YourNorthernHorizonTeam
Dan PRZYBYLSKI Heather ANDERSON
Sales/ClassifiedsCirculation (250)784-4319handerson@farmmedia.com dcsales@glaciermedia.ca
Pleasedirectallaccountinginquiriestoap@farmmedia.com
THENORTHERNHORIZON (PublishedbyGlacierFarmMedia)1666DublinAve, Winnipeg,ManitobaR3H0H1
TheNorthernHorizonretainsfull,completeandsolecopyrightofanyadvertisement, writtenorphotographicmaterialpublishedintheNorthernHorizon.Reproduction isnotpermittedwithoutthewrittenpermissionoftheNorthernHorizon. AllcontributedmaterialwillbeincludedintheNorthernHorizonasspacepermits. Wereservetherighttoeditorre-writeanyaspectofcontributedcopytomakeit suitableforpublishing.
OURNEXTISSUE:FRIDAY,FEBRUARY 27TH,2026
REGULARADDEADLINES:
Bookingdeadlineforregulardisplay ads: Noonon WEDNESDAY,FEBRUARY18TH,2026
Admaterialdeadline: Noonon FRIDAY,FEBRUARY 20TH,2026
CLASSIFIEDADDEADLINE:
AnysubmissionsforClassifiedAdsshouldbemadetoDanPrzybylski byphoneat(250)784-4319oremailatdcsales@glaciermedia.ca
Allclassifiedadsubmissionsmustbereceived by theNorthernHorizon by 10:00a.m.(BCtime)on FRIDAY,FEBRUARY20TH,2026
SUBSCRIPTIONS
SubscriptionstotheNorthernHorizonare available by contacting DanPrzybylski by phoneat(250)784-4319oremailatdcsales@glaciermedia.ca orHeatherAnderson by emailatheather@fbcpublishing.com
Theannualsubscriptionrateis $150.00 (GSTincluded) withfullpaymentdueattimeofsubscription.
To Canada Post, your Mailbox orSuperboxis designatedinoneof four ways -House,Apartment, FarmorBusiness.
Justheaddown to your localpostoffice andask your Postmaster to have yourMailbox/Superbox designatedasa“Farm”.
Youshouldstart receiving your copy oftheHorizon withina coupleof weeks. 98907416JAN26
Reliableenergy forthelife youlive
Inachanging world,thethingsthat staysteadymatter.
Naturalgashelps keephomes across BC warm,lightsonand energycostsmorepredictable— especiallyduringlongwintersand peakdemand.It’s thedependable energybehindeverydaymoments, from yourfirstcup of coffee to eveningsspent together at home.
As communitiesgrow, we’re focusedondelivering reliable, affordableenergy—safely, responsiblyand readywhen youneedit.
> Visit enbridge.com/bc to learnmore.
9 Agronomy Tips to Help Increase Canola Profit
These agronomy practices can help farmers and agronomists improve canola profit at little to no added cost.
1. Review the appropriate target plant stand
The recommended target stand of five to eight plants per square foot is based on meta-analysis of canola hybrid studies from Western Canada. University of Saskatchewan professor and researcher Steve Shirtliffe conducted the meta-analysis, and concluded that it is more profitable to target the lower end of the range when seed costs are high and the crop selling price and crop yield are low. But don’t go too low. Yield potential drops with plant populations lower than five per square foot, and thin stands increase the risk from flea beetles and weed competition. More on that below.
2. Achieve uniform seed emergence
Uniformity in terms of plant population across the field and crop staging is an important start for a competitive, high-yielding crop. Consistent seed placement into the top half-inch to inch of topsoil greatly improves seed survival, as does somewhat warmer soils. These steps to increase seed survival and improve the return on investment may require a well-maintained seed tool and perhaps slowing seeding speed, which take time but not excessive out-of-pocket cost. Uniform, rapid emergence also improves crop competition against weeds and flea beetles. Fungicide and harvest timing improve with all plants at equal maturity.
3. Choose seed with disease resistance to match threats In fields with yield-robbing levels of blackleg, use cultivars with a blackleg resistance group (RG) that works against the common blackleg races in that field. A stubble test will identify the dominant blackleg races in a field and provide tips for RG selection. Visit blackleg.ca and go to “Identifying blackleg” to find labs that test stubble for blackleg races. See the table here for a list of cultivars with blackleg R genes identified. Consider an improved blackleg seed treatment with tight rotations and limited information on blackleg races in a field. Cultivars with clubroot resistance and increased sclerotinia stem rot tolerance can also reduce yield loss with relatively little additional cost. Growers could also ask seed companies about cultivar differences in verticillium stripe performance.
4. Cost-effective approaches to flea beetle management
If farms pencil in one or more flea beetle sprays, starting off with more plants per square foot and an improved seed treatment may offset the need to spray. The question is which practice provides the most economical balance – more seed, better seed treatment or extra foliar sprays?
5. Meet crop needs for fertilizer
Cutting fertilizer rates will reduce upfront costs, but this is rarely the path to improved profitability. Fertilizing for a 50 bu./ac. target yield is usually more profitable than fertilizing for a 40 bu./ac. target yield, as long as weather allows crops to get close to those targets. (Read more in the January Canola Digest article, “Calculate an appropriate target yield.”)
Fertilizer application at the time of seeding is ideal as it avoids the losses often associated with fall application and it eliminates the need for an in-crop top dress. Big rates at seeding will slow the seeding operation, so farms may have some logistical trade-
offs. Whatever the trade-offs, note that fertilizer in the seed row, except for the starter rate of phosphorus, can undo the seed survival and uniformity benefits described earlier.
6. Control weeds early
Weeds compete for soil nutrients, moisture and sunlight, and that early competition can be particularly damaging to canola yield potential. Growers want crops emerging in a clean field so it can get ahead of the weed competition. If a farmer budgets for two sprays, early applications cost the same as late applications, but early applications can increase yield
Continued on page 18
Welcomeand Introductions(Fritz Hostettler,PRFSA President)
PeaceRegion Turfand ForageSeed Production -A HistoricalLook
Turfand ForageSeed Market Opportunities(Seed TradeCompanies) Turfgrass Market Outlook(Mike Baker,New Seeds)
Canola germination progress and percentage based on soil temperature. Warmer soils provide more rapid and uniform emergence.
Canola Council of Canada
Lethbridge Polytechnic Renews Land Lease Agreement with the Government of Alberta
Jan 22, 2026
Lethbridge Polytechnic has signed a 20-year land lease renewal agreement with the Government of Alberta for its 395-acre research farm east of Lethbridge. The agreement, signed in July, reinforces a long-term relationship between the polytechnic and the provincial government as they work to expand applied agricultural research operations in response to industry needs.
“The Lethbridge Polytechnic Research Farm is central to our agriculture research operations, supporting innovative projects while providing worldclass opportunities for researchers and students alike,” says Dr. Kenny Corscadden, vice-president –academic and research. “Thanks to our partnership with the provincial government, we look forward to enhancing our capacity for student-focused, industry-connected agricultural research.”
“Alberta’s government is proud to support applied agricultural research that delivers real-world solutions for producers while creating hands-on learning opportunities for students,” says Minister of Agricul-
•Micro-Mix Max• IgniteS2byAgri-Gro® OtherFoliarAppliedProductsInclude: •10%Boron• 2.5% Molybdenum •5%Copper •6%Iron• 9%Zinc •10%Calcium(Agri-Cal) •UltraOrganicBio-Stimulant •9-18-9-1LiquidFertilizer
ture and Irrigation RJ Sigurdson. “Renewing this land lease with Lethbridge Polytechnic provides longterm stability for innovative research, strengthens partnerships with industry and helps ensure Alberta remains a leader in agricultural productivity, sustainability and irrigation research.”
Lethbridge Polytechnic has been conducting applied research in agriculture for over 35 years, most recently within the Centre for Applied Research, Innovation and Entrepreneurship (CARIE). In December, a report released by Research Infosource Inc., a Canadian source of research intelligence, ranked the polytechnic ninth among the top 50 research colleges (and polytechnics) in the country, up from 10th in 2024 and 11th in 2023.
CARIE has managed operations on the farm since 2020 thanks to the initial lease agreement with the Government of Alberta. Since then, the polytechnic, through the Mueller Irrigation Research Group, has expanded capacity and research capabilities for precision irrigation projects.
In August, the polytechnic celebrated a transformative $2.8 million gift from the estate of Joe and Laverna Hranac to support operations at the research farm. These operations also provide hands-on student learning opportunities, whether through coursebased curriculum or research assistant positions, allowing students to work directly with researchers on real-world challenges facing producers.
The lease agreement also includes a provision allowing for the construction of the multi-use Cor Van Raay Link pathway, connecting Lethbridge to Coaldale.
To learn more about applied research activities and projects at Lethbridge Polytechnic, visit: lethpolytech.ca/CARIE. NH
CLAAS Recognized with Two AE50 Awards for Forage Harvesting Innovation
The CLAAS JAGUAR 1000 and ORBIS 10500 receive honors.
Omaha, Neb., January 19, 2026
CLAAS of America has been recognized by the American Society of Agricultural and Biological Engineers (ASABE) with two prestigious AE50 Awards, honoring the company’s continued leadership in agricultural engineering and innovation. The awards recognize the recently introduced CLAAS JAGUAR 1000 series self-propelled forage harvester and their new ORBIS 10500 corn harvesting head, designed to work with the new, larger JAGUAR 1000 series forage harvesters.
The AE50 Awards are presented annually by ASABE to the top 50 new products that demonstrate the highest level of innovation, significant engineering advancement and impact on agriculture, food and biological systems. CLAAS was one of only a select number of manufacturers to receive multiple awards in 2026.
“These two AE50 Awards reinforce what our customers already know — CLAAS continues to set the standard for performance, efficiency and intelligent machine design in forage harvesting,” said Dennis Ogle, Head of Sales for Self-Propelled Harvesters at CLAAS of America. “Both the JAGUAR 1000 series and ORBIS 10500 were developed with direct input from farmers and contractors, focusing on real-world productivity gains and operational simplicity.”
