Skip to main content

Star Weekly - Hobsons Bay Maribyrnong - 29th October 2025

Page 1


Sinful fun in Footscray

Footscray will play host to electrifying magic, burlesque, fire, circus, and more this Friday night as the hugely popular Halloween-themed cabaret show, Sins of the West, returns for 2025.

Held at a well-known LGBTQ+ venue Pride of Our Footscray, Sins of the West is a 90-minute show hosted by Cassidy La Creme and featuring some of Melbourne’s best cabaret performers. If previous years are any guide, patrons should prepare to witness anything on stage, with angle grinders, sword swallowing, even a live snake featuring in the past.

In order to avoid missing any of the action, audience members are encouraged to arrive, order drinks and be seated before the show starts at 8.30pm on 31 October.

Once the show is over, they can stick around afterwards for a late night boogie on the dance floor and to enjoy some more spooky drag shows from Sam T and LUMA.

Tickets are on sale now at: https:// www.trybooking.com/events/ landing/1093075

Tunnel stack fight

A cabinet minister and local campaign group have traded insults following the releaseofdamningreportintotheexhaust stacksbeingconstructedfortheWestGate Tunnel. The report commissioned by Maribyrnong Truck Action Group (MTAG) founddesignflawsinthetunnel’sexhaust stacks would result in thousands of residents in the inner west being exposed to harmful pollution, despite the tunnel beingbuilttoremovetrucksfromtheroads andimproveairquality.

The report conducted by Synergetics Consulting Engineers and released on

Tuesday 21 October, found the stack’s cosmetic design flourishes would create a downwash effect, pushing pollution towards nearby homes in Altona North and Yarraville where both are located.

Yarraville resident Sarah Tartakover lives in Princess Street, a short distance from the tunnel’s northern stack, and saidtheresultsofthereportmadeherfeel betrayed.

“For seven years we’ve put up with the inconvenience (from the tunnel construction) in good faith that we will be better off, that our lives will be better off, that our health will be better off,” Ms Tartakovasaid

“Ifeellikewe’vebeensoldalie.”

MTAG president Martin Wurt said the findings were alarming and again highlighted the need for filters to be installed in the stacks before the tunnel opensinDecember.

“Theseunfilteredstackswillcreateeven higherratesofhospitalisationsforasthma, cardio-vasculardisease,strokesandheart attacks.

“Enoughisenough!”

However, Williamstown MP and Roads Minister Melissa Horne fired back at MTAG, accusing the organisation of spreading disinformation and not providing the government with a copy of thereport.

“No other government has invested more to improve air quality across Melbourne’s west,” Ms Horne declared before listing a range of initiatives the governmenthadundertakentotacklethe problem.

She said numerous environmental and health assessments had found the tunnel would improve air quality and dismissed demandsforfilterstobeinstalled.

“No tunnels in Australia include filtrationsystems.

“Expert assessments have found that filtration is not required for the West Gate Tunnelventilationsystem.”

Rhiannon Thompson (front), Cassidy La Creme, Benni Hutton, producer Angelina Lester and Kitten Kaboodle are all taking part in Sins of the West, a Halloween extravaganza at Pride of Footscray this Friday night. (Damjan Janevski) 512424_01

Grand sale for Grand Theatre

A unique piece of Footscray’s cultural history has hit the market.

The former Footscray Grand Theatre at 8 Paisley Street, Footscray, has been listed for sale, offering prospective buyers the chance to restore the landmark building to its former glory.

Originally opened in 1911, the Grand Theatre was one of Melbourne’s earliest suburban cinemas, renowned for its impressive scale.

The venue entertained generations of locals before closing its doors in 1987,

marking the end of an era for Footscray’s entertainment scene.

In the decades since, the building sitting above the Paisley Street bus interchange has largely receded from view, with panelling over its facade leaving many locals unaware it even exists.

But with the 844 sqm theatre now up for sale, that looks set to change, with bids of up to $2 million expected.

Savills Australia and New Zealand is handling the sale through agents Julian Heatherich and Beau Bakhtani.

MrHeatherichsaidthepropertywould appeal to buyers who recognise the cul-

tural and architectural importance of the building and see value in bringing it back to life.

“The Grand Theatre is in need of work, but its bones and history are remarkable,” he said.

“This is an opportunity for an astute buyer to breathe new life into one of Melbourne’s most character-filled buildings and reimagine it for the next generation.”

Mr Bakhtani said the theatre would attract strong interest from creative and design-led purchasers.

