace, AB 780-518-1997
Wolfes Fleckvieh
Shane & Shannon Wolfe, Sundre, AB 403-556-0729
FlexiblePayment Optionsfor New OilerPurchases
Interest Free. Hassle Free. Designed forYour Operation. Investinginherd health andlice/ fly control shouldn’t require complicatedfinancing.Allnew oiler purchases qualifyfor our flexible, interestfreepayment plan—with nocreditapplication, no banks, and upto 18months tocomplete your payments.
Product Options
8.5Gallon Upright Single Oiler
Recommended for:
Herds of100 cowsor fewer
Startingat: $2,700
MonthlyPayments: From$150/ monthforupto 18months
Drapeand mineralfeederavailable atadditionalcost.
15 Gallon UprightDouble Oiler
Recommended for: Herds of100+cows
Startingat: $4,200
MonthlyPayments: From$233/ monthforupto 18months
Drapeand mineralfeederavailable atadditionalcost.
Multi UnitDiscounts
Operations purchasing multiple unitsinasingleorder are eligible for additional discounts, making it easierand more costeffective to outfitlarger herds ormultiple winter feeding areas and summer pastures. AdditionalInformation
•GSTapplies to all purchases.
• Payment plans are available on allnewoilers
• Designed to supportproducers withreliable,longtermherdprotection. Formoreinformationplease contact Steve Major 780-524-8880
VJV LIVESTOCK MARKETING GROUP
DAWSON CREEK BEAVERLODGEWESTLOCKPONOKA
TUESDAYS WEEKLY Office(250)782-3766 Fax:(250)782-6622 dawson@vjvauction.com
THURSDAYS WEEKLY Office(780)354-2423 Fax(780)354-2420 beaverlodge@vjvauction.com
THURSDAYS WEEKLY Office(780)349-3153 Fax(780)349-5466 westlock@vjvauction.com
WEDNESDAYS WEEKLY Office(403)783-5561 Fax(403)783-4120 office@vjvauction.com
Auction Date Apr28-403HdApr21-260HdApr14-1,104HdApril30-105HdApr23-NOSALEApr30-384HdApr23-364HdApr29-1,133HdApr22-2,488Hd BidRangeLowHighLowHighLowHighLowHighLowHighLowHighLowHighLowHighLowHigh 300-399$710.00$745.00$730.00$770.00$770.00$860.00$700.00$760.00n/an/an/an/an/an/a$675.00$1,025$800.00$860.00 400-499$700.00$800.00$720.00$800.00$740.00$845.00$710.00$800.00$710.00$800.00$650.00$777.00$720.00$805.00$675.00$791.00$760.00$855.00 500-599$660.00$737.00$650.00$707.00$670.00$772.00$650.00$725.00$660.00$710.00$640.00$725.00$645.00$725.00$645.00$748.00$620.00$747.50
600-699$590.00$649.00$600.00$649.00$580.00$659.00$595.00$645.00$558.00$652.00$550.00$625.00$550.00$620.00$540.00$653.00$550.00$630.00
700-799$530.00$591.00$540.00$595.00$540.00$600.00$540.00$595.00$530.00$581.00$535.00$600.00$490.00$565.00$525.00$625.00$525.00$597.00
800-899$480.00$532.00$485.00$529.00$480.00$535.00$490.00$535.00$485.00$529.00$465.00$533.00$448.00$515.00$475.00$539.00$460.00$532.00 900-999$460.00$475.00$460.00$475.00$450.00$472.00$440.00$485.00$470.00$485.00$434.00$468.00$389.00$450.00$440.00$478.00$455.00$482.50
600-699$570.00$607.00$555.00$607.00$550.00$627.00$550.00$610.00$530.00$575.00$495.00$581.00$510.00$599.00$490.00$580.00$530.00$612.00
700-799$485.00$557.00$485.00$552.00$490.00$575.00$482.00$555.00$480.00$527.00$475.00$533.00$470.00$524.00$475.00$540.00$475.00$540.00
800-899$440.00$465.00$440.00$472.00$440.00$489.00$440.00$469.00$440.00$465.00$470.00$500.00$424.00$512.00$445.00$510.00$425.00$483.00
900-999$425.00$447.00$400.00$435.00$415.00$445.00$420.00$446.00$415.00$432.00$380.00$425.00$408.00$445.00$420.00$443.00$400.00$446.50
1000+$400.00$422.00$360.00$375.00$340.00$415.00$395.00$419.00$400.00$418.00$370.00$415.00n/an/a$400.00$421.00$375.00$415.00
D1-D2CowsD1-D2CowsD1-D2CowsD1-D2CowsD1-D2CowsD1-D2CowsD1-D2CowsD1-D2CowsD1-D2Cows
$235.00$257.00$238.00$254.00$232.00$264.00$232.00$261.00$235.00$252.00$238.00$258.00$240.00$262.00$240.00$265.00$245.00$260.00
D3-D4CowsD3-D4CowsD3-D4CowsD3-D4CowsD3-D4CowsD3-D4CowsD3-D4CowsD3-D4CowsD3-D4Cows
$190.00$235.00$190.00$232.00$190.00$235.00$170.00$231.00$210.00$237.00$220.00$237.00$220.00$239.00$220.00$239.00$225.00$244.00 HeiferettesHeiferettesHeiferettesHeiferettesHeiferettesHeiferettesHeiferettesHeiferettesHeiferettes
$320.00$402.00$300.00$391.00$310.00$369.00$300.00$401.00$300.00$405.00$265.00$390.00$250.00$360.00$270.00$380.00$280.00$390.00 BolognaBullsBolognaBullsBolognaBullsBolognaBullsBolognaBullsBolognaBullsBolognaBullsBolognaBullsBolognaBulls
$235.00$259.00$230.00$253.00$240.00$260.00$240.00$249.00$230.00$247.00$240.00$269.00$235.00$282.00$260.00$285.00$240.00$280.00 FeederBullsFeederBullsFeederBullsFeederBullsFeederBullsFeederBullsFeederBullsFeederBullsFeederBulls
$260.00$320.00$260.00$322.00$270.00$325.00$270.00$305.00$250.00$295.00$250.00$350.00$250.00$360.00$275.00$360.00$280.00$350.00
WEEKEND Apr25/26(prel) Apr18/26(prel) Apr26/25
51,35056,12752,739 EAST 11,75710,65511,373
39,59345,47241,366 WEEKEND May02/26 (est) Apr25/26 (est)May03/25 US 524,000518,000556,000 CANADIAN CATTLEGRADES WEEKEND Apr25/26 Apr18/26 Apr26/25 A 39,34443,66641,218 B 338 380410 D 4,5644,8935,811
233 187204
Apr25/26(prel) Apr18/26(prel) Apr26/25
27,91430,01226,159
15,84118,36619,102
DATE Tues,Apr28,2026 Tues,Apr21,2026 No. 705 Head2,170 Head FEEDERSTEERS
600-699
700-799
800-899
$600.00$685.00$600.00$699.00
$510.00$600.00$525.00$615.00
$450.00$530.00$490.00$528.00
900-999 $400.00$490.00$400.00$490.00
1,000+ N/AN/AN/AN/A FEEDERHEIFERS
BID LOWHIGH LOWHIGH
300-399 $675.00$800.00$700.00$800.00
400-499 $600.00$770.00$625.00$760.00
500-599 $575.00$700.00$600.00$700.00
600-699 $515.00$625.00$500.00$602.00
700-799 $480.00$555.00$450.00$540.00
800-899 $400.00$490.00$400.00$489.00
900-999 $375.00$440.00$385.00$467.00
$230.00$265.00$235.00$270.00 D3 COWS D3 COWS
$190.00$225.00$200.00$229.00
SLAUGHTERBULLSSLAUGHTERBULLS
$240.00$292.00$220.00$290.00 REPLACEMENT CATTLE FEEDER COWSFEEDER COWS
$240.00$280.00$250.00$285.00
REG–
REG– Mon,May25th- 9:00a.m.