JAGUAR 1000 SERIES: BREAKING NEW GROUND IN FORAGE HARVESTING
The JAGUAR 1000 series represents a new generation of forage harvesters, combining extreme horsepower with intelligent automation and efficiency-focused design. With engine outputs reaching up to 1,110 horsepower, the machine is engineered to deliver maximum throughput while maintaining consistent chop quality and fuel efficiency.
Advanced features such as intelligent engine management, optimized crop flow and operator-assist technologies help reduce operator workload while maximizing daily harvest output. The AE50 Award recognizes the JAGUAR 1000 series for pushing the boundaries of forage harvester performance while maintaining reliability and serviceability.
ORBIS 10500: HIGH-CAPACITY CORN HARVESTING HEAD
Also recognized with an AE50 Award, the ORBIS 10500 corn harvesting head was designed to match the capacity demands of the new high-horsepower JAGUAR 1000 Series forage harvesters. Featuring a working width of up to 35 feet, the ORBIS 10500 enables efficient harvesting of large acreages while maintaining excellent crop intake and minimal losses.
The head’s innovative folding design improves transport safety and ease of maneuverability, while its optimized crop guidance system via AUTO CONTOUR ensures smooth, consistent feeding into the forage harvester. ASABE judges highlighted the ORBIS 10500 for its engineering sophistication and its contribution to overall harvesting efficiency.
INDUSTRY-RECOGNIZED INNOVATION
The AE50 Awards are selected by a panel of engineering experts and represent one of the most respected recognitions in agricultural equipment development. The
company’s dual recognition underscores the company’s long-term commitment to engineering excellence and customer-driven innovation.
Both award-winning products will be showcased during the upcoming ASABE Agricultural Equipment Technology Conference, where AE50 honorees are formally recognized. NH
The World’s First 1:1 Dual Knife Opener for Unmatched Depth Control!
Bourgault Introduces The all new ParaLink Dual Xtreme Opener
St. Brieux, SK – January 9, 2026
Bourgault Industries is proud to announce the launch of the patented PLDX (ParaLink Dual Xtreme™), a groundbreaking advancement in seeding technology and the world’s first 1:1 Dual Knife Opener. Designed to deliver superior depth consistency and agronomic flexibility, PLDX sets a new standard for precision seeding in challenging terrain.
Building on the success of the PLDS (ParaLink Dual Shank™) opener, which revolutionized seed and fertilizer placement in 2020, PLDX introduces a true 1:1 depth control ratio. This innovation ensures more consistent seed depth across severe contours, washouts, ruts, and rolling ground—conditions where traditional openers often struggle.
Key Advantages of PLDX:
• Unmatched Depth Control: Maintains precise seed
placement even in extreme terrain.
• Precise Soil Coverage: Achieve precise control of the amount of soil over the seed for optimal emergence and crop performance.
Thecommunity of Goodfare wouldliketo expresstheirsincerestthanksand appreciation to BirchcliffEnergyfor theirassistance inthere-painting of theinteriorofthe Goodfare Community Hall.
Theircommitmenttothe community istrulyappreciated.
• Agronomic Flexibility: Adjustable horizontal and vertical knife spacing for seed safety under highnitrogen programs.
• Convenient Adjustments: Fine-tune depth at the packer wheel without altering seed-to-fertilizer spacing; optional QDA (Quick Depth Adjust) and AccuSet allow rapid changes from the cab.
• Durability Upgrades: Wider pivots, optimized geometry for stone clearance, and simplified maintenance with only one grease point.
“PLDX combines Bourgault’s proven ParaLink™ technology with a complete redesign focused on precision, adaptability, and ease of use, Farmers can now achieve superior depth consistency without sacrificing flexibility for their fertility programs.” Curtis Hinrichsen, Bourgault Industries Ltd. – Saskatchewan, CAN The PLDX is ideal for growers running high nitrogen fertility programs or those seeking tighter separation in wet seasons. With its advanced design and operator-friendly features, the PLDX is more than an incremental improvement—it’s a complete rethink of what a dual knife opener can do. NH
Correction
An eagle-eyed reader (and Galloway breeder) spotted an error on page 23 of our January 30th issue.
Apparently, we showed a correct picture of a Galloway bull but re-ran the Charolais copy that was printed just before it. Our apologies.
So, here is what it should have looked like:
The Canadian Galloway Association represents three breeds: Galloways, Belted Galloways, and White Galloways. All three breeds come in black, dun, or red color. Galloways were imported into Canada in 1853, Belted Galloways were imported around 1950, and White Galloways were imported in 1966.
A double coat of hair in the winter helps to reduce feed intake and therefore lower costs and helps produce flavourful meat, lean yet-well marbled without excessive external fat. The breed is naturally polled and will eliminate horns from the next calf crop. Feeding tests at Olds College in Olds, Alberta over the last 21 years have shown that Galloway steers had excellent feed conversion rates and produced excellent carcasses. NH
FORAHAY MIX#1- $3.46perpound
60%RanchersAlfalfaBlend 25%SmoothBrome |5%Timothy 5% TallFescue|5%MeadowFescue 12poundsperacre
FORAHAYMIX#2- $3.68perpound
85%RanchersAlfalfaBlend |10%Timothy 5% TallFescue 10poundsperacre
HAY/PASTUREMIX- $4.25perpound
20%RanchersAlfalfaBlend |20% YellowAlfalfa 20%MeadowBrome|20%SmoothBrome 10%AlsikeClover |5%OrchardGrass |5%Timothy 10poundsperacre
HAYMIX(LOWLAND)- $4.28perpound
40%AlsikeClover|20%SmoothBrome
20%Timothy |20%ReedCanaryGrass 10poundsperacre
FORA PASTUREMIX- $3.65perpound
50%MeadowBrome |30%Rancher’sAlfalfa Blend |10% TallFescue |10%OrchardGrass 12poundsperacre
COMMUNITY PASTUREMIX$3.97perpound
30%MeadowBrome |30%SmoothBrome 10%Rancher’sAlfalfa |10% YellowAlfalfa 10%RedClover|5%CicerMilk Vetch 3%MeadowFescue |2%Timothy 12poundsperacre
BENEFITSOFCOVERCROPS
Reducefertilizercosts |Preventerosion |Conserve moisture |Reducetheneedforherbicides Improveyieldsbybuildingsoilhealth
PEACECOUNTRYTOTALMIX$55peracre
20%ForageOats,14%Barley,15%Forage Triticale, 20%ForagePeas,6%Hairy Vetch,4%FabaBeans, 3%RedProsoMillet,4%ItalianRyegrass,2% Sunflower,2%Flax,3%Sudangrass,2%Daikon Radish,1%Purple TopTurnip,1%7-Top Turnip,2% CrimsonClover, 1%BerseemClover 65lb.seedingrate |Availableintotesor50lbbags. PEACECOUNTRYSILAGEMIX$42peracre
45%ForageOats,15%Barley,19%Forage Triticale, 11%ForagePeas,4%Hairy Vetch,5%FabaBeans, 1%7-Top Turnip 90lb.seedingrate |Availablein TotesorBulk Tofollowupwithgrazing,add3lbsCrimsonClover & 4lbsItalianRyegrassat15$peracre
We arecommittedtohelpingfarmers &rancherstouse regenerativefarmingpracticesinordertodiversifyfarmland ecosystemswhileenhancingefficiencyandprofitability.Wecan custommixmostanycovercropmixthatyouwouldlike,at competitivepricing.
Alberta Canola Producers Commission(http://dashboard.albertacanola.com/reports/weekly-grains)
after 60 per cent seed
colour change (SCC) will yield more than swathing before that stage. A Canola Council of Canada multi-location study from the early 2000s found that canola swathed at 50-60 per cent SCC on the main stem yielded at least eight per cent more than fields swathed at 30-40 per cent SCC. Canola swathed at
60-70 per cent SCC yielded 11 per cent more than fields swathed at 30-40 per cent.
Newer research has confirmed these results. Indian Head Agricultural Research Foundation (IHARF) in 2013 concluded that “swathing at 20-30 per cent SCC resulted in the lowest seed yield, and postponing the operation by less than a week during this critical period increased canola yields by nearly nine per cent.”
The yield benefit from waiting is even greater in fields with fewer plants. With fewer, bigger plants, more yield is coming from side branches, and delayed swathing gives these seeds more time to fill.
8. Minimize combine loss
Canola harvest losses can exceed 10 per cent of yield in challenging harvest conditions or when going too fast with a poorly-set combine. The whole profit margin can easily blow out the back of the combine. Accurate measurement of loss requires a drop pan. And the right settings will require some trial and error, especially when learning the ropes with a new combine. Growers can reduce losses to one or two per cent with attention to detail and adjustment to changing harvest conditions.
9. Rotate crops to improve yield
Two- or three-year breaks between canola crops is a well-supported recommendation to reduce disease severity and increase yield. While adding a third crop to a wheat-canola rotation sounds easy, it may have logistical challenges that do increase costs in the short term. However, the overall long-term benefit, for farms that adopt the practice, can improve canola profitability.