“Footscray is going through a period of transformation, and sites like this – rich

A pocket full of art in a Yarraville garage

An empty garage was the inspiration behind Yarraville’s newest, and possibly smallest, art space.

Friends Peta Ferguson and Patricia Stewart have opened a tiny art gallery in Peta’s Yarraville garage.

Dubbed Art Pocket, the gallery is open Saturdays, from 11am to 2pm, at 223 Somerville Road, Yarraville.

The friends have known each other for more than 30 years after meeting at Church of Christ in Gordon Street, Footscray.

The gallery boasts a collection of Patricia’s paintings and photographs, some framed, some not.

The plan is to donate any proceeds to charity.

“Patricia needed somewhere to store all her artwork. I had an empty garage so we transferred all her work and once again the shed became a useful space,” explained Peta.

“From there, things evolved. I have what’s known as an acquired brain injury (ABI) which in my case means wonky speech and impaired gait amongstotherthings.OriginallyIwasina wheelchair completely mute for five years so this is an improvement!

“Patricia is very caring and tolerant and she listened to me as I complained of the complete level of ignorance in the community about ABI.

“One can sustain a head injury in all sorts of ways – car accident, fight, fall, stroke, overdose, playing sport, you name it. You could get a head injury tomorrow. There is an organisation, Brain Injury Matters, dedicated to raising community awareness. It was responsible for making me see there was life after head injury, not only not only that, it could be great.”

The friends will donate 100 per cent of proceeds to charities of their choice, including BIM, and will endeavour to open Art Pocket each Saturday until Christmas.

More Techno Park residents allowed to stay in their homes

More residents at the Techno Park estate will be able to remain in their homes after Hobsons Bay council issued certificates of compliance to another 25 properties at the Williamstown site.

Council issued the certificates to occupants of blocks four and 12 at the estate on Friday 17 October after they proved the properties had been continually used for residential purposes for 15 years. It follows certificates of compliance being issued to residents of block 11 in June, meaning those living in three of the estate’s five blocks have had their

existing use rights recognised, allowing them to stay regardless of zoning laws.

In May 2023, the then-Hobsons Bay council used zoning laws to try to evict residents of the former migrant hostel, arguing it was on zoned industrial land and that nearby fuel storage tanks posed a safety risk.

After a fierce public backlash, the eviction attempt was withdrawn and residents were invited to apply for certificates of compliance by proving they’d lived there for an extended period.

“Working together, residents

in history yet ready for renewal – are incredibly rare,” he said.

“Whether it’s restored as a creative venue, hospitality space or adapted for mixed use, 8 Paisley Street has the potential to become a landmark once again.”

The announcement of the sale sparked interest on local Facebook groups, with some calling for it to be turned into a live music venue or returned to being a cinema.

Derelict and empty buildings have long plagued the Footscray CBD and are considered a factor in the rising in crime and anti-social behaviour in the area.

Laverton steel workers strike

Workers at a Laverton steel mill walked off the job on Friday after negotiations over a new enterprise agreement broke down.

Australian Workers Union (AWU) members at InfraBuild’s Laverton steel mill will began rolling industrial stoppages from 6am on 24 October, after rejecting what the union called “a sub-standard enterprise agreement”.

The decision to go on strike was taken following a mass meeting of members last week where the union claimed support for industrial action was “unanimous and emphatic”.

The union and InfraBuild have been locked in negotiations over a new enterprise agreement since 2021, but AWU metro lead organiser Dave Swan said the time to strike had come.

“After four years of disputes, safety failures, and wages falling behind, our members have reached their limit,” Mr Swan said.

“They’ve decisively rejected Infrabuild’s enterprise agreement. The message is clear; workers deserve a genuine offer that reflects the current cost of living.”

As well as wages that keep pace with cost-of-living increases, the AWU also wants improved workplace conditions at the Laverton mill after what it claims are years of safety failures.

A spokesperson for InfraBuild said the company would continue to negotiate in good faith with the union.

InfraBuild’s Laverton mill manufactures steel products from recycled scrap metal and claims to be the largest such site in the country.

Despite this, the spokesperson for the company said the Australian steel industry was facing challenges from an over supply of steel coming into the country.

“Steel prices continue to be impacted by increased market uncertainty and European and US trade policy announcements.