REG– Mon,June1st- 10:00a.m.
REG– Mon,June8th- 10:00a.m.
REG– Mon,June15th -10:00a.m.
REG– Mon,June22nd -10:00a.m.
REG– Mon,June29th –NOSALE
REG– Mon,July6th- 10:00a.m.
REG –Mon,July13th- 10:00a.m.
REG– Mon,July20th -10:00a.m.
REG– Mon,July27th -10:00a.m.
JenningsMartinCattleBuyingwillbethereforyouandyouroperation asyouprepareforyour2026springandsummermarketing.Andwhilenotwo yearsseem to bethesame, Iremaincommittedtocontinueoffering fairprices whileproviding astress-freeenvironmentforbothyouandyourcattle. Our facilit yinLaGlacecontinues to remainopen,buyingallclassesofbulls, cows, steersandheifers,savingyoutheneed forshipping to localorsouthernmarkets.
780-864-3731Spirit RiverAL864-0236 Warren864.0217 or Jay780.978.0188
Website: www.rossequip.ca
70ftMorrisQuantumAirDrill12”spacing4”pair row5”semi-pneupackers.Blockagemonitorseach runseed&fert.Mudscrapers.9800ICTMorrisTank 7sections,4Tanks800 bu TowBehindCart.2Fans, Seedfan&fertfanStainlesssteeltubingandmanifolds.800/70R38dualsrearsinglefront,12”loading conveyorwithremotecontrol.Stainlesssteelmeteringsystem.OPERATING Ran with a top conx35 has extraMasterswitches.Blockagemonitorsystemis intelligentAg,ran withiPadBlow-Out $320,000 CALL780.864.8582For70’AirDrillor535Tractor
2024620 4wd Versatile 665hp@ 1900rpm,16x4Cat P/S tran, rev-fan towcable900/60 R42110gpmpump6E hyd 3/4”returndiff lock PTOsusp DelCabIsobusRadar,Jake Brake,19Led lites, V6700A/S/R Rearcamera,#8R2689 wt59,800 SN708852 $995,000Blow-OutPrice $ 850,000
QSX15LCummins,850x60Rdualtires80gpmhyd, 6Ehydremotesdifflock,DeluxeCab,radar,Frtwts 2911hrsBlowOut $295,000call 780.864.8582
2014580 QT CASEP/Stran,30”TracksTowcable Only2538hrs,TwinFlowhydpumps98gpm6hyd outletspower beyond,returncoupler,B/Tradio leatherseat,DeluxesuspCab.Difflock,Pro700 CaseMonitorwithworkingTrimbleGPS, TractoisfullyservicedandreadyforSpring 2014580QT$395,000BLOWOUT$335,000
XP11$28,000 2016D2500 Laramie MegaCab 6.4h V8 8s 4x4 SB210K leatherbktseats,radioNavsunroofHDRadHDshocks
TheDF22’sare98%assembled&Tested inSpiritRiverthenTRUCKED FREEofchg tocustomersin AB,SK,MB.Thecustomer suppliesa Picker to spotthe drier onhis pad, andafter theelectrical& gashookup iscompletedby theCustomerwesupplyatech to Commissionthedrier&instructtheCustomer onhowtorunit.A 12”bedofBarley @ 100ºC chain 850rpm= 37.5mtphx 45.9=1720buhr 2026DF22$395,000BLOWOUT $340,000
Equine Reproduction
Horses are seasonal breeding animals. This means they have their estrous cycles during the summer months and during the winter months they are in anestrous, or not cycling. They go through 2 transition periods; one during April/May when they are coming into estrous and one in September/October when they are going into anestrous. During these transition periods, a mare may show signs of estrus, or heat, but not have any ovulation therefore will not get pregnant despite breeding. Some horses will naturally continue to cycle all year round but this is not very common. Once a mare is cycling, her estrous cycle is 21 days long. This consist of a period of estrus which varies between 2 and 8 days. During this period the mare will be receptive to a stallion. Signs of heat commonly are standing for a stallion, frequent urination, winking of the vulva, and lifting the tail. These signs may be masked when a mare has a foal at side as she is trying to protect her baby. This is followed by a period of diestrus, where the mare will not be receptive to a stallion.
A mare’s reproductive cycle can be manipulated to facilitate breeding. This can be useful in synchronizing mares for embryo transfer or better time breed-
ing for when semen is available. A mare can be “short cycled” during the diestrus phase using a prostaglandin. This breaks down the corpus luteum (CL) which allows for a new follicle to mature and eventually ovulate. The timing from short cycling a mare to ovulation can be quite variable. They will commonly come into estrus within 3-10 days and then ovulate 2-8 days later. Close monitoring of behavioural signs of estrus and/or reproductive ultrasounds are recommended to track the size of the follicle to ensure ovulation is not missed. When using a prostaglandin, you can see adverse effects, such as increased heart and respiratory rates, sweating, muscle cramping, colic, stumbling, and weakness. These signs usually occur within 15 minutes of administration and will often resolve on their own within an hour. An estrus period can also be delayed with the use of a synthetic progestin, which suppresses estrus. Once the progesterone is removed, estrus should be seen within 4 to 5 days an ovulation within 2-8 days.
It can also be very beneficial to manipulate the timing of ovulation when breeding with fresh cooled or frozen semen as it can minimize the number of reproductive ultrasounds required to time the breeding correctly. The follicle must be at least 35 mm for these medications to be effective at triggering ovulation which is generally within 36 to 48 hours.
Sub-fertilebulls become aneconomicliability to your cattleoperation by •creating reduced pregnancies
• areductioninthe numberof potential calves •inconsistenc yintheageof calves •lighter weaning weightsand,ultimately •lostdollarstoyouroperation.
When breeding mares there are a number of options; pasture breeding, hand breeding, artificial insemination (AI) with fresh semen, cooled semen, or frozen semen. Pasture and hand breeding generally have the highest conception rates but come with risks of injury to the mare, stallion, and/or handlers. AI eliminates the injury risks to mare and stallion but comes with lower conception rates. Timing of AI can be tricky especially when ordering semen based off the mare’s cycle. Cooled semen only has a lifespan of 24-48 hours therefore the importance of serial ultrasounds becomes crucial to get this timing right. Cooled semen needs to be ordered and shipped so it can be inseminated into the mare 12-24 hours prior to ovulation. Frozen semen needs to be inseminated within 6 hours of ovulation. For a mare being bred with frozen semen, an ultrasound to track the follicle is performed every 6 hours to ensure the timing is optimized.