Taken from the website of the Canola Council of Canada/Canola Watch, https://www.canolacouncil. org/canola-watch/fundamentals/9-agronomy-tips-tohelp-increase-canola-profit/ NH
FRIESENFARMS
LAKEROADBLACKANGUS Consigning 11 Yearling&5 Two-Year-OldBlackAngusBulls
DRYCREEKRANCH Consigning 10 Two-Year-OldCharolaisBulls
WHISKEY JACKBLACKHEREFORDS&SIMMENTALS Consigning1 Reg.BlackHerefordBull&1 RegBlackHereford Femaleand3 LotsofCommercialHeifers
FRIESEN FARMS Consigning2-Year-Old Red&BlackAngusBullsand3 Pens-of-3AngusInfluenced ReplacementHeifers
EIGHT-WAY CHAROLAIS Consigning9 YearlingCharolaisBulls
MTRANCH Consigning2 Reg Purebred&2 Reg FullbloodSimmentalBulls
FO URTHCREEKANGUS
COWMAK ER BullSale
TW O YE AROLD & SELE CT YE ARLIN G ANGUS
Feb072026 2025
10Series s915720 820 bu,4Tanks80bu,250,bu,135bu, 355bu,+Tank LoadCells dualfans,TopConXD+monitor 5m3397 duals4-900/60R42 Convey-All Conveyor Sect Control +70’ QuantumAirDrill12”Spacingpaired row dblshoot 3 Row Packer 7m5332 s9M5729 ,820buCart$545,000 +70’AD$450,000=$995,000 Blow-Out$895,000
New246204wdVersatile665hp@1900rpm 16x4CatP/Stranrev-fantowcable900/60 R42 tire110gpmpump 6E hyd remote3/4” returndifflock PTO DelCab12”monitor L/seatSusp/CabRadar,Jake BrakeV6700 A/S/RIsobus,Rcamera#s852688 wt61,250 SN708852 $ 995,000Blow-Out $ 895,000
New23DT620Versatile,665hp@1900rpm 16x4P/S,rev-fan,difflock,TowCable,36” PTO,6500Series Tracks,110gpmpump 6remotes,3/4”return,DeluxeSuspCab, Radar19 LedlitesV6700A/S/R,#s249655 wt64,000 SN708249 msrp$995,000 NEW2023DT620Blow-Out $ 895,000 1
25’Pull-type11Spring-TripShanksSubsoiler30”shank spacing,Shankboltonwearplates, s#109091 Completewith frts/u&exch$121,800 Blow-Out$107,000codiw/$1,000deposit
$205,900
ANGUS Cattle Directory
Binks Angus Farm
Evan Binks, Grande Prairie, AB 780-518-2020
Brandl Cattle Co.
Bryron & Gwen Brandl, Jarvie, AB
Kailey, Wynton & Landon Brandl Byron 780-349-1765 Gwen 780-349-1704
Broken Stick Ranch
Black Angus for Sale off the Farm
Tom & Amber Ditner, Baldonnel, BC 250-794-7105
Evans Cattle Company
Glyn & Stephanie Evans, Doe River, BC 250-467-2275
Excel Ranches
Ron & Barb Miller, Westlock, AB Cody & Amy Miller, Westlock, AB 780-349-0644
Fourth Creek Angus Ranch
Ryan Lacey & Lucie Coche, Spirit River, AB Ryan 780-864-7753 Lucie 780-517-3507
GRA-TAN Farm
Grant & Tanya Chittick, Mayerthorpe, AB 780-284-0684
Crystal Chittick, Mayerthorpe, AB 780-204-2005
GRA-TAN Farm
Grant & Tanya Chittick, Mayerthorpe, AB 780-284-0684
Crystal Chittick, Mayerthorpe, AB 780-204-2005
Harvest Angus
Tom & Carolyn Dewaal, Prince George, BC 250-960-0022 | 250-562-5200
Heart Valley Angus
Nat Tschetter & Chris Tschetter Wanham, AB 780-978-6407 / 780-978-6406
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Kjos Black Angus
Marty & Miriam Kjos, Fort St. John, B.C. 250-787-0970
Kleskun Lake Farm
Brady Fraser, Sexsmith, AB 780-505-1734
Lakeroad Black Angus
Jim & Donna Rowe, Worsley, AB Jim 780-835-0455 | Donna 780-835-9588
Lazy B Livestock
Trevor Binks & Melanie Klassen Grande Prairie, AB Trevor 780-518-0630 Melanie 780-518-0230
Lazy S Ranch
Stewart Ainsworth, Mayerthorpe, AB 780-785-3136 or 780-786-4150
M.C. Quantock
Mac & Pat Creech, Lloydminster, AB 800-561-2855
Northway Cattle Co.
Hwy 64 & RR 94.5, Cleardale, AB
Albert 780-834-7055 Peter 780-835-8291
Willow Creek Simmentals
Mike & Mari Klassen, Crooked Creek, AB Colby&Tiffany Klassen,Crooked Creek, AB Mike 780-832-7343 Colby 780-832-6714
Rosebud Creek Charolais
Dan & Holly Schleppe, Dawson Creek, BC 250-786-5698/250-219-5698
Schweitzer Ranch
Troy & Kristina Schweitzer Dawson Creek, BC Troy 780-814-3598 | Kristina 250-219-4429
KSL Simmentals
Keegan Scorgie & Brad Smith Beaverlodge, AB Keegan 780-518-6572 | Brad 587-202-0254
Landaker Charolais Farm
Alan & Shirley Landaker, Brownvale, AB 780-618-3928
Pinnacle View Limousin
Rob & Cheryl Swaan, Quesnel, BC Erin & Eric Kishkan, Quesnel, BC Erin 250-991-6654
CHAROLAIS GELBVEIHS
Hill 70 Quantock Ranch
Sorensen Cattle Co.
Murray & Nicole Sorensen Teepee Creek, AB Murray 780-831-6332 Nicole 780-832-1189
RaisingQualityCharolaisCattletomeet theneedsofthe Commercial Industry!
8WAY CHAROLAIS
Nikki,Kristin,Whitney& CourtneyDrschiwiski Box18,CecilLake,BCV0C1G0 Ph:250-785 -6362 Cell:250-261-0876(Nikki) Cell:250-329-4816(Courtney eightway@pris.ca wanderlust_blues@yahoo.ca )
LAZY SCHAROLAIS ROY& ERIKASCHWEITZER ERIKASCHWEITZER BEAVERLODGE,AB
LAZY SCHAROLAISBULLSALE
1:00P.M. |SAT,MAR21,2026 |VJVBEAVERLODGE 30RED, WHITE& TANBULLSONOFFER
CELL:(780)402-5617
HOME:(780)356-3611 SCHWEITZERRE@GPNET.CA
Blondie Cattle Co. Montana Fogle, High Prairie, AB 780-402-4009
Dry Creek Ranch
Seth Harmon, Cecil Lake, BC 250-793-1858
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
JayDawn Farms
Jason & Nikki McQuaig, Sexsmith, AB 780-933-5530
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Chittick Farms
Raymond & Mona Chittick Mayerthorpe, AB 780-305-3925
Gold Stock Hereford Farms
Steve, Ashley & Brad White Beaverlodge, AB 780-518-0064 | 780-354-3190
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
Jonomn Hereford Ranch
Norm & Joanne Parrent, Clyde, AB 780-307-6586 | 780-348-5835
Mike Grimmeyer, Clyde, AB 780-307-3385
M.C. Quantock
Mac & Pat Creech, lloydminster, AB 800-561-2855
Rachido Ranch
Randy & Donna Chittick, Mayerthorpe, AB 780-674-1986
Reber's Polled Herefords
Serena & Kasey Reber, Woking, AB 780-518-2643
LIMOUSIN
Dry Creek Ranch
Gordon & Carla Harmon, Cecil Lake, BC 250-793-2384
Excel Ranches
Ron & Barb Miller, Westlock, AB Cody & Amy Miller, Westlock, AB 780-349-0644
Hillview Farms
Sturgeon County, AB
Raymond & Corine Verbeek 780-982-2176 | 780-939-2173
Colin & Tessa Verbeek Colin 780-982-1676 | Tessa 403-636-1066
Pinnacle View Limousin
Rob & Cheryl Swaan, Quesnel, BC Erin & Eric Kishkan, Quesnel, BC Erin 250-991-6654
MISCELLANEOUS
ALBERTA
Barrhead Feeder Association Ltd. Barrhead, AB | Office: 780-674-2456 office@barrheadfeeders.ca
Grande Prairie Feeders' Association Ltd. Grande Prairie, AB | Office: 780-538-1263 gpfeeders@gmail.com
North Peace Feeder Association Ltd. Berwyn, AB | Office: 780-338-2270 barhm@abnorth.com
Prairie River Feeders Co-op Ltd. High Prairie, AB | 780-523-8888 prfc@telus.net
Westlock Feeders Association Ltd. Westlock, AB | 780-348-5850 westlockfeedersassociation@hotmail.com
BRITISH COLUMBIA
B.C. Breeder & Feeder Association Quesnel, BC | Office: 250-992-8483 bearvlly@telus.net
Central Interior Feeders Co-operative Assn Vanderhoof, BC | Office: 250-567-2049 audreycifca@gmail.com
North Peace BC Feeder Co-operative Dawson Creek, BC | Office: 250-782-8911 pcc@neonet.bc.ca
North Peace B.C. Bred Heifer Association South Peace Bred Heifer Association Dawson Creek, BC | Office: 250-782-6272 pcc@neonet.ca.ca
Jennings Martin Direct Buying
La Glace, Alberta Jennings Martin 780-933-1023
Thorsby Stockyards Inc.
Thorsby, Alberta Office 780-789-3915
Chance 403-358-0456 | Jeff 780-203-4953
VJV Livestock Marketing Group
Dawson Creek, BC Office: 250-782-3766
Beaverlodge, AB Office: 780-354-2423
Yancy Crosier 403-485-0887
VJV Livestock Marketing Group Westlock, AB Office: 780-349-3153
Travis Sekura 780-621-6841
VJV Livestock Marketing Group Ponoka, AB Office: 403-783-5561
Craig Jacklin 403-783-1453
VJV Livestock Marketing Group Rimbey, AB Office: 403-843-2439
Dean Edge 403-704-0280
Wembley Livestock Exchange
Glen Mayer & Nolan Mayer, Wembley, AB Glen 780-897-9570 | Nolan 780-518-0709
Dean &Marsha Anderson–Fort
Clarkson Valley Simmentals
SIMMENTALS
Kyle & Ashley Klassen, Crooked Creek, AB 780-933-8605
Clearwater Simmentals
Polar Farms
Joe, Lindsey, Riley & Kendal Loomis
Peace River Regional District, BC 250-784-5150
Yearlingand 2yr. oldBullsforSalebyPrivate Treaty Box238, FAIRVIEW,ALBERTA TOH1LO
Norbert& JaniceLuken 780-835-3165
Email:njluken6@gmail.com
Chad Smith, Olds, AB 403-586-4714
Crystal Springs Ranch
Eckbert & Crystal Weitzel
Georg & Sarah Weitzel Charlie Lake, BC 250-263-8237
D.A.M. Livestock Ltd.
