WOULD YOULIKE TO RECEIVE THENORTHERNHORIZON?
HAVE YOURECEIVEDITPREVIOUSLY BUTTHEN STOPPEDRECEIVINGIT?
To Canada Post, your Mailbox orSuperboxis designatedinoneof four ways -House,Apartment, FarmorBusiness.
Justheaddown to your localpostoffice andask your Postmaster to have yourMailbox/Superbox designatedasa“Farm”.
Youshouldstart receiving your copy oftheHorizon withina coupleof weeks. 98907416JAN26
NORTH COUNTRY RANCHLAND BULL SALE
Dan PRZYBYLSKI Heather ANDERSON
Sales/ClassifiedsCirculation (250)784-4319handerson@farmmedia.com dcsales@glaciermedia.ca
Pleasedirectallaccountinginquiriestoap@farmmedia.com
THENORTHERNHORIZON (PublishedbyGlacierFarmMedia)1666DublinAve, Winnipeg,ManitobaR3H0H1
TheNorthernHorizonretainsfull,completeandsolecopyrightofanyadvertisement, writtenorphotographicmaterialpublishedintheNorthernHorizon.Reproduction isnotpermittedwithoutthewrittenpermissionoftheNorthernHorizon. AllcontributedmaterialwillbeincludedintheNorthernHorizonasspacepermits. Wereservetherighttoeditorre-writeanyaspectofcontributedcopytomakeit suitableforpublishing.
OURNEXTISSUE:FRIDAY,APRIL10TH,2026
REGULARADDEADLINES:
Bookingdeadlineforregulardisplayads: Noonon TUESDAY,MARCH31ST,2026
Admaterialdeadline: Noonon THURSDAY, APRIL2ND, 2026
CLASSIFIEDADDEADLINE:
AnysubmissionsforClassifiedAdsshouldbemadetoDanPrzybylski byphoneat(250)784-4319oremailatdcsales@glaciermedia.ca
Allclassifiedadsubmissionsmustbereceived by theNorther nHorizon by10:00a.m.(BCtime)on THURSDAY,APRIL2ND,2026
SUBSCRIPTIONS
SubscriptionstotheNorthernHorizonare available by contacting DanPrzybylski by phoneat(250)784-4319oremailatdcsales@glaciermedia.ca orHeatherAnderson by emailatheather@fbcpublishing.com
Theannualsubscriptionrateis $150.00 (GSTincluded) withfullpaymentdueattimeofsubscription.
$
$ 399,000
$ 279,000
$ 159,000
Stk#20897-1
2019BOURGAULT 3320-66/7950AIRSEEDER TANK
66x10”,HF, XTC,MRBlll’s,DS, FullRunIntelligent AG Blockage, 3/4”CarbideTips,Conveyor,Saddle Tankw/fillChute, 2High-CapacityFans,DigiStarScale,4 Meters+SaddleTankMeter, 850Front Singles& RearDuals.
Stk#20544-1
2014BOURGAULT3320-66w/
2019BOURGAULT 7700AIRSEEDER &TANK
66’X10”, XTCOpeners,MRBIII’s,3/4”Tips, 8RunTBH,DoubleShoot, SectionalControl,X35Monitor, Saddle Tank,SurgeBrakes,710Duals.
Stk#19568-2
2013BOURGAULT 3320-76QDA/7950
76’X10”,DS,MRBIII’S,QDA 4.5”RoundPackers,FullSeedsingle FertBlockage,X30,ASC,Cameras,DualFan, 4TankPlusSaddle, Conveyor,Duals,SurgeBrake,Scales
Stk#20994-2
2012BOURGAULT 3320-60XTC 20116550STAIRCART &TANK
60’X10”,MRBIII’S,V StylePackers,4TankMetering,AuxClutches, 591Monitor, DeluxeAuger,Rear650/75R34Duals.
Agriculture and Agri-Food Canada, March 5, 2026
Young Canadians are the future of the agriculture and agri-food sector. Helping youth gain practical experience in agriculture strengthens the workforce and contributes to Canada’s long-term food security.
Today, at the Atlantic Grains Council Cereals and Oilseeds 2026 conference, the Honourable Heath MacDonald, Minister of Agriculture and Agri-Food, announced an investment of up to $27 million in funding to Agriculture and Agri-Food Canada’s Youth Employment and Skills Program (YESP) over two years (2026 to 2028), including close to $13.47 million in funding for the 2026–27 program year. This funding will support young Canadians across the country as they gain valuable hands-on experience in the agriculture and agri-food sector and contribute to building the next generation of skilled workers.
The YESP encourages agriculture and agri-food employers to hire youth aged 15 to 30 for work experience and skill development opportunities, by providing non-repayable contributions for the youth’s wages and benefits. The YESP further incentivizes
employers to hire youth facing barriers to employment, including but not limited to Indigenous youth, youth with disabilities, and youth living in rural or remote regions.
Applications for the 2026–27 program year will be accepted from March 5 to May 4, 2026. Administrative enhancements have been introduced this year to streamline the application process and prioritize youth facing barriers to employment.
The Government of Canada is committed to fostering an inclusive, skilled workforce by providing young people with the experience and support they need to succeed in the agriculture and agri-food sector.
“Supporting young Canadians as they build their careers in agriculture is an investment in the future of our country. By opening doors to meaningful experiences in this essential sector, we help the next generation gain the skills, confidence, and opportunities they need to thrive. This investment will strengthen our rural communities, support innovation, and ensure the continued success of Canadian agriculture.” - The Honourable Heath MacDonald, Minister of Agriculture and Agri-Food
“Our youth bring fresh perspectives, energy, and
innovation to Canadian agriculture. By supporting programs like YESP, we are helping young people unlock new opportunities, gain valuable experience, and pave the way for a vibrant, sustainable future for our sector and our communities.” - Bobby Morrissey, Member of Parliament for Egmont
• This investment is part of the Government of Canada’s broader $307.9 million investment in the Youth Employment and Skills Strategy (YESS), focused on helping young Canadians gain valuable work experience and build rewarding careers.
• Funding is available for up to 50% of wages and benefits for general applicants, and up to 80% for Indigenous employers or employers hiring youth facing barriers.
• Since 2019, YESP has supported over 6,200 youth jobs across Canada’s agriculture sector, including almost 2,000 opportunities for youth facing employment barriers.
• New administrative changes are being introduced to simplify the application and approval process, ensuring more effective and targeted support for youth in the agriculture sector. NH
SpecializinginMicro-Nutrients Agrow-GuardDistributionisyour sourceforhighqualityagricultural MicronutrientsinCanada.
Products: •Micro-Mix Max• IgniteS2byAgri-Gro®
OtherFoliarAppliedProductsInclude: •10%Boron• 2.5% Molybdenum •5%Copper •6%Iron• 9%Zinc •10%Calcium(Agri-Cal) •UltraOrganicBio-Stimulant •9-18-9-1LiquidFertilizer
Agrow-GuardDistributionInc. Agrow-Guar istributionInc. P.O.Box237,DawsonCreek,BCV1G4G3 O.Box237,DawsonCreek,BCV1G4G3 250-782-0220
info@agrow-guard.com •www.agrow-guard.com
Schulte Industries, June 28, 2024
Professional producers require harrows capable of managing residue even in the toughest of conditions at various times of the year. The Schulte SHX line of harrows accomplish that with their unique seven bar harrow tine design and layout along with Field Finish On Demand™. The new 60-foot SHX-760 & 84-foot SHX-784 are the only harrows to offer a combination of heavy and light tines to move ground more aggressively, break up straw, improve material
distribution and create that desired field finish. The Field Finish On Demand hydraulic harrow pressure system allows you to optimize your field finish requirements. The Schulte SHX line of harrows offers great versatility for post-harvest residue management and pre-seeding soil bed preparation.
• Heavy duty 12” X 12” tubular frame
• Harrows include a seven-bar design with three sets of 5/8” at the front and four of 1/2” tines
with industry leading 28” length
• Wider harrow spacing allows for better material flow and distribution
• Active hydraulic up or down pressure controlled either manually or through a cab mounted monitor
• Robust “A” frame hitch design allows for easy maneuverability
• Angle adjustment of the harrows from 0 to 6 degrees NH
NORTH COUNTRY RANCHLAND BULL SALE
Sowhyn ottry aM aizexd ea le rs hi ponf orsize?
MaizexSeedsiscurrently recruitingnewdealers and retailers inthePeace Riverregiontointroducefarmers tothenextgenerationof canola hybridsandsilage/grazingcornperformance.Aswecontinueto expand ourbusiness,wearelooking forgoodpeoplewhoc areaboutseed asmuchaswedo.Ifyouareinterested inbecoming aM aizexSeeds representative, pleasegetintouchwithusat 877-682-1720, viamaizex.com, orgodirectlytoourapplication formusingtheQRcode.
Chet and Jamie, along with Taos, Rhett & Nash put on another great sale, including very nice show area outside to go along with their very nice show barn. NH
38 Head On Offer
Overall Sale Average - $9,098.68
20 Yearlings for a Sale Average of $8,650.00
18 Two-Year-Olds for a Sale Average of $9,597.22
HIGH SELLERS
LOT 1 - FTF MANHATTAN 206M - $15,500.00
LOT 42 - FTF NEPAL 232N - $13,500.00
FORAHAY MIX#1- $3.46perpound
60%RanchersAlfalfaBlend 25%SmoothBrome |5%Timothy 5% TallFescue|5%MeadowFescue 12poundsperacre
FORAHAYMIX#2- $3.68perpound
85%RanchersAlfalfaBlend |10%Timothy 5% TallFescue 10poundsperacre
HAY/PASTUREMIX- $4.25perpound
20%RanchersAlfalfaBlend |20% YellowAlfalfa 20%MeadowBrome|20%SmoothBrome 10%AlsikeClover |5%OrchardGrass |5%Timothy 10poundsperacre
HAYMIX(LOWLAND)- $4.28perpound
40%AlsikeClover|20%SmoothBrome
20%Timothy |20%ReedCanaryGrass 10poundsperacre
FORA PASTUREMIX- $3.65perpound
50%MeadowBrome |30%Rancher’sAlfalfa Blend |10% TallFescue |10%OrchardGrass 12poundsperacre
COMMUNITY PASTUREMIX$3.97perpound
30%MeadowBrome |30%SmoothBrome 10%Rancher’sAlfalfa |10% YellowAlfalfa 10%RedClover|5%CicerMilk Vetch 3%MeadowFescue |2%Timothy 12poundsperacre
Pleasebeadvisedthatallpricesaresubjecttochangewithout priornotice. We continuously reviewandadjustourpricingto provideyouwiththebestpossiblevalue.