Some mares can be challenging to get bred. This could be due to a number of different factors such as age, endometrial infection or inflammation or excess uterine fluid. For mares that are determined to be “dirty” (have lots of fluid retained in the uterus) a pre-breeding flush may be recommended. This can help clear the fluid to create a better environment for sperm. Post-breeding flushes can be quite useful in treatment of endometritis caused by breeding. This is recommended to be done 4 hours post-breeding to allow adequate time for the spermatozoa to enter the oviducts but close enough to time of breeding to minimize any bacterial contaminants to establish themselves. A uterine cytology, culture, and/or biopsy may be recommended to determine an underlying cause of infertility.
Examsshouldideally be conducted aminimumof 2to6 weeks priortobreedingseason SmallAnimal:(250)782-5616
At the Dawson Creek Veterinary Clinic, we have multiple vets who are trained in tracking a mare’s reproductive cycle, diagnosing and treating causes of infertility and performing uterine lavages and artificial insemination with cooled and frozen semen. Our new large animal clinic allows for us to house more mares for a more convenient breeding season and improved timing of AI. If you have any questions or would like to breed your mare, please contact us today! NH
Dr. Samantha Deamel
Dawson Creek Veterinary Clinic
250-782-1080
Proudly serving the BC and Alberta Peace Region Since 1977
2012bOURGAULT3320-76 &6700 10IN.SPACING,3/4IN.TIPS,MRBIII,18.5IN. AVERAGE,591MONITOR,4TANKMETERING,LOAD CONVEYOR, 2HIGHSPEEDFANS STK1039A-1040A
airdrills &seeders
2014Bourgault3320-86 &770
2012Bourgault3320-76 &6700
2009Bourgault3310-75 &6550ST
2012JohnDeere1870 &1910
2012SeedHawk6012& 600
2018Bourgault6450
2018Bourgault7550
2016Bourgault7950
2009Bourgault6550
tillage
2014SalfordI-4141
2018Gregoire-BessonSPHRW-TZ8
2019KvernelandNG-S101F35
PowerHarrow
2015Bourgault7200HeavyHarrow
2008Brandt5000HeavyHarrow
2016McFarlane2070-16Harrow
2013McFarlaneHD-140-THarrow
2009Bourgault6000Harrow
2015GatesDiscHarrow
2019HorschRT28HighSpeedDisk
2011Sunflower1550Disk
2023claasaxion920
miscellaneous
Auger -2019RodonoXTEND16
Auger -2013Sakundiak12-79
BaleProcessor -2018Highline2660
BaleProcessor -2015Highline 650-200
Conveyor -2022Brandt1547
Conveyor -2020Meridian20-110
Conveyor -2014Batco1545
GrappleBucket -AMIMGL150
Mower -2018KubotaZD1511LF-72
RTV -2018KubotaRTV-X1120D
RTV -2017KubotaRTV-1100C
RTV -2019KubotaRTV-XG850
Sprayer -2022CaseIHPatriot4440
combines
(4)CLAAS8700(2021-2023)
(2)2011CLAAS770
(5)CLAAS760TT(2011-2018)
(3)2013CLAAS670
2007CLAAS590R
2006CLAAS580R
(2)CLAAS570R(2008-2010)
2012JohnDeereS690
2008NewHollandCR9060
(2)2017CaseIH8240
2008CaseIH8010
2008CaseIH2588
$170,000 $170,000
2018bourgault7550
5TANKMETERING,SINGLESHOOTW/HIGHCAP FAN,DELUXELOAD/UNLOADAUGER,TOPCONX35 STK5956A
tractors &hEAVYEQUIPMENT
2018Versatile610DT 2015Versatile550 2011Versatile535 1990Versatile876 2022KubotaM7-172 (2)KubotaM7-171(2016-2018) 2013KubotaBX25D 2023KubotaM6-131 2010CaseIHSteiger335 2016ChallengerMT875E 2023Deutz-Fahr6165 2012JohnDeere9560R 2024JCB427AGT4FWheelLoader 2008JohnDeere328SkidSteer 2015Caterpillar279DSkidSteer 2018Gerry’s40TonTrailer 2017BWS15BWS2XTrailer 2007WesternStar4900SATruck
hayingequipment
2022Vermeer604ProBaler 2012Vermeer605NBaler
2017KubotaBV4580Baler 2004AGCOHesston4740Baler 2014JohnDeere569Premium Baler
2001JohnDeere567Baler 2020NewHollandRollbelt560 Baler
2006MacDon5020MC 2020NewHolland5020MC 2018KubotaDMC7036T 2018KubotaDMC6336T 2000Schulte5026RotaryCutter 2010VermeerR2300Rake
headers
2023CLAASConvio1530 2021CLAASConvio1230 2013CLAASMaxflex1200
2018MacDonFD140 (2)2019MacDonFD135 (3)MacDonFD75-40(2015-2018) (2)MacDonFD75-35(2017-2018) 2012MacDonD60-40 2009MacDonD60-35 2009JohnDeere936D 2014CaseIH3162-40 2008CaseIH2020-35F 2003CaseIH2015
Cargill Opens Regina Canola Facility, Expanding Market Access for Canadian Farmers
New facility strengthens domestic processing capacity and connects growers to global food and renewable fuel markets
Cargill.com,
Regina, Sask., April 21, 2026
Cargill’s canola processing facility in Regina, Saskatchewan is now operational, strengthening market access for Western Canadian farmers and helping meet growing global demand for food and low-carbon fuel solutions.
With the capacity to process 1 million metric tonnes of canola annually, the facility increases local demand while enabling more of the crop to be processed domestically into high-value products, including oil for food and renewable fuels and high-protein meal for animal feed. The site will serve growers across Saskatchewan and Western Manitoba.
“This facility strengthens our ability to connect Canadian farmers to growing global demand for food and renewable fuels,” said Jeff Vassart, president, Cargill Canada. “By expanding processing capacity in Saskatchewan, we’re creating more opportunities for farmers while helping ensure Canada remains competitive in rapidly evolving global markets.”
As demand grows for lower-carbon energy solutions, canola is playing an increasingly important role as a renewable feedstock for biofuels. By expanding local processing capacity, the Regina facility helps meet that demand while reducing reliance on exporting raw canola seed – allowing more value to be created within Canada and improving supply chain efficiency for farmers and customers.
Through programs like Cargill PowerCanola™, the site also helps farmers access emerging market opportunities while improving the delivery experience. Designed for efficiency, the facility features dual receiving lanes, appointment scheduling and streamlined logistics supporting faster, more predictable deliveries for growers.
Located at Saskatchewan’s Global Transportation Hub, the facility provides efficient rail access to domestic and export markets. The site supports more than 100 jobs in the region through a combination of full-time employees and contractors,
contributing to economic activity across transportation, logistics and service sectors in Regina and surrounding communities.
Cargill continues to invest in Canada’s agriculture sector to strengthen supply chains and support farmers. The company operates canola processing facilities in Camrose, Alberta and Clavet, Saskatchewan and offers programs to help Canadian growers access global markets and maximize crop value. NH
Spring Land Application — Make the Most of It
Agri-News, April 28, 2026
pplying manure and other nutrient sources including compost, digestate and other organic materials to land in early spring can be challenging, but when planned right, it helps keep nutrients in the field and makes every dollar work harder,” says Deanne Madsen, nutrient management specialist with the Alberta government.