David Michalchuk, Keg River, AB 780-987-0938
Rachido Ranch
Randy & Donna Chittick, Mayerthorpe, AB 780-674-1986
Rosefield Simmentals
James & Martha Wiebe, Prespatou, BC 250-630-2621
Short Grass Farms
WillowCreek Simmentals| Mike &MariKlassen |(780)832-7343
WillowCreekSimmentals| CrookedCreek,AB
Colby& TiffanyKlassen |(780)832-6714 willowcreeksimmentals@gmail.com
GB Farms
Garrett Biggelaar, Lacombe, AB 403-877-7661
Harvest Angus
Tom & Carolyn Dewaal, Prince George, BC 250-960-0022 | 250-562-5200
Hill 70 Quantock Ranch
Bill, Connor & Tes Creech, Lloydminster Bill 780-871-4947 | Connor 780-871-8496 Ted 306-307-2873 | Adam 780-218-4301
KIN-KIN Cattle Co.
Gary & Faye Chittick, Mayerthorpe, AB 780-786-4500
KMR Simmentals
Kent & Robin Malcomson, Grovedale, AB 587-298-5404
Kurtis & Chelsie Dillabough, DeBolt, AB 780-402-9578
Sorenson Cattle Co.
Murray & Nicole Sorenson
Teepee Creek, AB Murray 780-831-6332 Nicole 780-832-1189
Southpaw Cattle Company
Ron & Tammy Daley, Carstairs, AB Brandon & Shallaine Sharpe, Carstairs, AB 403-519-3401
Swantewitt & Sage Simmentals
Yellowhead County, AB Gerd 780-712-2096 Jordan 780-712-3600
Tri K Cattle
Beaverlodge, AB
Keiran Hodges 780-933-5637 Keith Hodges 780-831-7999
SPRINGSELECT BULLSALE
Saturday,March 7, 2026 |4:00p.m. OntheFar m, Groundbirch,BC
Chet &Jamie Jans
Box223,Groundbirch,BCV0C1T0
Call/Text250.219.8200 info@fallentimberfarms.com www.fallentimberfarms.com 98846316jan26
Albrecht Farms
Steve & Tammy Albrecht, Sprit River, AB 780-832-0883
Ryan & Tara Albrecht, Spirit River, AB 780-933-5448
Blazin" J Simmentals
Darcy & Caitlyn Lind, Sunset House, AB D 780-536-5203 / C 780-552-4934
Blondie Cattle Co.
Montana Fogle, High Prairie, AB 780-402-4009
Kruger Farms
Ryan & Chelsea Kruger, Sundre, AB 403-586-0125
KSL Simmentals
Keegan Scorgie & Brad Smith Beaverlodge, AB Keegan 780-518-6572 | Brad 587-202-0254
Lazy S Ranch
Stewart Ainsworth, Mayerthorpe, AB 780-785-3136 or 780-786-4150
M.C. Quantock
Mac & Pat Creech, Lloydminster, AB 800-561-2855
M J Simmentals
Joe & Marianne Gingles, Beaverlodge, AB Joe 780-354-8842 | Cell 780-814-2567
Montagneouse Creek Simmentals
Herman & Mark Giesbrecht, Worsley, AB 780-772-0488
Whiskey Jack Black Herefords & Simmentals
Tamara & Darcy Kuriga, Whitelaw, AB 780-834-7108
Willowdale Simmentals
Dale & Judy Smith and Family Valleyview, AB Dale 780-558-9337 | Kent 780-721-1109
Wolfe Farms
Tony Wolfe, Valleyview, AB 780-524-9322
Wolfe Lake Farms Inc.
Olin Rosvold, La Glace, AB 780-518-1997
Wolfes Fleckvieh
Shane & Shannon Wolfe, Sundre, AB 403-556-0729
VJVLIVESTOCKMARKETINGGROUP
TUESDAY
500-599
600-699
700-799
800-899
900-999
THURSDAY
THURSDAY S WEEKLY Office (780)349-3153 Fax(780)349-5466 westlock@vjvauction.com
WEDNESDAY S WEEKLY Office (403)783-5561 Fax(403)783-4120 office@vjvauction.com
$700.00$810.00$700.00$815.00$700.00$834.00$700.00$800.00$650.00$800.00n/an/an/an/an/an/an/an/a
$680.00$785.00$685.00$775.00$695.00$800.00$710.00$810.00$640.00$795.00$700.00$820.00$737.00$840.00$700.00$850.00$715.00$885.00
$628.00$725.00$620.00$710.00$640.00$728.00$640.00$712.00$613.00$710.00$669.00$735.00$640.00$772.50$655.00$730.00$635.00$785.00
$580.00$649.00$570.00$635.00$560.00$641.00$570.00$651.00$560.00$637.00$577.00$640.00$563.00$645.00$600.00$666.00$575.00$658.00
$505.00$565.00$510.00$561.00$505.00$559.00$508.00$565.00$500.00$565.00$520.00$577.00$511.00$569.00$530.00$581.00$510.00$574.00
$470.00$505.00$470.00$509.00$460.00$505.00$480.00$505.00$480.00$517.00$470.00$512.00$462.00$515.00$490.00$522.00$480.00$517.00
$430.00$475.00$445.00$465.00$435.00$455.00$445.00$460.00$436.00$482.00$407.00$453.00$429.00$473.00$460.00$485.50$455.50$480.50
500-599
$590.00$652.00$570.00$631.00$585.00$649.00$620.00$672.00$580.00$659.00$578.00$622.00$576.00$629.00$603.00$650.00$590.00$635.00
600-699$510.00$592.00$510.00$567.00$505.00$585.00$525.00$575.00$520.00$575.00$530.00$587.00$515.00$578.00$535.00$598.00$520.00$590.00
700-799
$460.00$535.00$458.00$525.00$440.00$507.00$500.00$530.00$485.00$541.00$470.00$525.00$458.00$509.00$475.00$512.00$460.00$521.00
800-899 $410.00$459.00$410.00$457.00$410.00$442.00$420.00$445.00$420.00$485.00$400.00$445.00$430.00$457.00$450.00$471.00$430.00$475.00
900-999$405.00$435.00$390.00$425.00$390.00$425.00$410.00$435.00$385.00$427.00n/an/a$325.00$430.00$395.00$439.00$380.00$442.00 1000+$380.00$405.00$370.00$391.00$330.00$359.00$380.00$402.00$330.00$345.00n/an/a$337.00$371.00n/an/a$325.00$377.50
D1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 CowsD1-D2 Cows $210.00$241.00$205.00$231.00$210.00$229.00$220.00
D3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 CowsD3-D4 Cows
$180.00$211.00$170.00$207.00$180.00$210.00$190.00$221.00$170.00$210.00$175.00$205.00$188.00$207.00$210.00$219.00$190.00$209.00 Heiferettes Heiferettes Heiferettes HeiferettesHeiferettesHeiferettesHeiferettes HeiferettesHeiferettes
Tues, Feb17th-10:00a.m. Tues, Feb24th-10:00a.m. Tues,Mar3rd-10:00a.m. Tues,Mar10th-10:00a.m. Tues,Mar17th-10:00a.m.
Blazin’J Simmental Bull Sale At theRanch Sat, Feb21–3:00 p.m.
Crestland Farms Bull Sale Tues, Feb24–1:00 p.m.
N.C.Ranchland Bull Sale Mon, Mar16–1:00 p.m.
Thurs, Feb19th-9:00a.m. Thurs, Feb26th-9:00a.m. Thurs,Mar5th-9:00a.m. Thurs,Mar12th-9:00a.m. Thurs,Mar19th-9:00a.m. 250.782.3766
Thurs, Feb19th-10:00a.m. Thurs, Feb26th-10:00a.m. Thurs,Mar5th-10:00a.m. Thurs,Mar12th-10:00a.m. Thurs,Mar19th-10:00a.m. Wed, Feb18th-9:00a.m. Wed, Feb25th-9:00a.m.
Lazy S Charolais Bull Sale Sat, Mar21–1:00 p.m.
Peace Country SimmentalBull Sale Mon, Mar30–1:00 p.m. Live Consignment SmallAnimal & Horse Sale Sat, April11th
Ring1-10:00a.m. Ring2-10:00a.m.
Mar4th-9:00a.m. Wed, Mar11th-9:00a.m. Wed, Mar18th-9:00a.m.
WEEKEND Jan31/26(prel)Jan24/25(prel) Feb01/24 CANADA 53,27156,11857,573 EAST 11,80512,48712,436 WEST 41,46643,63145,137 WEEKEND Feb07/26 (est)Jan31/26 (est) Feb08/25 US 535,000569,000575,000 CANADIAN CATTLEGRADES WEEKEND Jan31/26Jan24/26 Feb01/25 A 40,17913,27643,385 B 409423455 D 5,4785,5987,648
DATE Tues, Feb03,2026 Tues,Jan27,2026 No.1,506 Head 1,369 Head FEEDERSTEERS
300-399
$825.00$920.00$750.00$898.00
400-499 $800.00$890.00$750.00$870.00
500-599 $720.00$812.00$700.00$780.00
600-699 $610.00$673.00$575.00$650.00
700-799 $515.00 $583.00$500.00$564.00
800-899 $450.00$531.00$475.00$530.00
900-999 $400.00$487.00$420.00$485.00
1,000+ N/AN/AN/AN/A FEEDERHEIFERS
BID LOWHIGH LOWHIGH
300-399 $700.00 $827.00$675.00$797.00
400-499 $675.00$785.00$650.00$744.00
CATTLEFUTURES-US4/CWT -CLOSE February06,2026 MONTHLIVECHANGEMONTHFEEDERCHANGE
Feb-26 237.75+1.90Mar-26367.43+7.15 Apr-26 237.25+0.45 Apr-26362.80+4.53
Jun-26 233.85+2.13May-26357.13+2.00
500-599 $600.00$680.00$550.00$678.00
600-699 $525.00$618.00$515.00$609.00
700-799 $500.00$552.00$450.00$512.00
800-899 $410.00$484.00$400.00$473.00
900-999 $380.00$430.00$350.00$425.00
$210.00$233.00$210.00$240.00 D3 COWS D3 COWS
$190.00$205.00$180.00$200.00
SLAUGHTERBULLSSLAUGHTERBULLS
$210.00$252.00$210.00$245.00 REPLACEMENT CATTLE FEEDER
REG–
SALESCALENDAR
Feb16th –9:00a.m.