BENEFITSOFCOVERCROPS
Reducefertilizercosts |Preventerosion |Conserve moisture |Reducetheneedforherbicides Improveyieldsbybuildingsoilhealth
PEACECOUNTRYTOTALMIX$55peracre
20%ForageOats,14%Barley,15%Forage Triticale, 20%ForagePeas,6%Hairy Vetch,4%FabaBeans, 3%RedProsoMillet,4%ItalianRyegrass,2% Sunflower,2%Flax,3%Sudangrass,2%Daikon Radish,1%Purple TopTurnip,1%7-Top Turnip,2% CrimsonClover, 1%BerseemClover 65lb.seedingrate |Availableintotesor50lbbags. PEACECOUNTRYSILAGEMIX$42peracre
45%ForageOats,15%Barley,19%Forage Triticale, 11%ForagePeas,4%Hairy Vetch,5%FabaBeans, 1%7-Top Turnip 90lb.seedingrate |Availablein TotesorBulk Tofollowupwithgrazing,add3lbsCrimsonClover & 4lbsItalianRyegrassat15$peracre
We arecommittedtohelpingfarmers &rancherstouse regenerativefarmingpracticesinordertodiversifyfarmland ecosystemswhileenhancingefficiencyandprofitability.Wecan custommixmostanycovercropmixthatyouwouldlike,at competitivepricing.
Stats Canada, Table 32-10-0359-01, March 5, 2026
Canadian farmers expect to plant more canola, barley, soybeans and corn for grain in 2026, while they anticipate area seeded to wheat, oats, lentils and dry peas to decrease compared with the previous year.
At the national level, farmers anticipate planting 26.7 million acres of wheat in 2026, down 1.1% from the previous year. If this anticipation is realized, national wheat area would remain well above the five-year average, despite a decrease from 2025, which would likely be attributable to continued strong global demand.
Producers expect spring wheat area to edge down 0.1% to 18.8 million acres in 2026. They anticipate durum wheat area to decrease 2.4% to 6.4 million acres, while they expect winter wheat area to fall 6.7% to 1.6 million acres.
Farmers in Saskatchewan anticipate planting 13.9 million acres of wheat in 2026, down 1.0% from the previous year. Producers expect spring wheat area to fall 0.6% to 8.7 million acres, while they anticipate durum wheat area to remain at 5.1 million acres.
In Alberta, farmers expect total wheat area to edge up 0.3% to 8.1 million acres because of higher spring wheat area (+3.6% to 6.8 million acres). Meanwhile, they expect durum wheat area (-11.8% to 1.2 million acres) to decrease.
Manitoba farmers anticipate planting 3.1 million acres of wheat in 2026, down 5.1% from one year earlier.
Farmers expect canola area to increase 1.0% to 21.8 million acres in 2026, roughly in line with the five-year average. Higher anticipated seeded area may be led by strong domestic
demand as processing capacity continues to expand.
In Saskatchewan, where most of the country’s canola is grown, producers anticipate seeded area of canola to rise 0.5% to 12.2 million acres.
In Alberta, farmers expect seeded area of canola to increase 0.7% to 6.3 million acres.
Farmers in Manitoba anticipate seeding 3.2 million acres of canola in 2026, up 4.7% from the previous year.
SOYBEANS
Nationally, farmers anticipate planting 5.9 million acres of soybeans in 2026, up 1.9% from 2025.
In Ontario, the province that pro-
duces the most soybeans, farmers expect to plant more acres of soybeans in 2026, rising 0.2% to 2.9 million acres.
Manitoba is expected to lead the national increase in soybean acreage, rising 12.9% to 1.9 million acres. If this expectation is realized, this would be the highest soybean area in the province since 2018, possibly because of low input costs relative to other crops.
In Quebec, producers expect soybean seeded area to decrease 5.0% to 1.0 million acres in 2026.
Nationwide, farmers expect barley acreage to rise 5.0% to 6.4 million acres in 2026.
Farmers expect barley area to increase in both Saskatchewan (+7.9% to 2.4 million acres) and Alberta (+5.2% to 3.5 million acres), while they expect it to decline in Manitoba (-1.6% to 304,400 acres).
Producers expect oat area to fall 3.1% compared with one year earlier to 2.9 million acres in 2026, possibly because of high oat stocks resulting from high production in 2025.
At the national level, farmers expect to plant 3.8 million acres of corn for grain in 2026, up 1.7% from one year earlier. The increase in corn for grain area is led by Ontario, where more than 60% of all corn for grain in Canada is grown. Farmers anticipate planting 2.3 million acres of corn for grain in 2026, up 5.4% from 2025. If this occurs, it would be a record area for the province, surpassing the previous record set in 2022.
Quebec farmers expect to plant less corn for grain in 2026, falling 1.5% to 841,500 acres. Manitoba producers also reported anticipating lower area, falling
5.3% to 586,800 acres, a level still above the five-year average for the province.
Producers expect area seeded to lentils to decrease 5.5% compared with one year earlier to 4.1 million acres in 2026, possibly because of high stocks resulting from a large crop production in 2025. In Saskatchewan, where almost 90% of Canada’s lentils are grown, farmers expect seeded area to fall 4.3% to 3.6 million acres in 2026. Meanwhile, farmers in Alberta expect lentil area to decrease 13.4% to 489,500 acres.
Farmers across Canada expect to plant fewer acres of dry peas in 2026; they anticipate area for dry peas to fall 12.3% from 2025 to 3.1 million acres. In 2026, farmers expect seeded area to fall 16.6% to 1.5 million acres in Saskatchewan, and they anticipate it falling 3.9% to 1.4 million acres in Alberta. The national decrease is likely the result of lower returns relative to other crops because of tariffs in place from importing countries. NH
Proudly serving the BC and Alberta Peace Region Since 1977
CICERMILKVETCH
Long-lived,perennial,non-bloatlegume,Vigorouscreepingroots ALSO AVAILABLE
MULTI5301ALFALFA (multi-leaf,rapid re-growth)
MATRIXALFALFA (strongcreeping root)
MEADOWBROMEGRASS (excellent re-growth,highyielding,long-livedbunchgrass)
SMOOTHBROMEGRASS (highyielding,long-lived,creeping root)
TIMOTHY•ORCHARDGRASS•ALSIKECLOVER•REDCLOVER HAYBLENDS& PASTUREBLENDS
Callforinformationabouthayorpasture establishmentandyourforagecropseed requirements SoilHealthServiceprovidedby Regen Eco Ag
SOILANALYSIS formineralbalancingandnutrientavailability (basedonWilliamA.Albrechtprinciples)
COMPLETESOILAMENDMENT andnutrient recommendations (basedonlabanalysisandover45yearsoffielddata)
ENHANCEDSOILMICROBIOLOGY•ENHANCEDCROPHEALTH Suppliersof MARL, ahighqualitycalciumsourcethatis amoreefficientandsoil-readynutrientoptiontoagriculturallimestone
• Perennial ryegrass (PRG) is the most used grass globally. Varieties are bred for either turf or forage use but the majority of usage is for turf.
• PRG seed grown in the Peace Region is generally US varieties contracted with Peace Region companies.
• Contracts with growers are generally for one year. A second year of production is ONLY suggested in wet spring conditions.
• Fits well in annual cropping rotations as it can be seeded with an annual crop, harvested the following year and then taken out of rotation and back into annual crop. There is no lost year for establishing PRG.
• Peace Region Average Seed Yields: 600 lbs/acre with a range of 200 to 1200 lbs/acre.
• PRG does well on a wide range of soils but does best on high fertile fields and in areas that have above average precipitation. It requires good precipitation in spring and summer for highest yields.
• Fields should be as clean as possible of weeds such as quackgrass, wildcats, foxtail barley, volunteer brome, Canada thistle.
• Pre or post-harvest glyphosate must be done on the field prior to seeding and preferably multiple years before planting.
• PRG is seeded with glufosinate tolerant canola or wheat. The majority of fields are now established with glufosinate tolerant canola and is the preferred establishment system. PRG can tolerate a single application of most rates of glufosinate. Two in-crop applications of 1.35 L/acre of glufosinate (150g/L) may result in some damage. Perennial
ryegrass can also be seeded in mid July to early August on fallow.
• PRG is generally seeded in the same row as canola but has seen successful stand establishment by broadcasting and harrowing prior to seeding the canola. This system provides more ground cover than seeding in rows.
• Seeding rates are typically 12 to 15 lbs/acre.
• Pre-seed glyphosate applications at a minimum of .540 ai kg/acre to manage perennial grassy weeds.
• Rolling is recommended if rocks are present.
• Straight combining canola is generally the preferred harvest method but swathing can be done assuming the swaths do not remain in the field for an extended period of time. Saflufenacil can be applied as a desicant to canola for straight combining and not affect the ryegrass. Leave canola stubble tall - at least 10" high for snow retention.
• Straw/chaff must be spread uniformly across the field.
• Assess establishment prior to winter and again in the spring. PRG can be slow to green up and should be given until the third week of May to make a final assessment. Winter or early spring injury to PRG can occur in some years.
• Spring application works well but some growers prefer to fertilize in the fall. PRG responds well to nitrogen fertilizer. Rates vary from 70 to 100 lbs/ acre of nitrogen. Sulphur should be applied at 15Ibs/ac. Phosphorus and potassium applications should be based off soil test results.
• Grassy Weed Control: Fenoxaprop-p-ethyl is only herbicide option for wildcat control. There
are no options for suppression of foxtail barley or quackgrass.
• Broadleaved Weed Control: Active ingredients in mixtures that are safely used are MCPA ester, fluroxypyr, florasulam, clopyralid, pyrasofotole and bromoxynil
• Trinexapac-ethyl (Moddus) is distributed by Syngenta and registered for use on PRG. PRG is very responsive to Moddus but should only be considered on stands with high seed yield potential. Research trials are being conducted to evaluate the use of Moddus on PRG stands in the Peace Region.