While applying nutrient sources at rates closer to crop uptake can improve nutrient use efficiency, spring is often a constrained and busy time of year. For many livestock producers, manure application timing is driven by the need to empty manure storages and clean out pens. Field conditions and available labour also play an important role.
From a nutrient timing perspective, spring application can work well for all agricultural producers, but it also comes with a risk of nutrient loss. Early spring snowmelt and rainfall can move nutrients off fields before crops or forages are able to use them. These losses reduce the agronomic value of those nutrients. They can also contribute to water quality concerns, affect downstream users and may lead to regulatory or neighbour concerns.
Careful attention to timing and field selection is especially important when manure or other nutrient sources are applied in the spring to help reduce nutrient losses ahead of the growing season. When land applying in the spring, a combination of good planning and beneficial management practices can help reduce environmental risk while improving nutrient use efficiency and lowering fertilizer costs.
Consider the following practical steps to reduce nutrient loss and protect their value:
• Have sufficient land available or consider a manure handling or nutrient management plan. Stay away from fields that are poorly drained or already have elevated salinity or soil nitrate-nitrogen levels.
• Be mindful of nearby residences and communities. Stay 150 m or more away from nearby residences or occupied buildings or structures.
• Watch the forecast and field conditions. Wait for more stable weather and suitable soil conditions, i.e., avoid frozen or snow-covered land.
• Protect water wells and water bodies. Select fields that maintain appropriate setbacks; 30 m or more away from water wells and surface water depending on slope.
• Choose lower risk fields where possible. Apply first on fields with perennial forage, cover crops or good crop residue, following setback distances and incorporation requirements as required.
In Alberta, anyone land applying manure, or other nutrient sources found in the On-Farm Storage and Land Application Code, must follow the Agricultural Operation Practices Act (AOPA) and its regulations. The only exception would be nutrient sources being land applied under a permit issued by Environment and Protected Areas. These requirements ensure nutrient sources do not create a risk to the environment by leaving the land to which they are applied. Land application standards for setbacks, incorporation, soil testing and record keeping, particularly where larger
volumes of nutrients are applied, are found in the Standards and Administration Regulation.
“Keeping good records can help you track nutrients and make better nutrient management decisions over time,” says Madsen. “Producers handling larger volumes should be aware of the record keeping and soil testing requirements.”
In Alberta, anyone who applies 500 tonnes or more of manure and other nutrient sources annually, as outlined in the Code, is required to conduct soil testing on the land receiving those nutrients and keep records for 5 years. These records include:
• soil test results (no more than 3 years old)
• soil texture (one-time analysis)
• volume or weight of manure, compost, digestate and other organic materials handled
• name and address of each person receiving or applying nutrients, with applicable dates
• land locations where nutrient sources are applied
Early discussions with the Natural Resources Conservation Board (NRCB) can help producers identify appropriate options and plan manure application in a way that meets both operational needs and regulatory expectations. For additional information or clarification on land application setbacks, incorporation, soil testing and record keeping regulatory requirements, contact 310-FARM or your nearest NRCB field office.
For more information, visit the Government of Alberta’s Manure management guidelines and legislation and Manure management planning web pages. NH
Thinking of Keeping Backyard Chickens?
spca.bc.ca, June 11, 2025
The BC SPCA advocates for cage-free eggs to support a better life for laying hens. Raising backyard hens has become a popular option in rural and urban areas as a source of cage-free eggs while supporting local food production.
If you are thinking of raising backyard hens, it is important to consider whether you have the knowledge, time, and resources to care for them. Before welcoming feathered friends into your backyard, here are some important questions to ask yourself:
ARE BACKYARD HENS ALLOWED IN YOUR MUNICIPALITY?
Consult your local bylaws to confirm if backyard hens are permitted where you live. If allowed, bylaws will often outline specific requirements for keeping backyard hens that you must familiarize yourself with. Bylaws will usually restrict the number of hens permitted on one property. It is important to the well-being of hens to have at least two so they don’t get lonely.
Did you know? Roosters are not required for hens to lay eggs! Many municipalities usually prohibit keeping roosters due to the potential for noise disturbance. But what happens if you accidentally get a rooster? Hens and roosters look very similar when they are chicks, and even experienced breeders sometimes mistake a rooster for a hen. Ensure you have arranged with the breeder to return any unexpected roosters.
Check out our list of the best backyard hen bylaws. Did your municipality make the list?
WHERE WILL YOUR BACKYARD HENS LIVE?
Backyard hens should be housed in a chicken coop with a secure outdoor run. The coop and run must be designed and maintained to ensure adequate sanitation, ventilation, drainage, and space for all the hens. It must protect hens from the weather and predators, and prevent access by rodents. Coops must have litter for hens to scratch around in, perches for roosting, and comfortable nest boxes for hens to lay their eggs.
Exploring the outdoor run allows hens to perform many natural behaviours, such as scratching around in
the dirt, foraging through the grass, and dustbathing. Enrichment should be provided to backyard hens for mental stimulation and provide opportunities to perform natural behaviours. If your hens are not provided with enrichment, they may become stressed and frustrated. This could lead to the development of harmful behaviours such as feather pecking or bullying of other hens.
DO YOU HAVE ACCESS TO VETERINARY CARE?
Chickens may live for up to 10 years. Providing veterinary care to backyard hens is essential to being a responsible guardian. Is there a veterinarian in your community that has experience treating chickens? It is essential you have a relationship with a veterinarian to help keep your hens healthy and who can assist you if any health concerns come up, including euthanasia.
DO YOU KNOW HOW TO PREVENT AND DETECT DISEASE IN CHICKENS?
Chickens are susceptible to diseases that can cause serious illness and even death, such as Avian influenza. It is essential to follow basic biosecurity principles to reduce the risks posed by harmful diseases such as:
HaybineMo-Cow/2300Header...................................ComingIn NewHolland488 Haybine(2012)...............................$16,000 JohnDeere945 Discbine.............................................$35,000 KubotaDMC85400T Discbine.......................................$28,000
MISCELLANEOUSEQUIPMENT
1. Prevent contact with wild birds or other animals
2. Routinely and thoroughly clean the hens’ environment and equipment
3. Spot the signs of disease and contact a veterinarian early
4. Limit exposure to visitors – people can spread diseases to hens, too
5. Keep new hens separate until it’s known they are healthy
Are you familiar with signs of disease in chickens? Signs to look for include:
• Lack of energy, movement, or appetite
• Decreased egg production
• Swelling around the head, neck, and eyes
• Coughing or sneezing
• Nervous signs, tremors, or lack of coordination
• Diarrhea
More information can be found through the Canadian Food Inspection Agency.
ARE YOU AWARE OF THE RISKS TO HUMAN HEALTH?
Chickens can carry various viruses and bacteria that can infect people, including Campylobacteriosis (Campylobacter bacteria), E. coli (Escherichia coli bacteria), and Salmonellosis (Salmonella bacteria). In most cases, these diseases are spread through the feces (poop) of infected chickens, contaminated food, or the environment.