“Even with these pressures, InfraBuild is proud and committed to maintaining a strong sustainable local steel manufacturing industry in Australia and has been regularly engaging with the union.”

across the street collected more than 200 pieces of evidence for these two applications, including statutory declarations by past and current residents and their friends and neighbours, photos of their homes, home loans, phone bills, pet registrations, real estate listings advertising bedrooms and kitchens, and voter enrolments going back to the 1990s,” read a social media post from campaign group Save Techno Park after the latest applications were approved.

Applications for the remaining blocks are expected to be submitted soon.

However, the AWU accused InfraBuild of importing foreign steel themselves, undermining their workers in the process.

“Every tonne of foreign steel imported into Australia weakens our manufacturing industry, undercuts Australian jobs,” AWU Victoria state secretary, Ronnie Hayden said.

The AWU said its members would remain on strike until InfraBuild made an improved offer.

Peta Ferguson surrounded by Patricia Stewart’s art work in their garage gallery. (Supplied)

Height backlash

The state government is facing growing opposition to its proposal for high rise housing around inner-west train stations, with Maribyrnong council joining local residents demanding building height limits be lowered.

In draft plans released by the state government last month, apartment buildings of up to 12 storeys would be permitted along Barkley Street as part of the housing activity zone around West Footscray station, while a maximum of six storeys would apply along Victoria Street in Seddon as part of the Middle Footscray station activity zone.

The limits are substantially higher than the maximum allowed under neighbourhood plans for both suburbs, which Maribyrnong council is now asking the state government to revert to.

In its submission to the housing activity centre program due to be tabled at a meeting on Tuesday night after deadline, Maribyrnongcouncilwantsthemaximum height allowed in the West Footscray zone cut from 12 storeys to six and Middle Footscray reduced from six stories to four.

The submission, which still needs to be endorsed by council before being sent to the state government, follows a petition launched by a group of West Footscray residents who also want the maximum height allowed along Barkly Street to be cut in half.

The Change.org petition, which had 107 signatures at time or writing, argues 12-storey buildings would overshadow existing homes, parks and streets in the area,

reducingwintersunandoverallliveability.

The petitioners also want rules around affordability and design to be included and for community feedback to taken seriously, accusing the state government of ignoring their concerns about the proposed heightlimitsduringpreviousconsultation.

One of the petitioners, West Footscray resident Steve Khoury, said their opposition was to the proposed height limits, not more housing.

“We support growth and new residents,

but 12-storey towers are not the answer,”

Mr Khoury said, adding that six storeys had already been identified as the appropriate height limit for the area.

“This would still allow for significant new housing while protecting sunlight, parks, and neighbourhood character.”

A spokesperson for the state government said the government was building more homes near train stations so more people could benefit from the soon-toopen Metro Tunnel.

Bridge works to keep west moving

While the West Gate Tunnel will soon provide motorists from Melbourne’s west with a second Yarra River crossing, the first is also getting an upgrade, with the West Gate Bridge currently undergoing maintenance works.

The $24 million maintenance program includes full inspections of key bridge structures, laying down asphalt on the road and applying protective coating to concrete piers.

The package of works is aimed at reducing the need for unplanned closures, minimising disruption to road users, and ensuring additional load restrictions for freight and heavy vehicles are not required.

Williamstown MP and Roads and Road Safety Minister Melissa Horne said despite the West Gate Tunnel opening in December, the almost 50 year old bridge remained as important as ever.

“As the West Gate Bridge reaches its 47th year of service, it continues to serve as a lifeline for our freight, tourism and port industries, and an essential part of the state’s transport network,” Ms Horne said.

“The West Gate Bridge is a Victorian icon, which is why we are continuing to invest in its maintenance to keep it standing strong for decades to come.”

fun at Yarraville Gardens with entertainment, food and info stalls.

We’re getting ready to open the West Gate Tunnel. You can walk or run through parts of the tunnel, or come along to enjoy the free family friendly festivities at Yarraville Gardens. Register for the once-in-a-generation opportunity to explore the new road before it opens.

West Footscray residents (from left) Steve Khoury, Jay Morgan and Justine Moore are opposed to plans to allow 12 storey buildings to be built along Barkly Street. (Ljubica Vrankovic) 511776_01

New future for old factories

OldfactoriesandindustrialsitesinHobsons Bay should be revitalised and turned into hubs for advanced manufacturing, clean energy and mixed use employment.

That’stheviewoftheWestofMelbourne Economic Development Alliance (WoMEDA), an independent, not-for-profit organisation that includes local councils, institutions and other stakeholders, which has outlined its vision for the region in a report.