• Swathing is generally the second week of August but on dry years as early as the last week of July or first week of August. The best method to determine when to swath is to hand thrash seeds from heads that have been picked across the field. Swath when seed moisture is in the 38-42% range. PRG can shatter easily. Swathing early in the morning or late at night is recommended. If high amounts of material are present swath 20 ft or less. This helps with drying especially if rain falls on the swaths.
• Combining is generally recommended a week after swathing but depends on weather conditions and size of swath. Seed moisture at combining should be 11% or lower. Aeration is recommended to reduce heat and moisture. PRG handles easily.
• The outside swath of the field should be combined and stored separately from the rest of the field. This reduces the risk of quackgrass and/or bromegrass seed being present in the main seed lot which reduces grade and price.
• Stands are sprayed out with glyphosate and either worked or left to direct seed peas or canola the following year. PRG volunteers but there are several in-crop herbicides that can be used to manage volunteer PRG in annual crops.
Funded by: All the forage seed levy paying growers in Alberta and British Columbia and matching funds from the AAFC AgriScience Program and Results Driven Agriculture Research (ROAR). The Seed Head is published by Peace Region Forage Seed Association. For detailed report visit our website: peaceforageseed.ca NH
SARDA Ag Research
SARDA Ag Research is pleased to introduce the newest member of its team, Agronomist Denys Solskyi.
Denys joined the team in February as a Field Researcher, and he brings a wealth of experience with him to help conduct and facilitate research projects for SARDA.
“It all happened unexpectedly,” says Denys of his move to SARDA. “For the last two years I was farming cranberries in the lower mainland in Delta, and I got a call from Endali, one of SARDA’s employees, notifying me that they had an opening.”
Denys says he was excited to learn about the position as it was a good fit for the education he completed at the University of Saskatchewan, where he had experience in crop physiology and nutrient efficiency research. Denys’s education began in Ukraine at the National University of Life and Environmental Science where he earned a Bachelor of Science Degree in
Agronomy and then he completed his Master of Science in Agriculture at the University of Saskatchewan.
“It’s an interesting opportunity and closer to what I have my university education in,” says Denys of his new position. “I’m happy to be back in an area that has four seasons, I really missed the snow.”
Denys was born in Kyiv, Ukraine, but when he was three years old his family moved to a small city just outside the capital. He moved to Canada in September 2018 for English as a second language as a 10-week course, while he was improving his language skills at the University of Saskatchewan, he met his future supervisor that helped to get Denys into the master’s program.
“I have a master’s in crop physiology,” says Denys. “I did experiments and wrote a thesis on nitrogenuse efficiency use in Canola. For five years I did that in Saskatoon.”
Denys feels his transition to the Smoky River Region
and SARDA is a perfect fit for his background and he looks forward to hitting the ground running with research projects in the summer.
He adds that agriculture is a prominent career choice in his family, his Paternal Grandmother was on agricultural boards in Soviet Union, and his father runs a Ukrainian branch of a Dutch company that sells horticulture seeds. Denys also says he travelled throughout Ukraine with his father, observing different farms and agricultural operations since he was a little kid.
“I love nature and being outside,” says Denys. “I already saw an aurora and I’m glad I got to see it.”
Denys says he’s excited to learn his new job in upcoming months and he’s eager to be part of the team at SARDA. He says he’s eager to help implement and manage the various projects that will be done at SARDA in the future. NH
A new program funded by the Sustainable Canadian Agricultural Partnership will encourage veterinary students to work and stay in rural Alberta.
Agri-News, March 12, 2026
The two-year, $250,000 Veterinary Student Recruitment and Retention Pilot Grant Program is aimed at enticing rural practices to hire summer veterinary students and encouraging students to continue their careers in those communities. The program focuses on practices that provide livestock veterinary services and have a current or anticipated veterinarian vacancy.
Albertans need vets they can rely on in all corners of the province. The demand is especially high in rural communities, where veterinary access is essential to livestock producers’ livelihoods.
“Alberta’s ranchers take the health and well being of their livestock seriously, and veterinarians in rural communities are an essential part of their operations. This program helps vets plant roots and helps producers do what they do best – providing safe, high-quality food while building the rural communities that help drive Canada’s economy” Heath MacDonald, federal Minister of Agriculture and Agri-Food
“We understand the urgency of the veterinary shortage in Alberta. Rural and mixed-practice veterinarians are essential to the well-being of our livestock and the sustainability of our agriculture sector. By investing in veterinary students, we are investing in the future of Alberta’s agriculture industry. More trained vets in
Alberta means we are one step closer to ensuring every livestock producer has reliable access to veterinary care for their animals, and we can continue to be world leaders in animal health and food safety.” RJ Sigurdson, Minister of Agriculture and Irrigation
Rural vet clinics can apply now for the pilot grant program. Eligible clinics will receive up to $10,000 as a wage incentive for one veterinary student who works at the clinic between May 1 and Aug. 31, 2026. Applications for 2027 will open next year.
“Investing in veterinary students today is an investment in the future of rural veterinary care. Helping rural practices to provide meaningful, hands-on experiences to our students will result in lasting connections and strengthen a resilient veterinary workforce that Alberta can rely on for years to come.” Renate Weller, dean, University of Calgary Faculty of Veterinary Medicine
“Rural Alberta depends on accessible, quality veterinary care. Creating meaningful opportunities for students in rural practice helps build lasting connections and supports a strong, sustainable workforce. This is an important step toward addressing the veterinary shortage where it’s felt most." Dr. Jami Frederick, president, Alberta Veterinary Medical Association
Sustainable CAP is a five-year (2023-28), $3.5-billion investment by federal, provincial and territorial governments to strengthen competitiveness, innovation and resiliency in Canada’s agriculture, agri-food and agri-based products sector. This includes $1 billion in federal programs and activities and $2.5 billion that is cost-shared 60 per cent federally and 40 per cent provincially/territorially for programs that are designed and delivered by provinces and territories.
• In 2021, the Alberta Veterinary Medical Association and Alberta Veterinary Technologist Association released a report on veterinary workforce shortages, highlighting a significant shortage in the veterinary professions.
• While the provincial job vacancy rate is about three per cent, the report quoted a provincial vacancy rate of almost 17 per cent for veterinarian positions, rising to nearly 19 per cent in rural areas.
• Based on current attrition rates and growing demand for veterinary services, the report estimates a need for more than 1,600 new veterinarians by 2035. NH
Brandl Cattle Co.
Bryron & Gwen Brandl, Jarvie, AB Kailey, Wynton & Landon Brandl Byron 780-349-1765 Gwen 780-349-1704
Broken Stick Ranch
Black Angus for Sale off the Farm
Tom & Amber Ditner, Baldonnel, BC 250-794-7105
Evans Cattle Company
Glyn & Stephanie Evans, Doe River, BC 250-467-2275
Excel Ranches
Ron & Barb Miller, Westlock, AB Cody & Amy Miller, Westlock, AB 780-349-0644
Fourth Creek Angus Ranch
Ryan Lacey & Lucie Coche, Spirit River, AB Ryan 780-864-7753 Lucie 780-517-3507
GRA-TAN Farm
Grant & Tanya Chittick, Mayerthorpe, AB 780-284-0684
Crystal Chittick, Mayerthorpe, AB 780-204-2005
GRA-TAN Farm
Grant & Tanya Chittick, Mayerthorpe, AB 780-284-0684
Crystal Chittick, Mayerthorpe, AB 780-204-2005
Harvest Angus
Tom & Carolyn Dewaal, Prince George, BC 250-960-0022 | 250-562-5200
Heart Valley Angus
Nat Tschetter & Chris Tschetter Wanham, AB 780-978-6407 / 780-978-6406
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Kjos Black Angus
Marty & Miriam Kjos, Fort St. John, B.C. 250-787-0970
Kleskun Lake Farm
Brady Fraser, Sexsmith, AB 780-505-1734
Lakeroad Black Angus
Jim & Donna Rowe, Worsley, AB Jim 780-835-0455 | Donna 780-835-9588
Lazy B Livestock
Trevor Binks & Melanie Klassen Grande Prairie, AB Trevor 780-518-0630 Melanie 780-518-0230
Lazy S Ranch
Stewart Ainsworth, Mayerthorpe, AB 780-785-3136 or 780-786-4150
M.C. Quantock
Mac & Pat Creech, Lloydminster, AB 800-561-2855
Northway Cattle Co.
Hwy 64 & RR 94.5, Cleardale, AB Albert 780-834-7055 Peter 780-835-8291
Sorensen Cattle Co.
Murray & Nicole Sorensen Teepee Creek, AB Murray 780-831-6332 Nicole 780-832-1189
Towaw Cattle Co.
Kirk & Jill Wildman, Sangudo, AB 780-305-1661 | 780-305-1146
Dave & Gail Wildman, Sangudo, AB 780-305-1145
Willow Creek Simmentals
Mike & Mari Klassen, Crooked Creek, AB Colby&Tiffany Klassen,Crooked Creek, AB Mike 780-832-7343 Colby 780-832-6714
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Pinnacle View Limousin
Rob & Cheryl Swaan, Quesnel, BC
Erin & Eric Kishkan, Quesnel, BC Erin 250-991-6654
Rosebud Creek Charolais
Dan & Holly Schleppe, Dawson Creek, BC 250-786-5698/250-219-5698
Schweitzer Ranch
Troy & Kristina Schweitzer Dawson Creek, BC Troy 780-814-3598 | Kristina 250-219-4429
RaisingQualityCharolaisCattletomeet theneedsofthe Commercial Industry!
8WAY CHAROLAIS
Nikki,Kristin,Whitney& CourtneyDrschiwiski Box18,CecilLake,BCV0C1G0 Ph:250-785 -6362
Cell:250-261-0876(Nikki) Cell:250-329-4816(Courtney eightway@pris.ca wanderlust_blues@yahoo.ca )
Blondie Cattle Co.