Biosecurity practices should be followed to reduce your risk of disease. This includes:
• Always washing your hands before and after handling hens, or anything in their environment
• Not eating or drinking where your hens live or roam
• Not allowing hens to enter your home
• Wearing a separate pair of shoes for hen care, and keeping these shoes outdoors
• Remaining outdoors when cleaning equipment (e.g., feed and water containers)
WHAT WILL YOUR BACKYARD HENS EAT?
Providing laying hens with a proper diet is essential to keeping them happy and healthy. Pet store bird feed may not meet the nutritional needs of your hens. Good quality commercial poultry feed should be the main part of their diet. Always consult with your veterinarian to ensure you are meeting the nutritional requirements of your hens throughout their lives.
To help your hens digest their food, they should have access to grit, such as gravel. It is very important your hens receive enough calcium in their diet, as calcium is used to produce eggs. If not, calcium deficiency can lead to osteoporosis (weak bones), as calcium normally used to form strong bones is instead used for egg production.
In addition to feed, hens must have constant access to clean drinking water.
HOW WILL YOU MANAGE THE WASTE FROM BACKYARD HENS?
How will you dispose of used litter, feathers the hens shed, and all that poop in an environmentally conscious way? Chicken waste can make great garden compost, but do you have the time and space to carefully compost it?
WHAT WILL YOU DO WITH HENS WHO HAVE STOPPED LAYING EGGS?
Hens can live up to 10 years, and their egg production peaks in the first two years. Egg production drops each year after this point. Hens may stop laying eggs well before they reach the end of their natural life. Like any senior pet, older hens need special care to keep them healthy. NH
•P owerfulTie r4 -complian td iese le ngin e
•E asy-lifthoodwit hd ualgas-chargedlif ts truts
•P remiumoperato rs tationw/ergonomi cs eat,armrests &L EDlights
•S ingl ep ointloaderconnectionan de asil yc onnectandremovebackhoe
•Q uickl ya ndeasil yc hang es peedan dd irectionwithTwinTouchfoot c ontrolsan dH ydrostatictransmission(HST)
•A utoConnect™ m id-mowerdeckinstalls/removesinlessthan
ins
50 Year Reunion (Almost)
Organizers of the 50 Year Reunion (Almost) for Spirit River Secondary High School are putting the call out to everyone who attended the school from 1971 to 1981.
They will be putting on a weekend of outdoor old-time music, games, social events, reconnection with classmates and, of course, the sharing of memories of the “good old days” from July 3rd to 5th, 2026.
Interested in attending?
Then get in touch with Ed at (780) 933-4420 or the reunion group at 2026spiritreunion@gmail.com to let them know who and how many to expect. NH
Looking to Operate a Drone in Alberta?
To operate a drone in Alberta, you must follow federal Transport Canada rules, respect provincial and municipal land-use restrictions, and understand where drones are prohibited, especially around airports and national parks.
Operating a drone in Alberta requires navigating a layered regulatory system that combines federal aviation law, provincial and municipal land rules, and site specific restrictions.
Below is a clear, structured overview of the essential things you need to know before taking flight.
FEDERAL REQUIREMENTS
(TRANSPORT CANADA)
Transport Canada regulates all airspace in Alberta, meaning every drone pilot must follow the Canadian Aviation Regulations (CARs), Part IX. These rules apply whether you fly in a city, rural area, or wilderness.
Key federal requirements include:
• Drone Registration: Any drone 250 g to 25 kg must be registered with Transport Canada. The registration number must be clearly marked on the aircraft.
• Pilot Certification: You must carry a valid Basic or Advanced drone pilot certificate depending on your operation.
o Basic: for flying in uncontrolled airspace and away from people.
o Advanced: for flying in controlled airspace or closer to people. Microdrones under 250 g do not require certification but must still follow safety rules.
• Altitude Limit: Maximum altitude is 122 metres (400 feet) above ground level.
• Line of Sight: You must maintain visual line of sight at all times.
• Safe Operation: You must not fly in a reckless or negligent manner or near emergency sites such as wildfires or accident scenes.
• Privacy and Trespassing Laws: Drone pilots must respect privacy rights and avoid trespassing on private property.
AIRSPACE RESTRICTIONS
Even with certification, you must follow airspace rules:
• Airports and Aerodromes: No flying within 5.6 km (3 nautical miles) of airports or 1.9 km (1 nautical mile) of heliports.
• Controlled Airspace: Advanced pilots must obtain authorization from NAV CANADA before flying in controlled zones.
LAND USE RESTRICTIONS IN ALBERTA
Federal airspace permission does not guarantee you can take off or land in a given location. Alberta has multiple land managers whose rules you must follow.
1. National Parks (Banff, Jasper, Waterton, etc.) Recreational drone use is completely prohibited, including takeoff, landing, and overflight—even
for microdrones. Fines can reach $25,000.
2. Provincial Parks and Protected Areas Alberta Parks may restrict drone use; permission is often required.
3. Municipal Bylaws Cities may ban drone takeoff and landing in parks, beaches, sports fields, and event areas. Always check local bylaws.
4. Private and Indigenous Lands You must obtain permission from landowners or governing authorities before launching or landing.
NO FLY ZONES IN ALBERTA
You must avoid:
• National parks
• Border crossings
• Airports and heliports (distance rules above)
• Busy populated areas (stay at least 30 metres away from bystanders for basic operations)
• Emergency operations, forest fires, concerts, parades, and advertised events
INSURANCE AND SPECIAL PERMISSIONS
Insurance is not mandatory for standard operations but is recommended, especially for commercial work. Some activities require a Special Flight Operations Certificate (SFOC RPAS). NH
Beaverlodge | BeaverlodgeAgComplex (1400 –5th Ave)
Tuesday| 4:00p.m. to 7:30p.m. |May 5,12,19,26
June 2,9,16,23,30 |July 7,14,21,28
Wednesday |11:00a.m. to 2:00p.m. |May 6,13,20,27
June 3,10,17,24 |July 1,8,15,22,29
Contact: (780)354-3013orbeaverlodgemarket@gmail.com
Beaverlodge -SouthPeace Centennial JunctionofHighway 43andRR722
SpecialMarkets:
May 9 |Mother’sDay Garden Party| 10:00a.m. to 4:00p.m. HytheCommunityCentre
June 7 |Show& ShineMarket| 11:00a.m. to 4:00p.m. SouthPeaceCentennialMuseum
July 26 |ChristmasinJuly |10:00a.m. to 4:00p.m.
Heritage Site,Wembley (9021 –101 Ave)
Contact:780-978-1198orsouthpeacefm@gmail.com
Berwyn |BerwynAgBuilding(5001 –51st St)
SpecialMarkets:
June 30 4:00a.m. to 8:00p.m.
LacCardinalPioneerVillage Museum
July 1 |11:00a.m. to 2:00p.m.