Released last week to coincide with WoMEDA’s West of Melbourne Summit on 22-23October,thereport,WesternGrowth: Unlocking Melbourne’s Economic Engine,

advocates for Hobsons Bay to play a bigger role in the region’s future, particularly in the development of new industries.

Rather than being symbols of the past, the report argues that old industrial sites such as the former Toyota car assembly plant and the Exxon Mobile and Qenos refineries in Altona, could serve as launching pads for industries of the future.

“Vacant sites present an opportunity for ambitious industrial and commercial revitalisation,” the report said, highlighting the Toyota Centre of Excellence being built where the car manufacturer’s old assembly plant once stood and an intermodal freight and logistics hub planned for the

Qenos site, as examples.

“Their transformation could serve as a catalyst for broader renewal across the West of Melbourne industrial zone.”

A spokesperson said the state government was working with Hobson’s Bay council and other agencies to unlock more land for development.

Hobsons Bay council was contacted for comment.

Maribyrnong was also mentioned in the report, with the new Footscray Hospital, the development of Whitten Oval the proposed Creative West cultural centre predicted to attract further investment.

Maribyrnong mayor Pradeep Tiwari

509046_02

Friends join forces for joint art exhibition

After first meeting a year ago and then recently bumping into each other at Altona’s Louis Joel Gallery, artists Julee Latimer and Dovey Dee came up with a novel idea: a joint exhibition at, you guessed it, Louis Joel Gallery.

At the beginning of next month that idea will become a reality when Latimer and Dee’s exhibition, ‘Echoes of Elsewhere’ opens at the the Louis Joel Arts and Community Centre. “We have vastly different artistic styles and approach-

es yet we both explore aspects of place,” said Latimer of their work.

While she is based in Altona, for Latimer –- a professional artist who has works in permanent public collections in Sydney, Singapore, and Chicago–the exhibition will represent something of homecoming. “It has been approx. 15 years since I exhibited locally so I am looking forward to show my latest work in my suburb,” she said.

Dee on the other hand has only re-

turned to painting since retiring from her career as data scientist working in environmental engineering. Also a furniture maker, Dee’s artwork focuses on the beauty of the Australian landscape, paintingprimarilyinoilpastelsinpleinaire and then finalising them in oil paint on canvas in the studio.

And beginning with an opening event on Saturday 1 November Dee’s and Latimer’s paintings will be on display to the public until 12 November.

Split Second Competition back to spread road safety message

The state government and the Transport Accident Commission (TAC) are offering young Victorians the chance to use their creative skills to spread the road safety message and save lives.

The Split Second Competition, which invites Victorian creatives aged 18 to 30 to submit their attention-grabbing concepts for road safety campaigns aimed at young drivers.

This year the competition is open to filmmakers and content creators and will include two winning entries, each receiving a $5,000 cash prize and a pro-

duction budget of $45,000 with a focus on low-level speeding or not wearing a seatbelt.

The two winners will also receive mentorship from Truce Films and creative agency TABOO.

Low level speeding is a major factor contributing to trauma on Victorian roads, even at lower levels with around 25 per cent of deaths and serious injuries on our roads involving people travelling 1-10 km/h over the limit.

Seatbelts are a focus of the competition for the second consecutive year,

said council was proud to contribute to WoMEDA and had also used its membership or the organisation to advocate for improved public transport too.

“Council has called for a dedicated interchange in Footscray CBD to connect buses, trams and trains, enhance connectivity, support sustainable growth and improve the commuter experience,” Cr Tiwari said.

“We are also developing a new Integrated transport strategy and have recently provided feedback to the state government’s train and tram zone activity centre program to highlight the needs of our community.”

Homeless protocol added to local laws

Authorised officers in Maribyrnong will be trained in how to appropriately deal with homeless people as part of new local laws endorsed at a council meeting last week.

In amendments to the proposed local laws moved by deputy mayor Bernadette Thomas at the meeting on 21 October, authorised offices will be trained to act in accordance with council’s homelessness protocol when dealing with people who are sleeping rough.

The Maribyrnong Homelessness Protocol provides a framework for how to respond to people who are experiencing or at risk of homelessness, including how to provide them with the necessary information to access housing and support.

The amendment requiring authorised officers to be trained in the protocol comes as they are assisting private security guards in a six month trial aimed at reducing crime and improving public safety in the Footscray CBD.