REG– Mon, Feb23rd –9:00a.m.
BCH– Sat, Feb28th –12NOON
REG– Mon,Mar2nd –9:00a.m.
REG– Mon,Mar9th -9:00a.m.
REG– Mon,Mar16th -9:00a.m.
REG– Mon,Mar23rd -9:00a.m. SATURDAY,MAR28 |12NOON TSIALLBREEDSBULLSALE ANDBRED COW& HEIFER SALE
REG –Mon,Mar30th -9:00a.m.
REG– Mon,Apr6th –NOSALE
JenningsMartinCattleBuyingwillbethereforyouandyouroperation asyouprepareforyour2026springandsummermarketing.Andwhilenotwo yearsseem to bethesame, Iremaincommittedtocontinueoffering fairprices whileproviding astress-freeenvironmentforbothyouandyourcattle. Our facilit yinLaGlacecontinues to remainopen,buyingallclassesofbulls, cows, steersandheifers,savingyoutheneed forshipping to localorsouthernmarkets.
CheckoutourFacebook Page forWeekly Updates
Callus todayandmaximizeyourSpring &Summersaleopportunities. BUILDING FORSUCCESS| WORKINGWITHINTEGRITY
TC AT TL EB UY ING AT JENNING YO UR ST RE SS -FRE ES EL LI NGSOLUT IO N RESS-FREESEL Je n ni ngsMa r ti n •7 80.933.1 023 JenningsMa rt in
ENNING SM ARTIN
What to Expect When We Spay and Neuter
Dr. Stephanie Parth
Bringing your pet in for a spay or neuter surgery can feel scary for some pet owners. You may notice your pet seems extra nervous that day, wonder whether optional pre-anesthetic bloodwork is necessary, or feel unsure about what happens behind the scenes. If any of these thoughts have crossed your mind, this article may help. Below, we outline how your pet is cared for at our clinic from intake to discharge.
When your pet arrives, the first step is obtaining an accurate body weight. This allows us to calculate medications precisely and assess body condition. Pets that are underweight may be more susceptible to low body temperature during surgery, while overweight pets often require doses based on their ideal weight for safety.
Next, a pre-anesthetic examination is performed by your veterinarian. Special attention is given to the heart and lungs, as these systems are critical during anesthesia. The veterinarian also checks for other concerns such as dental disease, lumps or bumps, ear infections, or hernias. Your pet’s sex is confirmed to ensure the correct sterilization procedure is performed. If any abnormalities are noted, our veterinary team will contact you to discuss the findings and next steps.
Optional pre-anesthetic testing may then be performed. Common tests include bloodwork and an electrocardiogram (ECG). These tests are completed prior to sedation and assess vital organ function, including the liver, kidneys, and heart. These organs are responsible for metabolizing drugs and supporting your pet while under anesthesia. While most young and healthy pets have normal results, these tests can occasionally identify underlying conditions that may be subclinical. Although normal results cannot guarantee a risk-free anesthetic, they provide valuable information to help us navigate your pet’s anesthesia.
Additional precautions are taken for brachycephalic (short-nosed) breeds (eg. Frenchies, pugs, etc). These pets are more prone to breathing difficulties and regurgitation under anesthesia. Their breathing and airway anatomy are carefully assessed. An antinausea medication may be prescribed the night before or administered IV the morning of the procedure to help reduce the risk of aspiration. These patients are also pre-oxygenated using flow-by oxygen or an oxygen chamber to support their respiratory system as sedation begins.
Sedation drugs are then calculated and administered. There are several routes of administration, including intravenous (IV), intramuscular (IM), subcutaneous (SQ), or near an acupuncture point on the top of the head (GV20). The route chosen depends on the medications used, your pet’s temperament, and how quickly sedation is needed. IV and GV20 administration generally take effect more quickly, while IM and SQ routes may take longer. For very nervous or wiggly patients, IV access can be challenging, so our veterinary team works together to choose the least stressful and safest approach. In some cases, calming medications may be given beforehand to improve your pet’s comfort.
Once your pet is adequately sedated, an IV catheter is placed to allow direct access for medications and IV fluids. An anesthetic agent is then administered, and an endotracheal tube is placed to secure the airway. While the veterinarian performs a thorough surgical scrub, a registered veterinary technician closely monitors your pet under anesthesia. Monitoring includes heart rate, respiratory rate, blood pressure, oxygen levels, carbon dioxide levels, temperature, and anesthetic depth. Maintaining the correct anesthetic depth is critical, and this careful balance is achieved through extensive training and experience. For most pets a tooth count is performed to look for oral issues. Low blood pressure and hypothermia are more common complications of anesthesia and can be mitigated with IV fluids and patient warming systems that are placed on the patient immediately.
Meanwhile, another team member prepares the surgical site by clipping fur, cleaning the area, and applying local freezing if required. Your pet is then moved into the operating room, where the veterinarian performs the spay or neuter using appropriate techniques
After surgery, your pet is given oxygen and monitored intensely during recovery. Once they are ready, the breathing tube is gently removed. Your pet is then placed in a quiet recovery kennel, where a veterinary technician remains with them, offering gentle reassurance until they are more awake. Recovery times vary, and your pet is not left alone in this period.
Throughout the day, your pet’s vital signs are still monitored. Once they are stable and ready to go home late afternoon, the IV catheter is removed. At discharge, we review how the procedure went, provide aftercare instructions, and discuss what signs to watch for at home.
A surgical day with 8-10 patients takes a vet and minimum 3-4 surgical staff. Although spays and neuters are ‘routine’ surgeries, they are still significant procedures that require careful attention and care. Patients are under a watchful eye from intake to discharge. Our goal is to be thorough, efficient and provide your pet with safe, compassionate care every step of the way. NH
Supporting B.C.’S Food Security with Smart-Farming Systems
• Through the B.C. Centre for Agritech Innovation, Delta-based Windset Farms is working with experts to develop, test a smart farming system
• Kwantlen Polytechnic University and the University of the Fraser Valley are each creating training programs for drought-resistant crops, robotic weeding
• More than 350 people will be trained to help strengthen B.C.’s food security and economy
A new smart-farming project in Delta is helping strengthen food security for British Columbians, while two new training programs will ensure more people have the necessary skills to succeed in the growing agritech sector.
“With a changing climate and uncertainty from the U.S., it’s critical that two of British Columbia’s greatest strengths, technology and agriculture, come together to ensure British Columbians can rely on healthy food grown here at home,” said Ravi Kahlon, Minister of Jobs and Economic Growth. “Through our Look West plan, we are connecting innovators with industry partners to turn made-in-B.C. ideas into real-world solutions that create jobs and drive our economy forward in a sustainable future.”
With support from the B.C. Centre for Agritech Innovation (BCCAI), Delta-based Windset Farms is developing a new smart-farming system that automates decision-making with sensors that monitor plant stress and efficient greenhouse crop management.
By using advanced data analytics and machine learning, the project seeks to improve Windset’s production systems by optimizing:
• climate control
• nutrient uptake
• early disease detection in hydroponic tomatoes
“This partnership helps us develop advanced smart-farming systems that improve real-time greenhouse monitoring, optimize climate and nutrient management, and detect potential plant disease earlier,” said Tony Kalf, chief technology officer, Windset Farms. “These innovations allow us to make meaningful impacts
through job creation, new business opportunities and by ensuring the security and stability of B.C.’s food supply. By optimizing the growing environment, we can create efficiencies while minimizing resource use, allowing us to consistently grow high-quality produce yearround.”
The project is moving forward in partnership with Simon Fraser University (SFU), Koidra, Vivent, and Wageningen University & Research (WUR) in the Netherlands. It emerged from a 2023 letter of intent between SFU and WUR to collaborate on future research programs and tackle agricultural sustainability challenges, such as food production and climate change.
Training to grow more resilient crops
Through Kwantlen Polytechnic University (KPU), a new training program is being developed to support the need to adopt more drought-resilient crop production systems. The program will train participants in dry farming, a method that uses specific agro-ecological measures to cultivate crops with zero or very little additional water. The program is a collaboration between:
• the Ministry of Agriculture and Food’s Regional Extension Program
• KPU’s Institute for Sustainable Food Systems
• local farmers
• industry groups
“BCCAI’s support, along with the B.C. Ministry of Agriculture and Food, enables us to establish collaborative dry-farming extension, applied research and demonstration projects on three farms,” said Kent Mullinix, director of KPU’s Institute for Sustainable Food Systems. “We’re engaging dozens of farmers, professionals and students on soil health, agro-ecology, soil and weather data collection, and advancing drought-resilient farming.”