Grimshaw Mile Zero Multiplex ParkingLot
Contact:780-836-0660or farmersmarketberwyn@gmail.com
Chetwynd |Carver’sRow,Highway 97
Friday |3:00p.m.to6:00p.m.| May 15,22,29
June 5,12,19,26 |July 3,10,17,24,31
Contact: (250)788-6576orcmwiddic@gmail.com
Dawson Creek |N.A.R.Park(900Alaska Avenue)
Saturday| 9:00a.m. to 2:00p.m. |May 2,9,16,23,30
June 6,13,20,27 |July 4,11,18,25
Contact: (587)277-1476
Enilda|Women’s Institute Hall (WIDrive 1st Ave)
Saturday |10:00a.m. to 2:00p.m. |May 2 |June 6 |July 4
Contact:(780)523-5158orenildafarmersmarket@yahoo.com
Fairview |FairviewLegionHall(10315 –110th St) Wednesday |3:30p.m.to6:30p.m.| July 8,15,22,29
SpecialMarkets:May 6 |3:30p.m.to7:00p.m.
June 17 |3:30p.m.to7:00p.m.
Contact:780-772-9557or fairviewabfarmersmarket@gmail.com
FortSt.John |SUMMERMARKET
FestivalPlaza,Centennial Park (9523 –100th Street)
Saturday |9:00a.m.to2:00p.m.| May 2,9,16,23,30
June 6,13,20,27 |July 4,11,18,25
Contact: (778)256-7971or fsjfarmersmarket@gmail.com
FortNelson |Elk’s Lodge (5431 –50th AvenueSouth)
Saturday |9:00a.m.to3:00p.m.| May 2,9,16,23,30
June 6,13,20,27 |July 4,11,18,25
Contact: (250)233-3522ormanysoles@northwestel.net
GrandePrairie |TARACentre, Evergreen Park
Wednesday |4:00p.m.to7:00p.m.| July 15,22,29
Friday| 4:00p.m. to 7:00p.m. |May 1,8,15,22,29
June 5,12,19,26 |July 3,10,17,24,31
Saturday |10:00a.m. to 3:00p.m. |May 2,9,16,23,30
June 6,13,20,27 |July 4,11,18,25
Contact: (780)978-1198orsouthpeacefm@gmail.com
HighLevel |JubileePark(10511 –103St)
Saturday |10:00a.m. to 2:00p.m. |July 4,18
Contact:highlevelfarmersmarket@gmail.com
HighPrairie– Marigold |4724 –53rd Avenue
Wednesday |12:30p.m. to 5:30p.m. |May 13,27
June 10,24 |July 8,22
SpecialMarkets:Jul 28 | 11:00a.m.to3:00p.m.| 4724 -53Avenue
Contact:(780)523-4588
Kinuso |KinusoAgHall(1SwanAve) Saturdays| 10:00a.m. to 2:00p.m. |May 16,30
June 13,27 |Jul 11,25
Contact:780-775-2684orkinusofarmersmarket@gmail.com
La Crete |JubileePark(9102 –100St)
Thursday |11:00a.m. to 3:00p.m. |June 18,25| July 2,9,16,23,30
SpecialMarkets:July 1 |11:00a.m. to 3:00p.m.
Contact:(780)841-4648orlcheritagecentre@gmail.com
Manning | RoyalCanadianLegion(115 –3rd AveSW)
Thursday |4:00p.m.to7:00p.m.| May 7
June 4,11,18,25 |July 2,9,16,23,30 Contact: (780)836-1064
PeaceRiver | Former Peavey MartStore(9700 –78St) Saturdays |10:00a.m. to 2:00p.m. May 9,23 |June 13,27 |July 11,25 Contact:PRFMarket1991@gmail.com
Rycroft |RycroftAgCentre(5010 –49th Ave) Thursday |3:00p.m.to6:00p.m.| June 18,25 |July 2,9,16,23,30
SpecialMarkets:May 9 |Mother’sDay Market |12:00p.m. to 4:00p.m. Contact:(780)831-8792or rycroftfarmersmarket@gmail.com
Sexsmith |SexsmithCurlingRink(9913 –99th St) Tuesday| 4:00p.m. to 7:00p.m. |June 16,23,30 |July 7,14,21,28
SpecialMarkets:Jun 6 |10:00a.m. to 4:00p.m. ChautauquaDayMarket Contact:(780)568-3688or wellness@sexsmith.ca
Tangent |Tangent CommunityHall(101– 3rd Ave) Saturday |11:00a.m. to 4:00p.m. |May 23 -FlowerMarket June13 -GarageSale& Barbeque |July18- PopUpOutdoorMarket Contact:(780)219-5342or communityhalltangent@gmail.com
Valleyview |MemorialHall(4810 -50St) Saturday |11:00a.m. to 3:00p.m. |May 9 |June 6,20 |July 18 Contact:403-331-9507or valleyviewmarkets@gmail.com
NH Classifieds
Advertiser at a Glance
REGISTERED ANGUS BULLS, semen tested, vet inspected, delivery options. 780-781-4457, located North of Manning, AB.
2 YR OLD reg. virgin Charolais bull. White, 105lbs., conformation, passed semen evaluation. 780-814-3598.
TWO-YEAR-OLD registered virgin Charolais bull. 80lbs. (twin). Great feet, conformation, passed semen evaluation. Call/text 780814-3598.
CROSSBRED commercial bulls, semen-tested, vet inspected, vaccinated, free delivery in Peace Country. 780-836-0117 or 780-8360552.
2 YR OLD registered red simmental bulls for sale by Private Treaty. 780-354-8842 or 780-814-2567.
16i" CALF DEHORNING tool, $40. Call/Text Doug 250-219-4139.
NEW 4 RING 2 piece round poly bale feeder, $650. Call/Text Doug 250-2194139.
SPEED CONTROLLED RUBBER finger chicken plucker for sale, call 780772-6544.
FOR SALE: Big horn roping saddle. Padded seat, bridle included, asking $500 OBO. Call 780-354-3435.
CANADIAN ARCOTT
YEARLING ewes bred for February. Open ewe lambs, can deliver. Donald Johnston 780-837-1770.
CANADIAN ARCOTT
Buying Antiques: Coins, toys, advertising, tools & more. Will buy bulk. Call/text 780832-8216.
LOOKING FOR a 1980-87 cab for International 1854 3tonne truck. Call Abe 780841-4740.
LOOKING FOR A 3-horse bumper pull trailer. Call Bob 250-467-5345.
WALL FRAMING TRAILER, on wheels. Deck screws out to 8’. 780-772-6544.
Dismantling cultivator, disc, and plows for parts. Some air drills. 780-831-6747.
for your quote today.
KING BUHLER 3 PTH 8' disc, asking $2200. Call 780-841-1607 or 780-9282395.
FRONTIER LL1396, 8' drawn box blade w/Scarifier, 2 yrs old, purchased new. 780-837-6457.
250 3”-4” x 7ft fence posts for sale. $3.50 each. Call Doug 250-219-4139.
1950'S ERA FORD truck found when clearing brush. For details and pricing, call 780-772-6544.
2009 FORD F-350, 6.4 litre diesel, long box. Call/Text Greg, 780-5121207 or 780-538-9115.
1969 INTERNATIONAL GRAIN truck, wood box, hoist, motor needs work, shedded, $5000. Call/text 780-926-0981.
YEARLING ram, ram lambs for sale, can deliver. Call Donald Johnston, Donnelly, 780-837-1770. LOOKING FOR AN older (70's era) single axle water truck with spray bar. 780523-1488.
LOOKING FOR 4" or 6" grain bucket elevator legs, 25'-30' in height. Call Edwin 780-285-4680.