During public question time at the meeting, members of the Footscray Community Response, an organisation opposed to the security trial, asked councillor’s if they still supported the initiative after claiming to have witnessed disturbing behaviour by some security guards.

All councillor’s replied that they did still support the trial, with Cr Thomas noting that changes had already been made and that anyone witnessing security guards acting inappropriately should contact council.

Cr Susan Yengi said she hadn’t heard of any disturbing behaviour by security guards, but had received a lot of positive feedback from residents and business owners.

Cr Yengi said the amendments requiring homelessness training and centring humans rights come about following “some really robust conversations,” among councillors.

The amendments and entire Community Local Law 2025 were eventually passed unanimously.

with road trauma data showing around a quarter of young drivers and passengers killed on the roads in the past decade were not wearing a seatbelt.

For the second time, one of the competition winners will be selected from a culturally and linguistically diverse community to ensure critical road safety messages are being tailored to engage as many young road users as possible across our multicultural state.

Entries are open until 9 November.

For more information visit tac.vic.gov. au/road-safety/split-second

Community consultation on the new local laws began in March, with the public showing strong support for stricter land use controls, enhanced heritage protections, and new smoke-free areas, while opposing a reduction in the number of registered cats and dogs allowed on a property.

“We appreciate the community taking the time to be part of this vital engagement process and shared your thoughts on what local laws should look like for the next ten years,” Maribyrnong mayor Pradeep Tiwari said in thanking those who contributed.

The new local laws take effect on 17 November.

Artists Dovey Dee (left, with greyhound) and Julee Latimer are holding a joint exhibition ‘Echoes from Elsewhere’ at Louis Joel Gallery in Altona from November 1-12. (Damjan Janevski)

Green steps

Caring for the environment is one of the many crucial roles council plays.

While council can lead the way through varioussustainabilityinitiativesandefforts, it’suptoeveryoneinourcommunitytotake small steps that can make a big difference.

On top of ongoing initiatives, there are a couple of specific events I’d recommend residents get involved with over the next month.

Across two weekends next month, the Garage Sale Trail comes to Hobsons Bay.

There will be garage sales right across our city on 8, 9, 15 and 16 November to explore.

KnownasAustralia’sbiggestsecond-hand treasure hunt, the Garage Sale Trail is a chance to give another life to pre-loved items.

Encouraging re-use of items is an importantwaytokeepthingsoutoflandfill, and even make some bonus money.

Last year alone, the trail kept 418 tonnes of assorted items in use and out of landfill.

There are more than 40 locations across HobsonsBay,sojumponlineathobsonsbay. vic.gov.au/GarageSaleTrailtoseewhereyou can find yourself a sustainable bargain.

Also coming up are a couple of days to drop off hard-to-dispose-of household waste.

On 8 November you can bring any electronic waste and soft plastics to Council’s operations centre in Altona.

Items like TVs, phones, computers and other electronic items can’t go in your rubbish bin at home as they can explode, catch fire and leach out substances that pollute the environment.

Instead, drop them off for free to clear

space at home, while also ensuring their parts are recycled and put to good use.

Onthesamedayyou’llalsobeabletobring in soft plastics. We know our community has been wanting a way to dispose of these rather than just putting in the general rubbish, so bring your plastic bags, chip packets, cling wrap and more (just make sure they’re clean before bringing them).

They will go off to a new soft plastics processing facility, to be recycled into new soft plastic.

Sustainable living is up to all of us, so get along to any of these events if you can to make a difference.

Briefs

Unit fire

Police are investigating a suspicious unit fire in Maidstone on Sunday morning. Fire crews arrived at the property on Alma Street at about 5.30am on 26 October where they found the rear unit on the two-unit property well alight. Crews quickly attacked the blaze to prevent it spreading to neighbouring properties. The sole occupant of the unit had already evacuated, as had and the resident of the adjoining unit. One resident was treated on scene by paramedics and transported to hospital. The fire was deemed under control at 6.07am. Police arrived to begin their investigation while the Department of Families, Fairness and Housing attended to arrange alternate accommodation for residents.

School fire

A fire at Bayside P-12 College in Altona North early on Saturday morning is being treated as suspicious. Firefighters arrived at the scene at about 3.30am on 25 October after callers to triple-0 reported a fire at the school. Crews found a building within the school grounds engulfed in flames and donned breathing apparatus to attack the blaze, bringing it under control by 3.45am. Police were then requested to attend the scene to investigate suspicious circumstances surrounding the fire.