Montana Fogle, High Prairie, AB 780-402-4009
Dry Creek Ranch
Seth Harmon, Cecil Lake, BC 250-793-1858
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
JayDawn Farms
Jason & Nikki McQuaig, Sexsmith, AB 780-933-5530
KSL Simmentals
Keegan Scorgie & Brad Smith Beaverlodge, AB Keegan 780-518-6572 | Brad 587-202-0254
Landaker Charolais Farm
Alan & Shirley Landaker, Brownvale, AB 780-618-3928
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Jonomn Hereford Ranch
Norm & Joanne Parrent, Clyde, AB 780-307-6586 | 780-348-5835 Mike Grimmeyer, Clyde, AB 780-307-3385
M.C. Quantock
Mac & Pat Creech, lloydminster, AB 800-561-2855
Rachido Ranch
Randy & Donna Chittick, Mayerthorpe, AB 780-674-1986
Reber's Polled Herefords
Serena & Kasey Reber, Woking, AB 780-518-2643
Whiskey Jack Black Herefords & Simmentals
Tamara & Darcy Kuriga, Whitelaw, AB 780-834-7108
Dry Creek Ranch
Gordon & Carla Harmon, Cecil Lake, BC 250-793-2384
Excel Ranches
Ron & Barb Miller, Westlock, AB Cody & Amy Miller, Westlock, AB 780-349-0644
Hillview Farms
Sturgeon County, AB Raymond & Corine Verbeek 780-982-2176 | 780-939-2173
Colin & Tessa Verbeek Colin 780-982-1676 | Tessa 403-636-1066
Pinnacle View Limousin
Rob & Cheryl Swaan, Quesnel, BC Erin & Eric Kishkan, Quesnel, BC Erin 250-991-6654
Barrhead Feeder Association Ltd. Barrhead, AB | Office: 780-674-2456 office@barrheadfeeders.ca
Grande Prairie Feeders' Association Ltd. Grande Prairie, AB | Office: 780-538-1263 gpfeeders@gmail.com
North Peace Feeder Association Ltd. Berwyn, AB | Office: 780-338-2270 barhm@abnorth.com
Prairie River Feeders Co-op Ltd. High Prairie, AB | 780-523-8888 prfc@telus.net
Westlock Feeders Association Ltd. Westlock, AB | 780-348-5850 westlockfeedersassociation@hotmail.com
B.C. Breeder & Feeder Association Quesnel, BC | Office: 250-992-8483 bearvlly@telus.net
Central Interior Feeders Co-operative Assn Vanderhoof, BC | Office: 250-567-2049 audreycifca@gmail.com
North Peace BC Feeder Co-operative Dawson Creek, BC | Office: 250-782-8911 pcc@neonet.bc.ca
North Peace B.C. Bred Heifer Association South Peace Bred Heifer Association Dawson Creek, BC | Office: 250-782-6272 pcc@neonet.ca.ca
Jennings Martin Direct Buying
La Glace, Alberta
Jennings Martin 780-933-1023
Thorsby Stockyards Inc.
Thorsby, Alberta Office 780-789-3915
Chance 403-358-0456 | Jeff 780-203-4953
VJV Livestock Marketing Group
Dawson Creek, BC Office: 250-782-3766
Beaverlodge, AB Office: 780-354-2423
Yancy Crosier 403-485-0887
VJV Livestock Marketing Group Westlock, AB Office: 780-349-3153
Travis Sekura 780-621-6841
VJV Livestock Marketing Group Ponoka, AB Office: 403-783-5561
Craig Jacklin 403-783-1453
VJV Livestock Marketing Group Rimbey, AB Office: 403-843-2439
Dean Edge 403-704-0280
Wembley Livestock Exchange
Glen Mayer & Nolan Mayer, Wembley, AB
Glen 780-897-9570 | Nolan 780-518-0709
•
HomeofPolled&Horned 100%FullBlood&PurebredFleckvieh
Yearling&2-Year-OldBulls&Heifers forSaleoffthe Farm by Private Treaty
Elden&EinarBakkehaug Box156,Hythe,ABT0H2C0
Blazin" J Simmentals
Darcy & Caitlyn Lind, Sunset House, AB D 780-536-5203 / C 780-552-4934
M J Simmentals
Joe & Marianne Gingles, Beaverlodge, AB Joe 780-354-8842 | Cell 780-814-2567
Montagneouse Creek Simmentals
Blondie Cattle Co.
Montana Fogle, High Prairie, AB 780-402-4009
Clarkson Valley Simmentals
Kyle & Ashley Klassen, Crooked Creek, AB 780-933-8605
Call/Text (780)518-3536 Home (780)356-2113 99221227feb26
SimmentalCattleQuarterHorse
Clearwater Simmentals
Chad Smith, Olds, AB 403-586-4714
Herman & Mark Giesbrecht, Worsley, AB 780-772-0488
Polar Farms
Joe, Lindsey, Riley & Kendal Loomis
Peace River Regional District, BC 250-784-5150
Rachido Ranch
Randy & Donna Chittick, Mayerthorpe, AB 780-674-1986
Yearlingand 2yr. oldBullsforSalebyPrivate Treaty Box238, FAIRVIEW,ALBERTA TOH1LO
Norbert& JaniceLuken 780-835-3165 Email:njluken6@gmail.com
Crystal Springs Ranch
Eckbert & Crystal Weitzel
Georg & Sarah Weitzel Charlie Lake, BC 250-263-8237
D.A.M. Livestock Ltd.
David Michalchuk, Keg River, AB 780-987-0938
GB Farms
Rosefield Simmentals
James & Martha Wiebe, Prespatou, BC 250-630-2621
Short Grass Farms
Kurtis & Chelsie Dillabough, DeBolt, AB 780-402-9578
Sorenson Cattle Co.
Murray & Nicole Sorenson
Chet &Jamie Jans
Box223,Groundbirch,BCV0C1T0
QualitySimmental BreedingStock
Call/Text250.219.8200 info@fallentimberfarms.com www.fallentimberfarms.com 98846313mar26
Garrett Biggelaar, Lacombe, AB 403-877-7661
Harvest Angus
Tom & Carolyn Dewaal, Prince George, BC 250-960-0022 | 250-562-5200
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Teepee Creek, AB
Murray 780-831-6332 Nicole 780-832-1189
Southpaw Cattle Company
Ron & Tammy Daley, Carstairs, AB
Brandon & Shallaine Sharpe, Carstairs, AB 403-519-3401
Swantewitt & Sage Simmentals
Yellowhead County, AB
Gerd 780-712-2096
Jordan 780-712-3600
Red& Black Purebred Simmental Seedstock
WillowCreekSimmentals| CrookedCreek,AB
KIN-KIN Cattle Co.
Gary & Faye Chittick, Mayerthorpe, AB 780-786-4500
KMR Simmentals
WillowCreek Simmentals| Mike &MariKlassen |(780)832-7343 Colby& TiffanyKlassen |(780)832-6714 willowcreeksimmentals@gmail.com 989440
Albrecht Farms
Steve & Tammy Albrecht, Sprit River, AB 780-832-0883
Ryan & Tara Albrecht, Spirit River, AB 780-933-5448
Kent & Robin Malcomson, Grovedale, AB 587-298-5404
Kruger Farms
Ryan & Chelsea Kruger, Sundre, AB 403-586-0125
KSL Simmentals
Keegan Scorgie & Brad Smith Beaverlodge, AB Keegan 780-518-6572 | Brad 587-202-0254
Lazy S Ranch
Stewart Ainsworth, Mayerthorpe, AB 780-785-3136 or 780-786-4150
M.C. Quantock
Mac & Pat Creech, Lloydminster, AB 800-561-2855
Tri K Cattle
Beaverlodge, AB
Keiran Hodges 780-933-5637
Keith Hodges 780-831-7999
Whiskey Jack Black Herefords & Simmentals
Tamara & Darcy Kuriga, Whitelaw, AB 780-834-7108
Willowdale Simmentals
Dale & Judy Smith and Family
Valleyview, AB
Dale 780-558-9337 | Kent 780-721-1109
Wolfe Farms
Tony Wolfe, Valleyview, AB 780-524-9322
Wolfe Lake Farms Inc.
Olin Rosvold, La Glace, AB 780-518-1997
Wolfes Fleckvieh
Shane & Shannon Wolfe, Sundre, AB 403-556-0729
TUESDAY S WEEKLY Office(250)782-3766 Fax:(250)782-6622 dawson@vjvauction.com
THURSDAY S WEEKLY Office (780)354-2423 Fax(780)354-2420 beaverlodge@vjvauction.com
THURSDAY S WEEKLY Office (780)349-3153 Fax(780)349-5466 westlock@vjvauction.com
WEDNESDAY S WEEKLY Office (403)783-5561 Fax(403)783-4120 office@vjvauction.com
$765.00$825.00$730.00$845.00$790.00$825.00$740.00$800.00$700.00$800.00n/an/a$730.00$835.00n/an/a$775.00$882.00
$720.00$768.00$720.00$805.00$735.00$815.00$720.00$789.00$710.00$795.00$700.00$815.00$700.00$800.00$660.00$750.00$735.00$800.00 500-599
600-699
700-799
800-899
$650.00$737.00$660.00$749.00$655.00$743.00$670.00$735.00$660.00$742.00$560.00$690.00$647.00$743.00$570.00$720.00$650.00$742.50
$590.00$649.00$590.00$654.00$595.00$647.00$610.00$685.00$590.00$657.00$533.00$641.00$525.00$620.00$530.00$663.00$600.00$674.00
$510.00$581.00$549.00$603.00$540.00$594.00$525.00$591.00$540.00$600.00$539.00$580.00$500.00$594.00$515.00$601.00$520.00$605.00
$485.00$527.00$480.00$522.00$480.00$521.00$480.00$512.00$490.00$520.00$465.00$512.00$468.00$505.00$475.00$526.50$475.00$514.00 900-999 $430.00$459.00$430.00
500-599
$620.00$672.00$610.00$695.00$620.00$684.00$590.00$547.00$610.00$672.00$572.00$655.00$569.00$655.00$570.00$640.00$575.00$690.00
600-699$550.00$622.00$560.00$607.00$560.00$629.00$555.00$600.00$550.00$603.00$544.00$586.00$540.00$604.00$500.00$602.50$560.00$622.00
700-799
$480.00$550.00$480.00$559.00$480.00$557.00$490.00$551.00$500.00$557.00$460.00$528.00$475.00$525.00$450.00$524.50$480.00$558.50
800-899 $445.00$475.00$430.00$477.00$440.00$478.00$430.00$458.00$440.00$472.00$339.00$435.00$440.00$499.00$425.00$507.00$435.00$523.00 900-999$400.00$429.00$409.00$429.00$410.00$441.00$410.00$427.00$390.00$435.00$360.00$405.00n/an/a$390.00$422.00$400.00$482.50 1000+$390.00$410.00$385.00$401.00$380.00$400.00$370.00$400.00$340.00$389.00$340.00$415.00n/an/a$340.00$392.00$365.00$439.25
D1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 Cows
$225.00$242.00$227.00$246.00$210.00$240.00$225.00$242.00$220.00$247.00$230.00$255.00$230.00$255.00$235.00$250.00$235.00$250.00
D3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 Cows
$190.00$224.00$190.00$225.00$190.00$214.00$190.00$225.00$190.00$325.00$209.00$229.00$210.00$233.00$210.00$235.00$210.00$234.00 Heiferettes Heiferettes Heiferettes HeiferettesHeiferettesHeiferettesHeiferettes
Tues,Mar31st -10:00a.m. Tues, Apr7th -10:00a.m. Tues, Apr14th -10:00a.m. Tues, Apr21st -10:00a.m. Tues, Apr28th -10:00a.m.