SEACAN 8x20' storage container. End doors, very good shape, $4500. Call/text 780-926-0981.
DOUBLE D FENCING avail. for your barb wire, page wire & plank fencing needs. 780518-6319.
VALLEE FORESTRY BIG Red Portable Sawmill, undercarriage, and trailer. Call for price and details. 780-926-6087.
1981 HONDA 185 XL Enduro Motorbike, excellent shape, always covered, $3000. Call/Text Doug 250-2194139.
UPRIGHT PIANO for sale. Taking offers, For more information or pricing, call 780-772-6544.
10 PC HEAVY duty combination wrench set, 1” to 2 1/2”, $150. Call/Text Doug 250-219-4139.
2 TON BENCH type press, like new, $300. Call/Text Doug 250-219-4139.
CAT D6NLGP with ripper for hire, located in Birch Hills County. Call Eugene at 780835-0601.
MILITARY BUILT
30” GRASS SYTHE, $80. Call/Text Doug 250-2194139.
BENCH TOP DRILL Press, $150. Call/Text Doug 250219-4139.
NEW HAYS WIRE stretcher, $140. Call/Text Doug 250219-4139.
RADLEY 21” REAR bagger push mower, 1 year old, $175. Call/Text Doug, 250219-4139.
DAMAGED GRAIN BUYING:
1800 sqft home on QTR/section, f/basement, 400 sqft upper bedroom, 1 bath. 780-971-2592 after 6PM.
LOOKING FOR PASTURE to rent for (30) pairs of cattle. Call Andrew, 780-841-5932.
LOOKING TO LEASE farmland in the GP/Sexsmith/Teepee Creek area. Contact David to discuss options. 780-9786768.
1985 HONDA 250 Bif Red Trike for sale. Needs some work. For info, call 780-8411607.
2000 CASE CONCORDE 40’, 340bu TBT, paired row DS, single shoot, 1500gal tank, 18.4x26. 780-6189161.
16' HEAVY DUTY bale frame. Needs hitch, would make excellent bale wagon. Call 780-772-6544.
HOME BUILT 3 PTH Bale Spear, $250. Call/Text Doug 250-219-4139.
Looking for a carrier for a 30ft swather. Call/text Kevin at 780-285-4684.
1971 UTB 65 HP 4WA, diesel, 3 new tires, 661 hrs, excellent condition, $6000, 780-971-2592.
CONCORD 40' HEAVY duty cultivator, c/w anhydrous kit. 780-618-9161 or 780-8362107
1982 JD 4440, 9970 hrs., 20.8x38 duals, c/w 12' Degelman dozer blade, $38,000. Call/text 780-9260981.
STEIGER 310 TRACTOR, both differentials rebearinged. Atom-Jet hyd., 2 tires, $35,000. Call/text Abe, 780-841-4740.
WANTED: BARLEY, WHEAT for feedlot. Can pickup with Super B. Gary 780-5183992.
3/4T AUTOSTEERING bale wagon for sale. For more details and pricing call 780772-6544.
LAND ROLLERS for sale. 12', 14', and 17'. Call John for details and pricing. 780814-4472.
STARTER & DIFFERENTIAL pinion for cockshutt 40 or 50 with Buda gas engine. Call 780-835-0601.
FORAGE SEED OATS. Good germination. Delivery available. Call/Text 250-7820220
SMALL SQUARE BALES of barley and alfalfa for sale. Call Eugene 780-835-0601.
ORGANIC ALFALFA and Red Clover seed for sale. Call/Text Edwin 780-2854680.
CERTIFIED BROWN SEED OATS. CDC-SO1 brown oats for sale. Call/Text 780-7814457, Manning, AB.
CLASSIFIEDCATEGORY LISTING
May 30, 2026
June 13, 2026
Bins
Flat Bottom Grain Bin
Auger - Loading Auger w/ Mover
Harrow - Frontier Off-Set Disc
Swather - Header Transport
UnreservedFarmSaleforJacob“Jake”Blum
SaleStartsMay29th&ClosesJune2nd,2026
Directions:FromHytheAB,GoSouth½mileonHwy43totheIntersection ofHwy43&Hwy672.Go WestonHwy672for8Miles.SouthSideoftheRoad.BlueSign122033Hwy672
TRACTORS&ACCESSORIES
JD87604wd Tractor-Showing8321Hrs,Duals &OverhaulInframeEngine200HrsAgo
JD87604wd Tractor-Showing6915Hrs&Duals
JD46502wd Tractor-Showing10,356Hrs
JD50202wd Tractorw/Ezee-OnFEL&Duals
JD50202wd Tractor-ForParts
JD31302wd Tractor
VintageCase“D”2wd Tractor
EzeeOn2100FEL&Bucket
JDStarfire6000
JDStarfire300
JD4200Display
2–JD1800Displays
CONSTRUCTIONEQUIPMENT
Caterpillar225LC TrackExcavatorw/30”Pads, 48”DiggingBucket
CaterpillarD7GCrawlerDozerw/Ripper, 27”Pads,GoodUnderCarriage,Inframe EngineOverhaul1000HrsAgo, Showing6741Hrs
CaterpillarD23JCrawlerw/PuttMotor, HydC-Frame,PresentConditionUnknown Beales10'BrushRakeforD7G
Dika5WheelRootRakew/Extra Teeth C-Frame&DozertoFitCatD6with30”Pads V-BrushCutterforCATD7Crawler
TILLAGEEQUIPMENT
JD182061'AirDrillw/JD19003Comp430Bu AirCart
JD182052'AirDrillw/JD19103Comp350Bu AirCart
JD935048'HoeDrillw/Factor Transport&Fert
JD935040'HoeDrillforParts
BrandtContourCommander70'HeavyHarrows
JD23524'Disc
JD14'HDDisc Bourgault40'Cultw/1500GalAnhydrous Tank CertifiedUntil2029
JD160029'DTCult
MorrisChallengerL-24029'FieldCult
Wilrich56'FieldCult
Melroe9036BottomPlow Melroe9037BottomPlow Case4BottomPlow 20'DrillMover 9'SheepsFootPacker
HARVESTEQUIPMENT
JD9600SPCombine-Showing3476Sep.Hrs &JD914P/UHeader
JD9600SPCombine-Approx.3000 Sep.Hrs&JD914P/UHeader
JD9600SPCombine-Showing2500Sep.Hrs &CropCatcher
JD925SPStraightCutHeaderw/P/UReel Westward9300SP25'Swatherw/ TripleDelivery, Large Tires&2Spd
ElmerSwather Transport ElmerHeader Transport
2-Brandt10”x70'SwingAugers
LargeAssortmentofGas&ElectricMotorGrain Augers
AssortedAugerHoppers
Vertec5500ContinuousGrainDryer-NG &Propane
RemVRXGrain Vac-Showing210Hrs N/U15'Grain VacHose
Labtronic919GrainMoisture Testerw/Scale &Charts
GRAINBINS&ACCESSORIES
2-Meridian1612HopperBottomSmooth Wall GrainBins-CoatingforFert &InspectionBase
GrainMaxGM3000Smooth WallHopperBottom Bin
Buhler2400BuHopperBottomBin
Westeel2400BuHopperBottomBinw/Aeration
Buhler3000BuHopperBottomBin
LargeAssortmentofFlatBottomGrainBins, 5HaveSteelFloors&16Have WoodenFloors
3–3HpKehoAerationFans
2–5HpAerationFans
LargeAmountofAerationScreens
HAYING
JD567RdBalerw/Approx.18,000Bales, Twine &Mega WideP/U
JD 94614'HydroswingMoCo
NH216TwinVRake
AssortedOlderSideDeliveryRakes
Case Trail TypeSickleMower 4-SwathRollers
ForMoreInformationContactJakeat780-402-0569 Viewingis AvailablefromMay27th toJune2ndfrom9:00a.m.to4:00p.m.orbyappointment.