Training to remove weeds, improve fruit and vegetable production
In addition, a new training opportunity developed by the University of the Fraser
Continued on page 42
AATFOSTER’SAGRI-WORLD TFOSTER’SAGRI-WORLD
now$ 9,999 now$49,999
2008CLAAS570R
620FRONTDUALS &28L26REARTIRES W/4WD,MAVCHOPPER,OUTBACKS GPSW/STEERING,SUNNYBROOK CYLINDER,2070SEPHRS, STK2448
NEW2023KUBOTAL3902
0%FINANCINGFOR60MONTHSOAC, LOCATEDATKUBOTACOUNTRY, 37.5HP STK10210
now$34,999 now$34,999
2006CLAAS580R
4WDREARAXLE,900/60R32FRONT TIRES,OUTBACKGPSSTEERING,1600 SEPHRS, STK1136
now$29,999
2002CLAAS480R STANDARDHOPPER,3-DSIEVE, QUANTIMETER,3715/2889HRS STK1748
$225,000 $225,000
NEW2024JCB560-80AGRIPLUS 25FT10IN.MAXLIFTHEIGHT,12000 LB MAXLIFTCAP,145 HP, 25KM/H MAXSPEED STKU001148
$565,000 $565,000
NEW2024SEEDMASTERULTRASR 60 FT,735BUSHELSTOTALCAP, INCLUDESDELIVERYANYWHEREIN ALBERTA STKU000988
NEW2024JCB407AGT4 64 HP,30KM/HMAXSPEED STK U001057
Valley (UFV) is demonstrating new robotic-weeding technology. Weeds are a significant challenge for fruit and vegetable producers in B.C. and elsewhere, as they impact productivity by competing for valuable resources, such as moisture, nutrients and sunlight. This project demonstrates and trains farmers and students on robotic weeding technologies to:
• reduce labour reliance
• minimize herbicide use
• improve sustainability by efficient resource management
“The partnership with BCCAI enables new opportunities for students on current agricultural issues and shows them the types of skills and work opportunities available in agricultural robotics, such as the robotic-weeder demonstration,” said Renee Prasad, department head, associate professor, agriculture technology, UFV. “BCCAI serves an important role in supporting open dialogue by bringing technology and producers, current and future, together.”
Supporting a strong future in agritech
The three new projects and training programs represent a total investment of approximately $658,000, with $280,000 from BCCAI, $204,000 from industry and an in-kind industry contribution valued at $174,000.
These projects are examples of how B.C. is supporting the agritech sector, enabling companies to commercialize their technologies and create cleaner, more resilient and more productive agriculture, food and seafood industries.
It is anticipated the new project and training opportunities will give more than 350 people advanced training in areas such as horticulture, regenerative agriculture, data management and agri-business management, and create three new jobs and increase business opportunities through commercialization.
“B.C.-developed technology is helping our farmers increase production and make our food supply more resilient to climate change,” said Lana Popham, Minister of Agriculture and Food. “Using the latest tech to monitor plant growth and health, as well as maximize water and nutrient efficiency, is resulting in more sustainably grown, local food being produced for B.C. families and a better bottom line for farmers.”
This work is part of the Province’s Look West plan for jobs and industry, which out-
lines B.C.’s vision to deliver jobs and opportunities by strengthening the workforce to develop a more independent economy. The investment by Pacific Economic Development Canada (PacifiCan) in BCCAI is scaling up homegrown innovation and boosting B.C. business growth, key steps in building a strong Canadian economy.
Look West is focused on delivering major projects quicker, diversifying markets, and growing targeted sectors, such as technology, aerospace, marine, AI and quantum, life sciences, agriculture and construction innovation.
Quotes:
“PacifiCan investments are driving local innovation and helping B.C. businesses grow. The B.C. Centre for Agritech Innovation is advancing groundbreaking technologies and hands-on training opportunities in the agriculture sector, improving food security and building a stronger, more resilient Canadian economy.” Gregor Robertson, federal Minister of Housing and Infrastructure and Minister responsible for Pacific Economic Development Canada.
“For technology to deliver real impact, it must go hand in hand with training and upskilling the workforce. BCCAI is proud to support three new projects that focus on technological innovation and hands-on learning. These initiatives demonstrate the power of collaboration in driving sustainable agriculture and food security.”
Rahul Singh, director, B.C. Centre for Agritech Innovation (hosted at SFU)
Quick Facts:
• Announced in July 2022, BCCAI empowers small and medium businesses, producers and processors to de-risk and adopt technology solutions that build resilient supply chains and generate global solutions for food security and climate change.
• The Province has invested $6.5 million over three years toward BCCAI, while the Government of Canada is contributing as much as $10 million through PacifiCan over five years.
• Since opening in September 2022 at SFU’s Surrey campus, BCCAI has created 78 jobs and launched 33 projects with 29 agriculture businesses and 55 delivery partners.
• BCCAI has brought 24 products, services and processes to market, and trained 2,074 highly qualified people via 23 initiatives, such as workshops, training programs and conferences. NH
VJV SELECT BRED HEIFER & COW SALE
Saddle Hills County Health Clinic Now Offering Cervical Cancer Screening (Pap Tests)
Saddle Hills County, Jan 30, 2026
The Saddle Hills County Health Clinic is now offering cervical cancer screening (Pap tests) to County residents as part of its preventive health services.
Cervical cancer screening is a key component of preventive health care and saves lives.
Regular screening can identify cell changes early— often before cancer develops or symptoms appear— when treatment is most effective.
Women and people with a cervix aged 25 to 69 may be eligible for screening. Residents are encouraged to
speak with their health care provider about when to get screened and which option is right for them.
More information about cervical cancer screening is available through Alberta’s Screening for Life program at screeningforlife.ca
Details about the clinic, available services, appointment booking, and frequently asked questions can be found on the Saddle Hills County website here.
Residents are also encouraged to subscribe to the County newsfeed and follow @saddlehillshealthclinic on Facebook and Instagram for updates. NH
HaybineMo-Cow/14HSHeader(newreel).....................$35,000 NewHolland1475
Alberta Updates Wild Boar Regulations
Saddle Hills County, Jan 27, 2026
The Government of Alberta has updated regulations related to wild boar to better protect the province’s agriculture industry.
As of December 1, 2025, wild boar are now classified as a regulated agricultural pest in all circumstances, not only when they are at large. Under the new rules, it is illegal to keep, import, purchase, sell, transport, or otherwise obtain live wild boar or wild boar hybrids without a permit.
Wild boar are considered an invasive species and can cause significant damage to cropland, pastureland, and the environment. They may also pose safety risks to people and livestock.
Residents who see wild boar or signs of activity are encouraged to report sightings online. Learn more about the changes to rules for hunting, trapping, and reporting wild boar by visiting alberta.ca NH
NewHolland430HB
TRACTORS
KubotaMX5800 Tractor(2019),w/LoaderandBucket, 580Hours,ROPSHST,FWA .........................................comingsoon
HAYINGEQUIPMENT
NHRB560(2015)
New/TwineBaler(22,000Bales).....................................$59,000
NewHollandBR7090 RoundBaler.............................$35,000
NewHollandBR780 RoundBaler...............................$23,000
NewHolland664 RoundBaler.................................ComingIn NewHollandH7150
HaybineMo-Cow/2300Header...................................ComingIn NewHolland488 Haybine(2012)...............................$16,000 JohnDeere945 Discbine.............................................$35,000 KubotaDMC85400T Discbine.....................................$28,000
MISCELLANEOUS EQUIPMENT
Degelman1800 SideArm................................................$13,000 Haybuster256PlusII BaleProcessor.....................ComingSoon MKMartin76in HydDriveSkidSteerSnowblower........................................$9,500
*Offervalidwith20%ofpurchasepricedown.Loadersandcabsarefactor yinstalled.Itemsmaynotbeexactlyasshown,accessories,attachments,andimplementscostextra.Taxes,set-up,delivery chargesnotincluded.PricesarebasedontheUSexchangeandmaybesubjecttochange.A documentationfeeofupto$349willbeappliedtoallfinanceofferings.Additionalfeesmayapply. Programsandpricessubjecttochangewithoutnotice. SeePrairieCoastequipmentforfulldetails.Somerestrictionsapply. Offervaliduntil Februar y28,2026.whilesupplieslast. Financingonapproved John DeereFinancialcreditonly. Limitedtimeofferwhichmaynotbecombinedwithotheroffers.QID#335791035075Ew/loader,
John Deere Expands Model Year 2027 Tillage Portfolio with New
Sizes and Autonomy
Ready Tools
Portfolio updates give farmers more ways to prepare fields efficiently.
OLATHE, Kan. (January 22, 2026)
John Deere (NYSE: DE) announced a series of model year 2027 (MY27) tillage updates, expanding its portfolio and offering customers more flexibility across a broad range of field and conditions and operation sizes. The updates include the introduction of 2-section High-Speed Disk (HSD) models in four new widths, expanded autonomy ready options across rippers and field cultivators and updated naming for the DA Series applicators. Building upon proven durability of John Deere tillage implements, these updates will help farmers improve productivity, manage residue and reduce passes.
“The new expanded John Deere tillage portfolio reflects what we continue to hear from farmers — the need for tools that fit their operation, acres and timeline,” said Michael Porter, John Deere marketing manager for tillage equipment. “From new
sizes to expanded autonomy ready options, these updates provide customers with more ways to complete critical fieldwork efficiently during tight post-harvest and pre-planting seasons.”
High-Speed Disk Portfolio Expands With New 2-Section Models
Launched in early 2025, John Deere is building on its HSD lineup by delivering new 2-section models available in 15, 19, 22, and 25-foot widths. With the new sizes, customers can expect the same dual-season performance, excellent residue management and field finish while gaining more flexibility for smaller acreages, transport limitations and varying tractor sizes.
The 2-section HSDs will stay true to the features of the larger models by coming autonomy ready from the factory and featuring the same durable frame design and improved residue flow to help operators cover more acres per day without sacrificing performance.
“We heard from customers who needed the benefits and performance of the highspeed disk in a more compact option,” Porter said. “The new 2-section options in smaller widths deliver that flexibility while maintaining the field finish that define the HSD lineup.”
Expanded Autonomy Ready Tillage Options
As farmers search for ways to continually improve productivity and efficiency while combating labor shortage pressures, John Deere continues to expand autonomy ready tillage solutions to help meet their needs. For 2026, autonomy ready capability is now available on the 2730 combination ripper and the 64’ and 69’ models of the 2230 field cultivator, giving customers more options to integrate autonomous tillage into their operations.