Dawson Creek 4-in-1 Sale Sat, Apr25–11:00a.m.
Thurs, Apr2nd -10:00a.m. Thurs, Apr9th -10:00a.m. Thurs, Apr16th -10:00a.m. Thurs, Apr23rd -10:00a.m. Thurs, Apr30th -10:00a.m. Wed, Apr1st -9:00a.m. Wed, Apr8th -9:00a.m. Wed, Apr15th -9:00a.m. Wed, Apr22nd -9:00a.m. Wed, Apr29th -9:00a.m.
Peace Country SimmentalBull Sale Mon, Mar30–1:00 p.m.
Horse, SmallAnimal Sheep&Goat Sales 10:00a.m. Saturday, April11th Saturday, May9th Saturday, June13th
Thurs, Apr2nd -9:00a.m. Thurs, Apr9th -9:00a.m. Thurs, Apr16th -9:00a.m. Thurs, Apr23rd -9:00a.m. Thurs, Apr30th -9:00a.m.
.70FTMorrisQuantum air drill with .12”spacing4”pairrow boots .doubleshootseedandfert .5”semi-pneupackers. .Full blockagemonitors eachrun .seed&Fert.Mudscrapers. .Stainlesssteeltubing and .manifolds. Highflotation tires .Individual shank depth. 9800ICTMorrisTank Sectional control (7 sections) .4Tanks 800buTowBehind DualFan.Seedfan andfert fan
20115354wdVersatile535hp 16x4CatP/Stran,QSX15LCummins 850/60R38dualtires,80gpmhydpump, 6E hyd remotes1-3/4”retur n,difflock Deluxe, Cab leatherseat, Radar, Frtwts ONLY 2911 HRS Blow-Out $ 295,000 Trimble GPS CALL780.864.8582
..800/70R38singlefronttires .800/70R38dualreartires .12”loading conveyor withremote .Stainlesssteel meteringsystem .Operating .Ran with a TopCon x35display .HasextraMasterswitches .Blockagemonitorsystemis .intelligentAg.ranwith iPad 70’UnitBlow-Out$320,000 CALL780.864.8582For70’AirDrill
New246204wdVersatile665hp@1900rpm 16x4CatP/Stranrev-fantowcable900/60 R42 tire110gpmpump6E hyd remote3/4” returndifflock PTO Deluxe,suspCabRadar,Jake BrakeV6700A/S/R Isobus,Rcamera#s852615 wt61,250 msrp$995,000 Blow-Out$895,000
New 10Series s9m5729 820 bu,4 Tanks80bu,250,bu,135bu,355bu,+ Tank LOADCellsdualfans, TopConXD+monitor5m3397duals4-900/60R42ConveyAllConveyorSectControl+70’QuantumAirDrill12”Spacingpairedrowdbl shoot3RowPacker7m5332820buCart$545,000+70’Quantum$450,000= msrp$995,000 Blow-out$795,000
Shanks 11/4”Wideby6”deep,by 44”talland madeofhigh-carbon steelforlongtermuse.Penetrate from 12”-18”.Recommended 30-50 HPper shank 11shanks Pricedwith bolt on 22” reversible wearbar
Since the first Blue-Jetin1980this narrow1 1/4” shanksubtillerhasfracturedcompactedsubsoilwith verylowdisturbanceatthesurface,butdoes avery good job offracturing hardpan 14”-18”deeptoretain water and increaseyields
Mar14/26(prel)Mar07/26(prel)Mar15/25
52,54453,63858,463
10,80511,96012,554 WEST 41,73941,67845,909 WEEKEND Mar21/26 (est)Mar14/26 (est)Mar22/25 US 495,000508,000540,000 CANADIAN CATTLEGRADES WEEKEND Mar14/26Mar07/26Mar15/25
40,61740,41745,826
221208
Mar14/26Mar07/26Mar15/25
Mar14/26(prel)Mar07/26(prel)Mar15/25
400-499
500-599
600-699
700-799
800-899
$750.00$850.00$750.00$842.00
$700.00$771.00$700.00$795.00
$620.00$670.00$610.00$680.00
$500.00$593.00$515.00$593.00
$450.00$520.00$450.00$522.00
900-999 $410.00$479.00$410.00$479.00
1,000+ N/AN/AN/AN/A FEEDERHEIFERS
300-399
400-499
500-599
$600.00$750.00$650.00$750.00
$625.00$725.00$625.00$725.00
$600.00$690.00$615.00$705.00
600-699 $525.00$612.00$520.00$607.00
700-799 $425.00$515.00$450.00$522.00
800-899 $400.00$530.00$400.00$503.00 900-999 $350.00$420.00$375.00$430.00
1,000+ N/AN/AN/AN/A SLAUGHTER CATTLE D1-D2 COWSD1-D2 COWS
$220.00$267.00$220.00$251.00 D3 COWS D3 COWS
$190.00$225.00$190.00$220.00
SLAUGHTERBULLSSLAUGHTERBULLS
$230.00$265.00$225.00$265.00
D1-D2 COWSD1-D2 COWS $220.00$245.00$220.00$255.00 D3-D4 COWSD3-D4 COWS $170.00$220.00$170.00$219.00
$220.00$265.00$210.00$271.00
Highway43andRangeRoad91, Wembley,AB Ph:(780)766-2887 |Fax:(780)766-3751 admin@cassityequipment.comIwww.cassityequipment.com
REG
-9:00a.m.
REG– Mon,Apr6th –NOSALE
REG– Mon,Apr13th -9:00a.m REG– Mon,Apr20th –9:00a.m
REG– Mon,Apr27th -9:00a.m RANCHMAN’SBULLSALE IN CONJUNCTIONWITHREG SALE
REG– Mon,May4th -9:00a.m
REG– Mon,May11th -9:00a.m.
JenningsMartinCattleBuyingwillbethereforyouandyouroperation asyouprepareforyour2026springandsummermarketing.Andwhilenotwo yearsseem to bethesame, Iremaincommittedtocontinueoffering fairprices whileproviding astress-freeenvironmentforbothyouandyourcattle. Our facilit yinLaGlacecontinues to remainopen,buyingallclassesofbulls, cows, steersandheifers,savingyoutheneed forshipping to localorsouthernmarkets.
CheckoutourFacebook Page forWeekly Updates
Callus todayandmaximizeyourSpring &Summersaleopportunities BUILDING FORSUCCESS| WORKINGWITHINTEGRITY
Agri-News,
The Water Amendment Act updates the Water Act for the first time in more than 25 years and is a forward-looking piece of legislation that balances the needs of Albertans, the environment and the economy. The act keeps the strong foundation of Alberta’s water management system in place while
modernizing the rules and processes to better meet the needs of our growing population and economy. Passed in the legislature in fall 2025, amendments to the Water Act will come into effect March 11. The proclamation of these amendments implements a series of common-sense changes that will cut red tape,
improve transparency and better meet the needs of farmers, ranchers, businesses and communities, while still maintaining the strong environmental protections that Albertans expect.
Clear, simple rules and streamlined processes will help farmers, ranchers and others more easily amend their licences and consolidate allocations under a single licence, while still making sure other water users and the environment are not negatively impacted. This flexibility makes it easier to adapt to conditions on the ground and effectively access and use of water.
“For too long we’ve put up with outdated and unnecessary rules that no longer make sense. Starting today, Alberta’s water management system is more practical and modern, with less red tape to slow down the good work of Albertans. I’d like to thank the previous minister, Rebecca Schulz, for leading this transition and doing so much work to get us to this point.” Grant Hunter, Minister of Environment and Protected Areas
The Water Amendment Act removes barriers and improves processes associated with water licensing, making it easier to access and use water.
“These amendments will provide municipalities with the resources and tools they need to support their
communities. By reducing unnecessary red tape, we will save time and taxpayer money. Enhancing reuse applications will enable further cost savings and new revenue streams.” Josh Bishop, reeve, Wetaskiwin County Water use in Alberta will be more transparent than ever, thanks to amendments that allow the government to set consistent measurement and reporting expectations for all licence holders. The detailed requirements for measuring and reporting water use will be informed through upcoming discussions with water licence holders. Alberta’s government will also develop policy to establish how any prices paid for water as part of a licence transfer will be reported in the future.
“Amending the Water Act has improved access to water and streamlined certain processes, especially for users with multiple licences, like irrigation districts, which will improve reporting and strengthen transparency in water use.” Richard Phillips, chair, Alberta Irrigation Districts Association
Alberta was the only province in Canada to require inter-basin transfer decisions to be authorized
through a special act of the legislature. Now, a new category of lower risk inter-basin transfers can be approved through a ministerial order. Only transfers that meet strict environmental standards and limits are eligible under this lower risk category. Any proposed inter-basin transfer that does not meet these standards will continue to require a special act of the legislature.
The amendments also enable communities and others to collect rainwater from rooftops and reuse wastewater. This improves conservation and increases water reuse for municipalities, industry and others.
“Defining rainwater and considering water recycling and reuse are important to our operations. At Big Marble Farms, we are Always Growing™ fresh, local vegetables year-round, and to remain competitive we must use all resources efficiently.” Ryan Cramer, CEO, Big Marble Farms
• The Water Amendment Act is the first major update to Alberta’s Water Act since 1999.