TRUCKS&TRAILERS
1988PeterbiltT/A20'Grain Truckw/Courtney Berg20'SteelBox&Hoist
1980GMC7000T/AGrain Truckw/20'Steel Box&Hoist,Roll Tarp
1979GMCS/AGrain Truckw/17'SteelBox &Hoist
2013GMC15004x4RegCabLongBox Truck 1998Chev25004x4ExtCabShortBox Truck MaverickT/A16'BPStock Trailer HomemadeS/A TruckBox Trailer ShopBuiltDualWheeled Trailer
ShopBuiltFuel Tank Trailer
OTHEREQUIPMENT
2017Honda500ccQuad 2008Honda420ccQuad
Inland72'T/AFieldSprayerw/800GalPlastic Tank 4-SprayAir72'Sprayers(2forParts) WheatHeartHi&HeavyHitterPostPounder w/HondaEngine Rock-O-MaticRockPicker ShopBuilt16'LandRoller WillmarS/AFertSpreader Easy Way250BUCreepFeederwithPanels FarmKingRollerMill AssortedCattlePanels CalfShelters 9 Ton Wagonw/ WoodDeck 4Wheel Wagon
MISCELLANEOUS
VintageLister(1.5HP)Engine(Pre1930) VintageBandSawfromQuebec
Vintage WoodLathe& Tools LincolnRanger8AC&DCMotorDrive Welderon Trailer SeveralShop Welders ExtensionLoaders
Saddles& Tack BEMotorDrivenPressure Washer Culverts 2–50'QuickBinRings 3-180 WattSolarPanels 4–FarmFuel Tanks&Stands
LargeAmountofShopSupplies& Tools
CastIronBathtub
LargeSelectionofAntiques&HouseholdEffects
Beyond Dirt
Alle M. Carter, Lawyer, CLH Law/CLHbid.com, Farmer, Peace Country
Growing up in the Peace Country, I am proud to call the Niobe area home, where I’m now the fourth generation on the land my great-grandfather homesteaded in 1911. Most days I’m somewhere between farming, practicing law, and talking with farmers/ranchers about land; often juggling all three at once. I’d like to think my farm background keeps me out of the category of “stuffy, overpriced lawyer,” and that this column feels more like a conversation than a lecture. I don’t claim to be an expert, but I do spend a lot of time listening, and I hope my two cents are helpful. Perhaps if one topic doesn’t resonate with you, it might with a neighbour or a friend.
PROBATE ISN’T THE ENEMY
WE THINK IT IS
Perhaps you’ve been asked to act as an Executor/Personal Representative or maybe you’re just trying to get your own affairs in order. Either way, there’s one topic that comes up over and over again; whether it’s at a farm show, over coffee, or sitting across my desk.
The dreaded word: Probate.
For whatever reason, probate has taken on a bit of a reputation. I often hear concerns that the government is going to “freeze everything for years,” that it’s overly expensive, or that it’s something to be avoided at all costs. While there are always exceptions, the reality in Alberta is that the process can be less painful than it is made out to be.
Probate is simply the court confirming that a will is valid and that the Executor/Personal Representative has authority to act. It ensures the wishes of the deceased are honoured, and beneficiaries get what they are entitled to in law.
In Alberta, the cost is less than in several other provinces. There is a court fee set out under the Surrogate Rules, capped at a relatively low amount, with legal fees being in addition to the Court fee. In most cases, if things are organized, probate can be obtained in a matter of weeks or months, not years.
Now, that doesn’t mean that there aren’t suitable circumstances where you should consider structuring your affairs to avoid probate or the fees that relate. My concern relates to making the avoidance of probate fees the paramount factor in your estate planning- up to the exclusion of all reasonable factors. The most common one I see with farmland is wanting to add children onto titles as joint tenants when the children and testor are relatively young. The idea of joint tenancy is simple: when one owner passes, the land transfers automatically to the surviving owner by right of survivorship so the asset never forms part of the estate.
However, that is often where things can go sideways…
Avoiding probate on land is only half the equation; if bank accounts, investments or other assets are still in the deceased’s name alone, those assets will likely still require probate to deal with. That being said, the “probate avoidance” plan isn’t really avoiding probate at all.
More importantly, adding a child onto title should be part of a broader and more complex estate planning decision as it is a legal transfer of an interest in your land.
Now, whoever you add to the title can result in the child having as many ownership rights in the property as you do.
I have met folks in their 50s, 60s, even early 70s who have added a child to title “just to avoid probate fees” several years ago and they are now wanting to sell a piece of land...
Yet the child on title doesn’t agree.
At that point, the answer is a tough one- you can’t sell without their con -
sent…Not unless you’re prepared to go to court and argue that they are on title as trustee only. I currently have a client who wants to sell her land, as she needs the money. However, her son will not allow it. It breaks my heart to see the stress that this is now causing her and in the end, no money was saved.
What started as a simple attempt to “make things cheaper”, can end up tying your hands and, in some cases, creating real strain within the family.
Even if you are later in life, you may still have a lot of living left to do. Plans change, operations evolve, kids come and go from the farm. What makes sense today may not make sense five or ten years from now.
Probate, in many cases, is not the problem it’s made out to be. In fact, it can be a useful tool. It provides certainty, confirms authority, and allows assets to be dealt with cleanly and properly. Don’t shoot yourself in the foot just to avoid the fees associated with it because in the end, it could cost you many multiples of the fee you sought to avoid.
That doesn’t mean there’s a one-size-fits-all answer. Good estate planning is about looking at the full picture, land, bank accounts, tax considerations, and, most importantly, family dynamics. There are circumstances where thoughtful estate planning makes a lot of sense, however, I would recommend sitting down with both your lawyer and your accountant to work through a proper plan. Part of that advice is also understanding that adding a child to title merely to avoid probate fees doesn’t accomplish anything from a CRA perspective, unless a lot of other planning goes with it. There also has to be a real disposition for tax purposes in order to access or multiply capital gains exemptions.
In summary, please don’t let the fear of probate fees drive decisions that affect how you live and operate today. Why? Because at the end of the day, the goal isn’t just to simplify things when you’re gone, it’s to make sure you still have flexibility to live with the assets you have earned while you still can. NH
Parcel 4– 158± Treed Acres
Proudly serving the BC and Alberta Peace Region Since 1977
RAVELLI
Inventoryisalready rollingin forourAnnualSpringThawTimed OnlineAuction,hostedbyVJVDawsonCreekandVJVBeaverlodge.
Thisis agreatopportunitytosellfarm,ranch,industrial,acreage, andequipment-relateditemsthrough atrustedtimedonline auctionplatform.