John Deere’s autonomy ready tillage tools are designed to seamlessly integrate with autonomous-ready tractors to help customers prepare for the future of field operations while relying on the agronomic performance they traditionally rely on.
Customers with 2016 or newer 2730 combination rippers can update to autonomyready through a John Deere Precision Upgrade kit. These kits provide a cost-effective way to enhance existing machines delivering greater flexibility. Combination ripper upgrade kits will be available for order starting in summer 2026, while field cultivator kits are available today, giving customers the opportunity to begin integrating advanced technology into their operations immediately.
Updated DA Series Naming Aligns Applicator Portfolio
To better align their applicator portfolio with the broader tillage portfolio, John Deere is also updating the naming of its DA Series Applicators, formerly known as the 2510H. While the name might be new, customers can continue relying on the same proven performance they are used to across multiple seasons.
“John Deere continues to listen to our customers by expanding and aligning the tillage portfolio to meet the needs of operations of all sizes,” Porter said. “With the MY27 updates, we continue to deliver proven durability, increased flexibility and technology-ready solutions that help farmers maximize productivity.”
To learn more about the entire John Deere Tillage portfolio, visit JohnDeere.com or contact your local John Deere dealer. NH
Advertiser at a Glance
CROSSBRED commercial bulls, semen-tested, vet inspected, vaccinated, free delivery in Peace Country. 780-836-0117 or 780-8360552.
REGISTERED POLLED HEREFORD bulls. Sementested, vet inspected, vaccinated, free delivery in Peace Country. 780-8360117, 780-836-0552.
2 YR OLD registered red simmental bulls for sale by Private Treaty. 780-354-8842 or 780-814-2567.
(50) BLACK ANGUS and Angus/Hereford cross cows. Bred to Black Angus & Hereford bulls. April/May calvers. Preg-checked Nov. 28. Will feed to February. Info 250-263-5871.
LOOKING FOR A female Lassie Collie or Sheltie for farm pet. Call Jake 780-9273638.
SPEED CONTROLLED RUBBER finger chicken plucker for sale, call 780772-6544.
FOR SALE: Big horn roping saddle. Padded seat, bridle included, asking $500 OBO. Call 780-354-3435.
CANADIAN ARCOTT
YEARLING ewes bred for February. Open ewe lambs, can deliver. Donald Johnston 780-837-1770.
CANADIAN ARCOTT
YEARLING ram, ram lambs for sale, can deliver. Call Donald Johnston, Donnelly, 780-837-1770.
LOOKING FOR a 1980-87 cab for International 1854 3tonne truck. Call Abe 780841-4740.
1950'S ERA FORD truck found when clearing brush. For details and pricing, call 780-772-6544.
1975 FORD 8000 w/B&H, 6V "Jimmy" engine, 13spd transmission, not running. 780-836-2107 or 780-6189161.
LOOKING FOR AN older (70's era) single axle water truck with spray bar. 780523-1488.
LOOKING FOR old or used reefer vans. Call/text 780926-6789.
HTS WESTERN SNOWBLADE, like new, 7'6", fits any pickup truck. C/w all accessories. 780814-2567.
SNO-CO 30" ROTARY separator. Call Ed 780-6189161 or 780-836-2107.
ALLIED 794 FEL, fits JD 4240/4440, with HD bale spear. $5,000. 780-831-4233 or 780-766-2538.
CAT D8H dozer blade for sale. Hydraulic tilt on one side. Call 780-618-9161 or 780-836-2107.
1800
on
250 3”-4” x 7ft fence posts for sale. $3.50 each. Call Doug 250-219-4139.
DOUBLE D FENCING avail. for your barb wire, page wire & plank fencing needs.
BUILT RIGHT SHEDS. Building quality shelters. Call John 780-835-1908 for your quote today. VALLEE FORESTRY BIG Red Portable Sawmill, undercarriage, and trailer. Call for price and details. 780-926-6087.
LOOKING FOR 4" or 6" grain bucket elevator legs, 25'-30' in height. Call Edwin 780-285-4680.
CLEAN 2,000 GALLON poly tank with valve. Asking $2,000.00. Call 250-2610251.
LOOKING TO LEASE farmland in the GP/Sexsmith/Teepee Creek area. Contact David to discuss options. 780-9786768.
1958 FARMHOUSE TO be moved by mid-April 2026. 950 sq.ft., $30,000 OBO. 250-569-7509, Grimshaw, AB.
LAND AND BUSINESS OPPORTUNITY, remote 20 acres on pavement. Unfinished hwy lodge, gardens. Duane 250-2325400.
HONDA 300 4x4 quad for sale. Needs some work. Call 780-835-0452 or 780-6852624.
Buying Antiques: Coins, toys, advertising, tools & more. Will buy bulk. Call/text 780832-8216.
MILITARY BUILT CAT D8 dozer. Includes blade & winch, taking offers. 780523-1488.
WALL FRAMING TRAILER, on wheels. Deck screws out to 8’. 780-772-6544.
Dismantling cultivator, disc, and plows for parts. Some air drills. 780-831-6747.
FRONTIER LL1396, 8' drawn box blade w/Scarifier, 2 yrs old, purchased new. 780-837-6457.
1981 HONDA 185 XL, enduro, excellent shape, always covered, $3000. 250219-4139.
FORAGE SEED OATS. Grown from Mustang. Delivery available. Call 250782-0220. UPRIGHT PIANO for sale. Taking offers, For more information or pricing, call 780-772-6544.
WANTED WAFFLE IRON cast iron with five hearts. Call Ernest 780-926-9412.
WANTED: BARLEY, WHEAT and oats for feedlot. Can pickup with Super B. Gary 780-518-3992.
sqft home
QTR/section, f/basement, 400 sqft upper bedroom, 1 bath. 780-971-2592 after 6PM.
DAMAGED GRAIN BUYING:
an 26
GREENFEED OAT BALES for sale, 1150 lbs., no rain, put up in August, $50/bale. 403-886-2088.
1971 UTB 65 HP 4WA, diesel, 3 new tires, 661 hrs, excellent condition, $6000, 780-971-2592.
WANTED: 4 or 5 bottom pulltype Moldboard plow. Auto Re-Set, colour doesn’t matter. Call 250-719-4967.
2011 NH BR7090 round baler, mega-wide pickup, excellent condition, $27,000. Call Doug 250-219-4139.
16' HEAVY DUTY bale frame. Needs hitch, would make excellent bale wagon. Call 780-772-6544.
3/4T AUTOSTEERING bale wagon for sale. For more details and pricing call 780772-6544.
CASE IH CX100U, FWA, FEL/bucket, new turbo, new injector, needs clutch cable. 780-835-0452 or 780-6852624.
Every issue of AgDealer brings you hundreds of the latest new and used farm equipment listings from your region. The AgDealer app brings you all the photos and details for each piece of equipment from across the country. Scan the code to see the latest deals.
WANTED: JOHN DEERE Model 80 tractor for parts. Call 780-814-0523.
DanPrzybylski SalesMgr.
Canada Approves Pigs Resistant to Porcine Reproductive and Respiratory Syndrome Viruses for Use in Food and Feed
Health Canada, January 23, 2026
Porcine reproductive and respiratory syndrome viruses (PRRSV) are one of the most devastating classes of viruses affecting farmed pigs, representing significant losses for Canada’s producers and higher prices at the store for Canadian consumers.
Today, Health Canada and the Canadian Food Inspection Agency (CFIA) announced the completion of independent, comprehensive safety assessments on pigs resistant to PRRSV following applications from Genus PLC and PIC Canada, Ltd., respectively. Health Canada has concluded that foods made from these pigs are as safe and nutritious for people to eat as pork currently available in Canada. The CFIA has confirmed that these
pigs are also safe and effective for use in livestock feeds.
Improving resistance to PRRSV in pigs will help farmers avoid illness in their herds from these viruses, reduce antibiotic use, and improve animal welfare, while supporting a more stable, affordable and sustainable food supply.
Genus PLC’s PRRSV-resistant pigs are already permitted for food use in the U.S., Brazil, Colombia and the Dominican Republic. Genus PLC has indicated that even though Canada has approved the sale of PRRSV resistant pigs, the company does not intend to sell these pigs before further regulatory authorization in other key markets. The company and Health Canada are committed to the highest level of transparency and will communicate to the public when this new technology enters the Canadian market.
While genetically engineered foods are considered as safe and nutritious as conventional foods, the Government of Canada recognizes that information about genetic engineering is important. That is why we have been working with the Canadian General Standards Board since November on a public review of the National Standard for labelling and advertising of foods that are, and are not, products of genetic engineering. The CFIA uses this Standard to provide its guidance to companies on the labelling of foods.
Quick facts
• In 2024, the swine industry generated over $6.3 billion in farm cash receipts and Canada produced 2.34 million tonnes of pork and exported 1.45 million tonnes of pork.
• As of January 1, 2025, there were 13.9M hogs on 6,885 Canadian farms.
• PRRSV infections can cause severe symptoms in pigs like breathing problems, fever, the inability to eat, and can lead to stillborn piglets and death.
• There are currently no effective treatments, and vaccination has only been partially effective.
• In Canada, food labelling is required when there are well-established health risks or significant changes to the nutritional qualities of the food. For example, an allergen in a food must be labelled to alert consumers of the risk.
• Because Health Canada found no health and safety concerns, no special labelling is required for foods from these PRRSV-resistant pigs.
• In addition to the assessments noted above, in December 2025, the New Substances program— jointly administered by Environment and Climate Change Canada and Health Canada—determined that environmental and human health risks from indirect exposure to these pigs is no different from pigs currently available in Canada. NH
New Rules Boost Water Storage and Conservation
Alberta’s government is making it easier for farmers, ranchers, communities, businesses and emergency responders to store and use water.
New and expanded Water Act exemptions will increase water availability, improve conservation, support agricultural production and help protect communities from future emergencies.