• The legislation was introduced on Oct. 30,2025, following extensive public engagement.
• Alberta’s water licence priority system, based on first-in-time, first-in-right, remains unchanged.
• Royalties, bulk or volumetric pricing of water are not included in these amendments.
• Environment and Protected Areas will engage water users and licensees to establish and implement standards for water use measurement and reporting. Most large water users already have measurement systems in place to measure water use in their operations. Low- and no-cost options will be available for water users. Reporting will be made public.
• Seven inter-basin transfers have been approved since the Water Act was introduced in 1999, and five are in place today. All are for drinking water and municipal wastewater systems.
• The Water for Life strategy and its goals remain in place. NH
lberta wheat and barley farmers who pay check-off through Alberta Grains and do not request a refund are eligible for a 26 per cent tax credit through the Scientific Research and Experimental Development Fund (SR&ED) program for their investment in wheat and barley research and development (R&D) projects. For example, farmers
who paid $100 in check-off on their wheat or barley in 2025 would earn $26 in tax credit.
The federal SR&ED program encourages R&D investment through tax-based incentives, giving claimants tax credits for their expenditures on eligible R&D work. The tax credit percentage is based on the amount invested in R&D that meets the criteria laid out by the Canada Revenue Agency (CRA).
Farm individuals should use form T2038 (IND) to claim this credit when filing taxes, while farm corporations must use form T2SCH31.
For more information, contact the Canada Revenue Agency directly, or visit the CRA website.
Producers who have requested a refund of their check-off are not eligible for the tax credit. NH
•P owerfulTier4-compliantdieselengine
• Easy-lifthoodwit hd ualgas-charge dl if ts truts
•P remiumoperatorstationw/ergonomi cs eat,armrests &L EDlight s
•S ingl ep ointloaderconne c tionan de asilyconnectandremovebackhoe
• Quickl ya ndeasilychangespee da nddirectionwithTwinTouchfoot c ontrolsan dH ydrostatictransmission(HST)
• AutoConnect™ m id-mowe rd ec ki nstalls/remove sinl es st ha n5m ins
*Offervalidwith20%ofpurchasepricedown.Loadersarefactor yinstalled.Itemsmay notbeexactlyasshown,accessories,attachments,andimplementscostextra.Taxes,set-up, deliver ychargesnotincluded.PricesarebasedontheUSexchangeandmaybesubjecttochange. Adocumentationfeeofupto$349willbeappliedtoallfinanceofferings.Additionalfees may apply. Programsandpricessubjecttochangewithoutnotice. SeePrairieCoastequipmentforfulldetails.Somerestrictionsapply.OffervaliduntilApril30,2026whilesupplieslast. Financingonapproved John DeereFinancialcreditonly.Limitedtimeofferwhichmay notbecombinedwithotheroffers.QID#335733641025Rw/loader,QID#33573380withTLB.
VJV in Dawson Creek played host to the Bull Power Sale which brought together the programs from 8-Way Charolais, Dry Creek Ranch, Friesen Farms, Lakeroad Black Angus, MT Ranch and Whiskey Jack Black Herefords and Simmentals. There was a full house of ready bidders, both on site and on line. And there were some good results as well. NH
41 Head on Offer – Overall Sale Average - $11,530.49
8-Way Charolais Average - $8,958.33
Dry Creek Ranch Average – $11,562.50
Friesen Farms Average - $11,557.69
Lakeroad Black Angus Average – $12,616.67
MT Ranch Average - $7,750.00
Whiskey Jack Black Herefords & Simmentals Average - $9,750.00
LOT 20 - DCR ATLAS 9M Charolais $18,000.00
LOT 5 - LAKEROAD MOTIVE 36M Black Angus $17,500.00
LOT 39 - FRIESEN TRIBUTE 55M Black Angus $16,500.00
LOT 2 - LAKEROAD SPLASH 15M Black Angus $16,000.00
LOT 59 - 8-WAY MORGAN N 32M Charolais $16,000.00
LOT 1 - LAKEROAD SPLASH 6M Black Angus $16,000.00
Troy
2008claas570r
MAVCHOPPER,OUTBACK SGPSW/STEERING, SUNNYBROOKCYLINDER,2070SEPHRS STK2448
2022Bourgault3335-76QDA &9950
2014Bourgault3320-86 &770
2012Bourgault3320-76 &6700
2009Bourgault3310-75 &6550ST
2016MorrisC2Contour &2016
Bourgault7950
2012JohnDeere1870 &1910
2012SeedHawk6012 &600
2018Bourgault6450
2023Bourgault9950
2018Bourgault7550
2016Bourgault7950
2009Bourgault6550
2014SalfordI-4141
2018Gregoire-BessonSPHRW-TZ8 2019KvernelandNG-S101F35 PowerHarrow
2024Elmer’sSuper 7HeavyHarrow
2015Bourgault7200HeavyHarrow
2008Brandt5000HeavyHarrow
2016McFarlane2070-16Harrow
2013McFarlane2060-16Harrow
2013McFarlaneHD-140-THarrow
2009Bourgault6000Harrow
2015GatesDiscHarrow
2019HorschRT28HighSpeedDisk 2011Sunflower1550Disk
2006claas580r
4WDREARAXLE,900/60R32FRONTTIRES, OUTBACKGPSSTEERING,1600SEPHRS STK1136
Auger-2019RodonoXTEND16
Auger-2013Sakundiak12-79
BaleProcessor -2018Highline2660
BaleProcessor -2015Highline 650-200
Conveyor -2022Brandt1547
Conveyor -2020Meridian20-110
Conveyor -2014Batco1545
GrainCart -2011J&M1326
GrappleBucket -AMIMGL150
Mower -2018KubotaZD1511LF-72
RTV-2018KubotaRTV-X1120D
RTV-2019KubotaRTV-XH850
Sprayer -2022CaseIHPatriot4440
Sprayer -2003JohnDeere4710
2002claas480r
STANDARDHOPPER,3-DSIEVE, QUANTIMETER,3715/2889HRS STK1748
2023CLAASAxion920 2018Versatile610DT (2)Versatile550(2013-2015) 2011Versatile535 1990Versatile876 2022KubotaM7-172 (2)KubotaM7-171(2016-2018) 2013KubotaBX25D 2023KubotaM6-131 2010CaseIHSteiger335 2016ChallengerMT875E 2023Deutz-Fahr6165 2012JohnDeere9560R 2018JohnDeere2032R 1986JohnDeere4650 2024JCB427AGT4FWheelLoader 2008JohnDeere328SkidSteer 2018Gerry’s40TonTrailer 2017BWS15BWS2XTrailer 2007WesternStar4900SATruck
combines
(4)CLAAS8700(2021-2023) (2)2011CLAAS770 (5)CLAAS760TT(2011-2018) (3)2013CLAAS670 2007CLAAS590R 2010CLAAS570 2012JohnDeereS690 2008NewHollandCR9060 (2)2017CaseIH8240 2008CaseIH8010 2008CaseIH2588
2022Vermeer604ProBaler 2012Vermeer605NBaler
2017KubotaBV4580Baler 2004AGCOHesston4740Baler 2014JohnDeere569Premium Baler
2001JohnDeere567Baler 2020NewHollandRollbelt560 Baler
2021JohnDeere8300Forage Harvester 2006MacDon5020MC 2020NewHolland5020MC 2019JohnDeere946MC 2018KubotaDMC7036T 2018KubotaDMC6336T 2020SchulteXH1500RotaryCutter 2000Schulte5026RotaryCutter 2010VermeerR2300Rake
headers
2023CLAASConvio1530
2021CLAASConvio1230 2013CLAASMaxflex1200 2018MacDonFD140 (2)2019MacDonFD135 (3)MacDonFD75-40(2015-2018) (3)MacDonFD75-35(2011-2017) 2012MacDonD60-40 2009MacDonD60-35 2009JohnDeere936D 2014CaseIH3162-40 2008CaseIH2020-35F 2003CaseIH2015
814076Highway 2| Office780-835-5515 FORTST.JOHN,BC 6719ElevatorRoad MCLENNAN,AB 9BousfieldAvenue |Office780-324-0305
The next generation 8-Series tractors deliver more power, improved maneuverability, and advanced technology to help farmers cover more acres
OLATHE, Kansas (Feb. 24, 2026)
John Deere (NYSE: DE) announced today the launch of six new 8R and 8RX tractor models featuring additional higher horsepower options; ground-up redesign; and improved performance, maneuverability, and versatility. The company has manufactured 8-Series tractors for over 30 years, improving this popular and versatile line of tractors based on customer input. The additional options of 440 hp, 490 hp and 540 hp extend the horsepower range available in the 8-Series tractor lineup to meet growing customer demand.
"These tractors are designed to get work done," said Michael Porter, John Deere marketing manager for large tractors. "The new horsepower options, technology, and other customer-driven changes make these tractors the ultimate planting tractor, planting up to 1,200 acres each day1 during those tight weather windows. Whether you need to plant with a 24+ row planter, pull large grain carts or midsize seeders, these new 8-Series tractor options have the productivity and technology to help with all your plant, harvest, and tillage work."
Key to any John Deere tractor experience is the technology, and these new horsepower options fit the bill. The tractors are autonomy ready to help unlock efficiency during tillage; have the G5Plus display for access to precision ag technologies such as AutoTrac™ Turn Automation, AutoTrac Implement Guidance, AutoPath™ and more; are Machine Sync ready and optional JDLink™ Boost connectivity to help ensure reliable capture of field and machine data.
The new 8R and 8RX models come with the JD14 engine, designed to provide maximum power when operators need it the most. These new 8-Series tractors elevate John Deere's Intelligent Power Management system (IPM) to new levels with the optional peak power IPM. This new option enables not only an additional 40 horsepower at rated 1900 rpm but
all the way down to max horsepower at 1700 rpm, enabling up to 634 horsepower for the most demanding applications of hydraulic, PTO, transport or electrical offboarding. This means customers will have the power when they need it.
"We have incorporated an engine brake option that helps slow down the tractor without having to rely on brakes," Porter said. "This feature provides additional stopping power and reduces wear on the primary
braking system, enhancing safety and control, especially when pulling heavy loads and driving on steep inclines, this has been a huge request for our transport customers."