Currently, many dugouts are sized too small to capture available water because of a 2,500 cubic metre exemption limit. Effective immediately, farmers and ranchers can fill their dugouts up to 7,500 cubic metres – triple the previous limit – provided the water is used for agricultural purposes. This change helps protect them from future droughts and supports strong agricultural operations.
“Albertans asked for practical improvements to make more water available, and we’re delivering. These changes make it easier for farmers, businesses and communities to access and store water. It’s good for communities, the environment and the economy.” Grant Hunter, Minister of Environment and Protected Areas.
“Reliable access to water is essential for Alberta’s farmers and ranchers, especially as they manage drought risk and plan for the future. These practical changes respond directly to what producers and rural communities have been asking for – making it easier to store and use water responsibly so agricultural operations can remain strong, resilient and productive.” R.J. Sigurdson, Minister of Agriculture and Irrigation Alberta’s government is also making it easier for
communities and businesses to use less fresh water by using stormwater instead. Under the new exemptions, a newly constructed wetland will also be able to capture and fill with up to 7,500 cubic metres of local surface runoff per year. That’s a 1,250 cubic metre increase from the previous limit, supporting more wetlands across the province.
Other changes include making it easer to:
• Use water for bridge, sign washing and dust control.
• Supply water to a temporary work camp.
• Access water from borrow pits on unoccupied public land in the Green Area.
As demand for water increases across our province, Alberta’s government is modernizing the water management system to ensure we meet the challenges of today. Recent improvements include passing the Water Amendment Act, which removes the requirement for riparian restoration projects to get a temporary diversion licence for watering plants, while also ending the unnecessary 10 per cent holdbacks on most water licence transfers, giving Albertans more freedom to water.
Quick facts
• New exemptions:
- Up to 100 cubic metres per source per day for fire prevention and training activities related to firefighting and spill response (water used for active firefighting has long been exempt under
the Water Act).
- Up to 1,000 cubic metres per day for water accessed from borrow pits on unoccupied public land in the Green Area, provided there are no fish present and no connection to a wetland or watercourse.
- Up to 100 cubic metres per source per day for bridge and sign washing, and dust control.
• Expanded exemptions:
- Water use from a dugout has been increased to 7,500 cubic metres per year, while dugouts up to 7,500 cubic metres in size may be built with no approval required under the Water Act. These exemptions must only be used for agricultural purposes.
- Annual use from stormwater ponds of up to 7,500 cubic metres with an outflow or up to 15,000 cubic metres with no outflow are now exempt from licensing requirements.
- The wetland construction exemption has increased to 7,500 cubic metres.
- The exemption for water use by temporary camps has increased to 2,500 cubic metres per year. NH
ALBERTAJUNIORHOCKEYLEAGUE 2025-2026SCHEDULE &STANDINGS
REGULARSEASON
Fri,Dec197:00p.m. GRANDEPRAIRIE CanmoreCanmoreRecCentre
Sat,Dec205:00p.m. GRANDEPRAIRIE CalgaryKenBrackoArena
Fri,Jan2 7:00p.m. GRANDEPRAIRIE Bonnyville R.J.LalondeArena
Sat,Jan3 7:00p.m. GRANDEPRAIRIE LloydminsterCenovusEnergyHub
Thurs,Jan8 7:00p.m.FortMcMurray GRANDEPRAIRIE
Sat,Jan106:00p.m.FortMcMurray GRANDEPRAIRIE
Sun,Jan112:00p.m.FortMcMurray GRANDEPRAIRIE
Sat,Jan176:00p.m.Drumheller GRANDEPRAIRIE
Sun,Jan182:00p.m.Drumheller GRANDEPRAIRIE
Bonnett’sEnergyCentre
Bonnett’sEnergyCentre
Bonnett’sEnergyCentre
Bonnett’sEnergyCentre
Bonnett’sEnergyCentre
Fri,Jan237:00p.m. GRANDEPRAIRIE LloydminsterCenovusEnergyHub
Sat,Jan247:00p.m. GRANDEPRAIRIE Bonnyville
Fri,Jan307:00p.m.Camrose GRANDEPRAIRIE
Sat,Jan316:00p.m.Camrose GRANDEPRAIRIE
R.J.LalondeArena
Bonnett’sEnergyCentre
Bonnett’sEnergyCentre
Wed,Feb4 7:00p.m. GRANDEPRAIRIE DevonGFL TwinArena
Sat,Feb7 6:00p.m.Calgary GRANDEPRAIRIE
Sun,Feb8 2:00p.m.Calgary GRANDEPRAIRIE
Bonnett’sEnergyCentre
Bonnett’sEnergyCentre
Fri,Feb137:00p.m.Whitecourt GRANDEPRAIRIE Bonnett’sEnergyCentre
Sat,Feb147:00p.m. GRANDEPRAIRIE Whitecourt JDAPlace
Sun,Feb222:00p.m.Devon GRANDEPRAIRIE Bonnett’sEnergyCentre
Tues,Mar 37:00p.m.Whitecourt GRANDEPRAIRIE Bonnett’sEnergyCentre
Fri,Mar6 7:00p.m. GRANDEPRAIRIE Whitecourt JDAPlace Mon,Mar9 7:00p.m. GRANDEPRAIRIE DevonGFL TwinArena
Tues,Mar107:00p.m. GRANDEPRAIRIE DevonGFL TwinArena
Fri,Mar137:00p.m.Drayton Valley GRANDEPRAIRIE Bonnett’sEnergyCentre Sat,Mar146:00p.m.Drayton
NORTH/SOUTH–SexsmithVipers(4)vsLaCreteLumberBarons(1) Game1Sat, Feb7Vipers(2) LumberBarons(5) Game2Sun, Feb8Vipers(2) LumberBarons(7) Game3 Fri, Feb138:00p.m. LumberBaronsVipers Game4Sat, Feb148:00p.m. LumberBaronsVipers Game5Mon, Feb167:00p.m. LumberBaronsVipers
NORTH/SOUTH-CtyofGrandePrairieWheatKings(3)vsBeaverlodgeBlades(2) Game1 Wed, Feb4WheatKings(5)Blades(3) Game2Sat, Feb7Blades(1) WheatKings(6) Game3Sun, Feb8WheatKings(5)Blades(4) Game4Sat, Feb148:00p.m. BladesWheatKings Game5Sun, Feb152:00p.m. WheatKingsBlades
EAST/WEST- FairviewFlyers(4)vsFortSt.JohnHuskies(1) Game1Fri, Feb6Flyers(4) Huskies(5) Game2Sat, Feb7Huskies(3)Flyers(4) Game3 Tues, Feb108:00p.m. FlyersHuskies Game4 Fri, Feb138:00p.m. HuskiesFlyers Game5Sat, Feb148:00p.m. FlyersHuskies
EAST/WEST-DawsonCreekKodiaks(3)vsNorth PeaceNavigators(2) Game1Fri, Feb6Kodiaks(2)Navigators(5) Game2Sat, Feb7Navigators(6)Kodiaks(5) Game3 Wed, Feb118:00p.m. KodiaksNavigators Game4Sat, Feb148:00p.m. Navigators Kodiaks Game5Sun, Feb153:00p.m. KodiaksNavigators SEASONSTANDINGS(asofSunday,February8,2026)
EAST/WEST Huskies5939299121-0210114+96.756 Navigators45402116310-3188182+6.563 Kodiaks27401225310-2135204-69.338 Flyers1240533211-0120266-146.150 NORTH/SOUTH LumberBarons7340363121-0258118+140.913 WheatKings45402217122-0168149+19.563 Blades45402217120-0196193+3.563 Vipers29391222501-1126175-49.372
Location:LaCrete,AB Live,Online,AbsenteeBidding June13,2026
S/AGrainTruck-1981F600Ford S/AGrainTruck -1976F60Ford S/AGrain Truck -JohnDeere 100030'Vibrashank- JohnDeere12'DeepTillageMelroe923-8188-BottomPlow- Blanchard50'HarrowPackerBar- NewHolland Side DeliveryHayRake -JohnDeere 224StraightCutHeader- Westfield1081 SwingoutAuger -Westfield741Augerw/Honda Engine -LikeNewMiller211 Welder-4000PSIWasher- Generators,Misc Toolsandmore
Location:LaCrete,AB Live,Online,AbsenteeBidding
Tractor -SwingAuger -HeavyHarrow -FrontierOff-SetDisc -Premier Swather -HeaderTransport -4BottomBreakingPlow -FuelTanks -Winchester30-30 .22BoltAction -Tools -Householdandmuchmore
Groundbirch 4-H Multi Club Discover Beef & Sheep Digestive Systems
Submitted by club Reporter Addison Martell, January 25, 2026
On January 25, 2026 our 4-H club got to do some hands-on learning during our monthly meeting. Arduini Meats from Progress, BC, donated a cow stomach and a pig stomach for some of our members to learn from. The Cloverbuds learned about the pigs stomach and how its digestive system works. The sheep and
Yard,5kms(3Miles) WestofDeBolt,AB April17th,2026toApril20th,2026
SaleStarts12Noon,Friday,April17th,2026
SaleStartsClosing11a.m.,Monday,April20th,2026
ViewingAvailable Tuesday, April14th toThursday,April16th
TerryThiessen(780)876-2379
Email:albertanorthauctions@gmail.com Website:abnorthauctions.com
beef members learned about the beef stomach and pig stomach and how the digestive system works for Ruminant animals (animals with 4 stomachs) . The beef and sheep members were also able to do experiments to learn about how each of the four stomachs work. A big thank you to Arduini Meats for the generous donation and giving our club a chance to learn about ruminant digestive systems. NH
For alimitedtime,get0%orlow-ratefinancingontheallnew2024 and2025Versatiletractorsandtillageequipment.Don’tmissthis opportunitytomaximizeperformancewithoutstretchingyourbudget. Thislimitedtimeoffersendssoon.Terms &Conditionsapply.Contact yourFoster’sAgri-WorldSalesRepformoreinformation. www.versatile-ag.com