The hydraulic system on these tractors includes increased pump capacity with separate steering and braking pumps. Additional updates include an enhanced Independent Link Suspension (ILS) on the front axle that supports increased carrying weight and incorporates roll control for improved road performance, now with 60KPH transport speed capability, which drives even more productivity for our transport customers. A front hitch and front PTO option is available, increasing the productivity of this tractor for all operations. The rear hitch has a 24,000-pound lift capacity to lift heavier and wider implements, and hitch active downforce maintains a constant depth with hitch-mounted implements. To help increase power to rear PTO implements, the new models have a 1,300 rpm rear PTO option.
Precision handling is a key benefit of these new tractors with a tight turn radius and Reactive Command Steering, improving maneuverability. The Reactive Command Steering means the steering wheel automatically returns to center and includes three settings
to create a customized steering experience. A new, narrow, and nimble frame maximizes maneuverability.
"Drivability is important for operators, and with these new 8-Series tractor models you no longer have to choose between power and maneuverability," Porter said. "The turning radius these tractors provide is more than 6' tighter than competitors and does not limit the power and performance."
The 8-Series tractor offers the Electric Variable Transmission (EVT) that gives farmers the ability to quickly plug in the planter and get to work. This transmission enables electric power offboarding, so operators will no longer need to worry about PTO or hydraulic power generators to power electric drive planters, but instead a simple one plug connection enables power to their planter using the tractors transmission. As part of the new updates, three new options are available for transmission controls, including CommandX™, CommandX™ Plus and CommandX™ Pro. The new controls represent a significant advancement in streamlining drive operations across John Deere's equipment portfolio. A standardized handle, paired with customizable options, delivers a consistent operating experience while allowing operators to tailor functionality to their needs. Push button start gives
operators the ability to control who can start the tractor by requiring a personalized PIN number.
Additional features that enhance the operator experience include:
• New Engine throttle controls
• New Convenience Display for easy access to adjustment of radio, air conditioning, seat, and phone controls
• Integrated wireless charging phone holder
• Two-way independent electric armrest adjustment
• Optional door cinch
Building on the model year 2025 enhancement of ground-up serviceability on our high horsepower 9RX, the engine oil, coolant and hydraulic oil sight gauges are at eye level so fluids can be quickly checked, leading to a quicker start each day. In addition, the air filter and fuel/DEF fill from the ground. The hydraulic oil interval increased from 1,500 hours to 2,000 hours, leading to more uptime. A 330° windshield wiper provides a clearer view, and battery disconnect and jumper are on the door side for better accessibility.
"The six new 8R and 8RX models are designed for today's farmers," Porter said.
"With efficiency, maneuverability and versatility, farmers know the 8-Series tractor is a business partner that helps them be more productive and efficient." NH
CROSSBRED commercial bulls, semen-tested, vet inspected, vaccinated, free delivery in Peace Country. 780-836-0117 or 780-8360552.
REGISTERED POLLED HEREFORD bulls. Sementested, vet inspected, vaccinated, free delivery in Peace Country. 780-8360117, 780-836-0552.
2 YR OLD registered red simmental bulls for sale by Private Treaty. 780-354-8842 or 780-814-2567.
16i" CALF DEHORNING tool, $40. Call/Text Doug 250-219-4139.
NEW 4 RING 2 piece round poly bale feeder, $650. Call/Text Doug 250-2194139.
LOOKING FOR A female Lassie Collie or Sheltie for farm pet. Call Jake 780-9273638.
SPEED CONTROLLED RUBBER finger chicken plucker for sale, call 780772-6544.
FOR SALE: Big horn roping saddle. Padded seat, bridle included, asking $500 OBO. Call 780-354-3435.
CANADIAN ARCOTT YEARLING ewes bred for February. Open ewe lambs, can deliver. Donald Johnston 780-837-1770.
CANADIAN ARCOTT
YEARLING ram, ram lambs for sale, can deliver. Call Donald Johnston, Donnelly, 780-837-1770.
LOOKING FOR a 1980-87 cab for International 1854 3tonne truck. Call Abe 780841-4740.
1950'S ERA FORD truck found when clearing brush. For details and pricing, call 780-772-6544.
CAT D6NLGP with ripper for hire, located in Birch Hills County. Call Eugene at 780835-0601.
MILITARY BUILT CAT D8 dozer. Includes blade & winch, taking offers. 780523-1488.
WALL FRAMING TRAILER, on wheels. Deck screws out to 8’. 780-772-6544.
2009 FORD F-350, 6.4 litre diesel, long box. Call/Text Greg, 780-5121207 or 780-538-9115. Dismantling cultivator, disc, and plows for parts. Some air drills. 780-831-6747.
2015 CHEVROLET 1500 4x4, 4 door, V8, canopy, 135,000 kms. $19,500 OBO. Call Ken 250-789-3747
1969 INTERNATIONAL GRAIN truck, wood box, hoist, motor needs work, shedded, $5000. Call/text 780-926-0981.
1975 FORD 8000 w/B&H, 6V "Jimmy" engine, 13spd transmission, not running. 780-836-2107 or 780-6189161.
LOOKING FOR AN older (70's era) single axle water truck with spray bar. 780523-1488.
LOOKING FOR A 3-horse bumper pull trailer. Call Bob 250-467-5345.
FRONTIER LL1396, 8' drawn box blade w/Scarifier, 2 yrs old, purchased new. 780-837-6457.
HTS WESTERN SNOWBLADE, like new, 7'6", fits any pickup truck. C/w all accessories. 780814-2567.
CAT D8H dozer blade for sale. Hydraulic tilt on one side. Call 780-618-9161 or 780-836-2107.
1981 HONDA 185 XL Enduro Motorbike, excellent shape, always covered, $3000. Call/Text Doug 250-2194139.
BABY GRAND PIANO for sale. For more information, call/text Jean 780-625-6793.
UPRIGHT PIANO for sale. Taking offers, For more information or pricing, call 780-772-6544.
WANTED WAFFLE IRON cast iron with five hearts. Call Ernest 780-926-9412.
10 PC HEAVY duty combination wrench set, 1” to 2 1/2”, $150. Call/Text Doug 250-219-4139.
2 TON BENCH type press, like new, $300. Call/Text Doug 250-219-4139.
30” GRASS SYTHE, $80. Call/Text Doug 250-2194139.
BENCH TOP DRILL Press, $150. Call/Text Doug 250219-4139.
NEW HAYS WIRE stretcher, $140. Call/Text Doug 250219-4139.
BUILT RIGHT SHEDS. Building quality shelters. Call John 780-835-1908 for your quote today.
LOOKING FOR 4" or 6"
250 3”-4” x 7ft fence posts for sale. $3.50 each. Call Doug 250-219-4139.
DOUBLE D FENCING avail. for your barb wire, page wire & plank fencing needs.
VALLEE FORESTRY BIG Red Portable Sawmill, undercarriage, and trailer. Call for price and details. 780-926-6087.
1800 sqft home on QTR/section, f/basement, 400 sqft upper bedroom, 1 bath. 780-971-2592 after 6PM.
LOOKING FOR PASTURE to rent for (30) pairs of cattle. Call Andrew, 780-841-5932.
LOOKING TO LEASE farmland in the GP/Sexsmith/Teepee Creek area. Contact David to discuss options. 780-9786768.
1958 FARMHOUSE TO be moved by mid-April 2026. 950 sq.ft., $30,000 OBO. 250-569-7509, Grimshaw, AB.
LAND AND BUSINESS OPPORTUNITY, remote 20 acres on pavement. Unfinished hwy lodge, gardens. Duane 250-2325400.
HONDA 300 4x4 quad for sale. Needs some work. Call 780-835-0452 or 780-6852624.
FORAGE SEED OATS. Good germination. Delivery available. Call/Text 250-7820220
WANTED: BARLEY, WHEAT and oats for feedlot. Can pickup with Super B. Gary 780-518-3992.
SMALL SQUARE BALES of barley and alfalfa for sale. Call Eugene 780-835-0601.
ORGANIC ALFALFA and Red Clover seed for sale. Call/Text Edwin 780-2854680.
16' HEAVY DUTY bale frame. Needs hitch, would make excellent bale wagon. Call 780-772-6544.
1982 JD 4440, 9970 hrs., 20.8x38 duals, c/w 12' Degelman dozer blade, $38,000. Call/text 780-9260981. GREENFEED OAT BALES for sale, 1150 lbs., no rain, put up in August, $50/bale. 403-886-2088.
WANTED: JOHN DEERE Model 80 tractor for parts. Call 780-814-0523.
STARTER & DIFFERENTIAL pinion for cockshutt 40 or 50 with Buda gas engine. Call 780-835-0601.
3/4T AUTOSTEERING bale wagon for sale. For more details and pricing call 780772-6544.
HOME BUILT 3 PTH Bale Spear, $250. Call/Text Doug 250-219-4139.
1971 UTB 65 HP 4WA, diesel, 3 new tires, 661 hrs, excellent condition, $6000, 780-971-2592.
WANTED: 4 or 5 bottom pulltype Moldboard plow. Auto Re-Set, colour doesn’t matter. Call 250-719-4967.
CASE IH CX100U, FWA, FEL/bucket, new turbo, new injector, needs clutch cable. 780-835-0452 or 780-6852624.
Beaverlodge | BeaverlodgeAgComplex(1400–5th Ave)
Tuesday|4:00p.m. to 7:30p.m.
Mar 3,10,17,24,31| Apr 7,14,21,28| May 5,12,19,26
Wednesday |11:00a.m. to 2:00p.m.
Mar 4,11,18,25| Apr 1,8,15,22,29| May 6,13,20,27
Contact:(780)354-3013orbeaverlodgemarket@gmail.com
Beaverlodge-South Peace Centennial Junc�onofHighway43andRR722
SpecialMarkets: Apr 18 |Cra� &Cri�erSale|10:00a.m. to 4:00p.m. Beaverlodge AgriPlex
May 9 |Mother ’s DayGarden Party|10:00a.m. to 4:00p.m. HytheCommunityCentre
Contact:780-978-1198orsouthpeacefm@gmail.com
Chetwynd |Carver ’s Row, Highway97
Friday |3:00p.m. to 6:00p.m.|May 15,22 Contact:(250)788-6576orcmwiddic@gmail.com
Dawson Creek |N.A.R. Park (900Alaska Avenue) Saturday |9:00a.m. to 2:00p.m.|May 2,9,16,23,30
Contact:(587)277-1476
Enilda| Women’sIns�tute Hall(WIDrive1st Ave)
Saturday|10:00a.m. to 2:00p.m.|Mar 7 |Apr 4 |May 2
Contact:(780)523-5158or enildafarmersmarket@yahoo.com
Fairview | Fairview LegionHall(10315–110th St)
Wednesday |3:30p.m. to 6:30p.m.
SpecialMarkets: April 1 |3:30p.m. to 7:00p.m. May 6 |3:30p.m. to 7:00p.m.
Contact:780-772-9557or fairviewabfarmersmarket@gmail.com
FortSt.John |SUMMERMARKET
Fes�valPlaza,Centennial Park(9523–100th Street)
Saturday |9:00a.m. to 2:00p.m.|May 2,9,16,23,30
Contact:(778)256-7971or fsjfarmersmarket@gmail.com
FortNelson|Elk’sLodge (5431–50th AvenueSouth)
Saturday |9:00a.m. to 3:00p.m.
Mar 7,14,21,28 |Apr 4,11,18,25|May 2,9,16,23,30
Contact:(250)233-3522ormanysoles@northwestel.net
GrandePrairie | TARACentre, Evergreen Park
Friday |4:00p.m. to 7:00p.m.
Mar 6,13,20,27 |Apr 3,10,17,24 |May 1,8,15,22,29
Saturday|10:00a.m. to 3:00p.m.
Mar 7,14,21,28 |Apr 4,11,18,25 |May 2,9,16,23,30
Contact:(780)978-1198orsouthpeacefm@gmail.com
HighPrairie–Marigold |4724–53rd Avenue Wednesday |12:30p.m. to 5:30p.m. Apr 1,15,29 |May 13,27
Contact:(780)523-4588
Kinuso |KinusoAgHall (1 Swan Ave) Saturdays|10:00a.m. to 2:00p.m.|May 16,30 Contact:780-775-2684or kinusofarmersmarket@gmail.com
Manning | RoyalCanadianLegion(115–3rd Ave SW) Thursday |4:00p.m. to 7:00p.m. Mar 19 |Apr 16 |May 7 SpecialMarkets: Contact:(780)836-1064
PeaceRiver | Former Peavey MartStore(9700–78St) Saturdays |10:00a.m. to 2:00p.m. Mar 7,21 |Apr 11,25 |May 9,23 Contact:PRFMarket1991@gmail.com
Rycroft | Rycro�AgCentre (5010–49th Ave) Thursday |3:00p.m. to 6:00p.m.
SpecialMarkets: Apr 4 | EasterMarket |12:00p.m. to 4:00p.m. May 9 |Mother ’s DayMarket |12:00p.m. to 4:00p.m. Contact:(780)831-8792or rycro�farmersmarket@gmail.com
Tangent | TangentCommunityHall(101–3rd Ave) Saturday |11:00a.m. to 4:00p.m.
March28- EasterMarket |April18–SpringMarket May23-FlowerMarket Contact:(780)219-5342or communityhalltangent@gmail.com
Valleyview |MemorialHall (4810-50St) Saturday |11:00a.m. to 3:00p.m. March 14,28 |April 18 |May 9
April25,2026-9amMST 2025IRC11 SHIPPING CONTAINER- 11 FT UNUSED 8FTX 12 FTSHED 2026 AGTSDA-140T MINISKID STEER 2025HQSHIPPING CONTAINER- 40FT 2010GMCACADIA SUV
UNUSED2026CFG QK20RMINIEXCAVATOR
UNUSED2026CFG MX12RMINIEXCAVATOR
UNUSED2026CFG H15RMINIEXCAVATOR
UNUSED2026CFG MH12RX MINIEXCAVATOR
WHERE DO FUTURE PEACE COUNTRY CATTLE PRODUCERS COME FROM - THEY START GOING TO BULL SALES WITH THEIR GRANDPAS
Inspectandbidonahugeselectionoffarmequipment,trucks, realestate andmore at upcomingunreserved auctions.
Forcomplete listings,scantheQR code to see ourSpring AuctionGuide,orviewinventory at rbauction.com/agriculture
Saay ,A pril25 ,2 026
9:00AMI LAMYardSite
DELIVERY DEADLINE: APRIL 11TH
2015KenworthT800Tri-DriveTruckTractor •2012KenworthT800Tri-DriveTruckTractor •2018KenworthW900BT/ATruck Tractor •2013JohnDeere250GLCExcavatorHoe •1998 Challenger75ECrawlerTractor• 1991 ChallengerCH75Crawler Tractor• 1981Case2290 2wdTractor •2008LoadLineTridemClam DumpGravelTrailer• 1996 ArrowTridemHayrackLog Trailer •TandemLowBedEquipmentTrailer •2020DoubleA T/AGooseneckTrailer• Cat7015cuydPullScraper •Custom Built14ftPullGrader •2 Bottom DikaBreakingPlow •15ftRootPickerPTODrive •35ftDeepTillagew/mHarrows •JohnDeere 16ftOff-Set Disc •2013GMC 1500Pickup •500gFuelTankonSkidw/Pump
Miscfarmequipment,GPSunits,augers,headers,industrial,Case850Kcrawlertractor,generators,unusedmobilestructures, selfcontainedcabin,sheds,barn,2014AdvancedChallengerIIXL-65airplane,holidaytrailers,lawnswings,lawnmowers, shoptools,unusedkitchentables&awholelotmore…
It was a solid snappy sale at yesterday’s North Country Ranchland Bull Sale at VJV in Dawson Creek. The Transcon team kept everything roll.
SALE RESULTS
56 Bulls on Offer
OVERALL SALE AVERAGE - $11,352.68
Black Simmentals - $14,326.92
Red Simmentals - $10,453.49
CRYSTAL SPRINGS RANCH
Black Simmentals - $14,863.64
Red Simmentals - $11,565.22
Rosefield Simmentals
Black Simmentals - $11,375.00
Red Simmentals - $9,175.00
HIGH SELLERS
LOT 48 - CRYSTAL SPRING ADMIRE 2N - $21,000.00
LOT 33 - CRYSTAL SPRING DYNAMIC 48N - $19,500.00
Weaver Auctions, a respected Western Canadian auction house, has officially joined Euro Auctions, the leading auctioneers in Europe of construction, agricultural and industrial equipment. The acquisition marks a significant step in Euro Auctions expansion across Canada, enhancing services for customers in Alberta, British Columbia and beyond.
Weaver Auctions has built a strong reputation among contractors, farmers, fleet operators and equipment dealers, with two strategic locations in Rycroft, Alberta and Prince George, British Columbia, each offering more than 25 acres of yard capacity. Known for professionally managed, large-scale unreserved auctions, Weaver Auctions specializes in construction machinery, agricultural equipment and transport assets tailored to the needs of Western Canadian industries.
Euro Auctions is the largest auctioneer in Europe and owner of Yoder & Frey, along with other Canadian auction businesses, brings its global scale and technology to the Canadian market. The addition of Weaver Auctions strengthens the company’s presence in Western Canada while adding to its existing national group, including:
• Michener Allen Auctioneering (Alberta & Manitoba)
• Jardine Auctioneers (Atlantic Canada)
• North Toronto Auction (Ontario)
• Coast2Coast Collector Car Auctions For Canadian consignors, this integration provides:
• Access to a global buyer base across more than 100 countries
• Greater equipment exposure through an internationally recognized auction platform
• Industry-leading online bidding technology with live global participation
• Increased competition and liquidity through highvolume, unreserved auctions
This latest addition makes 7 sites across Canada with full national coverage from British Columbia to New Brunswick. Canadian buyers benefit from this national and international coverage with a broader inventory selection spanning construction, agriculture, forestry, transportation and industrial sectors, supported by coordinated national marketing and global reach.
Yvette and Jeff Weaver, co-owners, comment:
“This transition ensures the long-term growth and strength of Weaver Auctions. By joining Euro Auc-
tions and its established Canadian network, including Michener Allen, Jardine Auctioneers, North Toronto Auction and Coast2Coast, we become part of a nationwide platform backed by global reach. Our team remains in place, and our customers benefit from increased exposure and bidding power while retaining the local expertise they trust.”
Weaver Auctions experienced management team and staff will remain in place, ensuring continuity of service and maintaining long-standing relationships within the regional marketplace. Operations will continue as usual, with integration focused on expanding buyer access and enhancing competitive bidding for consignors.
Derek Keys of Euro Auctions added:
“Canada is a core market for our group. Expanding into northern Alberta and British Columbia is of strategic importance. Weaver Auctions has built an excellent reputation in the region, and their customer-focused approach aligns perfectly with ours. This acquisition strengthens our Western Canadian presence and increases opportunities for buyers and sellers across the country.”
Euro Auctions strategy in Canada focuses on combining strong, locally established auction businesses with the scale, technology and international marketing power of its global platform. The acquisition of Weaver Auctions ensures the company’s local expertise is preserved while enhancing efficiency and market reach.
Ongoing infrastructure development, resource sector activity and fleet renewal cycles within farming
and contracting sectors continue to drive strong demand for quality equipment across Canada. With an expanded national network and access to global buyers, Euro Auctions is well positioned to help Canadian sellers maximize asset value while providing buyers with competitively priced machinery
About Weaver Auctions: Weaver Auctions is a Western Canadian auction company specializing in construction equipment, agricultural machinery, transportation assets and industrial equipment, serving buyers and sellers across Alberta and British Columbia.
About Euro Auctions: Euro Auctions is a leading global auctioneer of construction equipment, agricultural machinery, industrial equipment and commercial vehicles. Operating permanent auction sites across Europe, the Middle East, Australia and North America, Euro Auctions delivers unreserved auction services and comprehensive asset remarketing solutions to a worldwide buyer base. NH
For alimitedtime,get0%orlow-ratefinancingontheallnew2024 and2025Versatiletractorsandtillageequipment.Don’tmissthis opportunitytomaximizeperformancewithoutstretchingyourbudget. Thislimitedtimeoffersendssoon.Terms &Conditionsapply.Contact yourFoster’sAgri-WorldSalesRepformoreinformation. www.versatile-ag.com