FOR BREAKING NEWS, VISIT

Web: starweekly.com.au

Maribyrnong & Hobsons Bay Star Weekly @starweeklynews @star_weekly

Cr Paddy Keys-Macpherson. (Supplied)

An election to remember

Williamstown amateur historian Barb McNeill is Star Weekly’s history columnist. This week she tells the tale of a tense tussle over the seat of Melbourne Ports at the 1931 state election.

In 1931, politicians were making life miserable for everyone, what with diminished exports, government cutbacks, and Premier Lang’s reluctance to cough up the cash required to pay interest to Britain. The Great Depression was gnawing away at Australia, and Williamstown felt its bites keenly. However, when the legendary Phar Lap romped home to win the Underwood StakesatWilliamstown, everyonecheered up, though some gloomy souls predicted that this would be the last excitement for the year.

Their predictions were proved true and life resumed its dreary course. And then - William Howey came marching in from Port Melbourne, bursting with confidence that his credentials would ensure him glory in the forthcoming election. He was a returned soldier and a member of the recently formed United Australia Party. TheseatofMelbournePortshadbeenheld by Labor since 1906, but Mr Howey was 100 per cent certain that the electorate wouldgivethemthebootatbothstateand federal levels, and joyfully install him in the former.

WilliamstownTownHallwaspackedfor a meeting on 8 December. Amongst the usual hecklers was an intoxicated Martin Moore, loudly interjecting, much to the annoyance of Mr Howey, other speakers and the audience. Told by Constable Browne to behave himself, he stacked on such a turn that he had to be dragged outside kicking and biting. He was handcuffed to the Town Hall steps, where he sat swearing at Constable Morgan. He was duly hauled off to the police station, where he immediately attacked the watchhouse keeper, Constable Jones.

At the Williamstown Court on 15 December, with just four days left until the voting stampedes began, Mr Moore had three charges to answer to: insulting words, obscene language and assaulting Constable Browne.

The defendant told a different story. He was the victim of police brutality having been punched and batoned by three burly policemen for no reason at all, and beaten to jelly by Constable Browne who had never heard of freedom of speech. It did him no good whatsoever. He was fined two pounds for insulting words, five pounds for obscene language and three pounds for assaulting police. Failure to pay would net him 21 weeks in the clink.

One the eve of the election, Mr Howey andhissupporters,decidingthatthe open air was better suited to spruiking than the TownHall, bellowedtheircampaignfrom a truck parked in Ferguson Street. One of thesesupporters,ThomasBriggsofLenore Crescent, walked into Ferguson Street to cheer for the UAP candidate.

This produced a very strange effect on Ernest Roberts of Rennie Street, who had just enjoyed wrecking an Electra Street political meeting with much jeering and howling down of various speakers. He spotted Mr Briggs standing near the lorry and stopped. Ernest Roberts harboured an intense dislike for Thomas Briggs and, followed by hundreds of men, headed straight towards him. Raising his voice above the racket made by the UAP, he screamed “Have you got Brother Briggs

there? The Christian brother with the Christian spirit?”

Briggsfacedhim.Robertsthengotdown to business by accusing Briggs of bringing sectarianism into Williamstown by virtue of having attended no fewer than seven different churches. “You’re a mongrel! A sectarian mongrel!” This he repeated several times loudly, albeit inaccurately, apparently confusing sectarianism with ecumenism.

Noting the army of heavies behind Mr Roberts, Briggs wisely said nothing. He may have been a Christian, but he was not willing to forgive and forget rude Mr Roberts of Rennie Street. He took him to court charged with insulting words.

Awitness,RobertFaulknerfromHannan Street who had been standing behind Briggs on the night, had seen Roberts near the truck and heard his accusations of bringing sectarianism to Williamstown. Briggs had merely replied, “Don’t be silly.”

Then anther witness, Robert Johnston of OsborneStreet,statedthathehadbeenon the lorry, and had seen Roberts confront

Briggswiththebackingofseveralhundred men behind him. Yes, Roberts accused Briggs of sectarianism, and mentioned several churches, but he hadn’t heard the word “mongrel”. In fact, the racket made by the spruikers and audience was such that it was a miracle that anyone could hear anything. Other witnesses agreed that the hellish hubbub made by Mr Howey, the shouts of his supporters, the clanging of bells and the jeering of political foes made it wildly improbable that Briggs could have heard a thing.

Mr Jackson, Justice of the Peace, had the wisdom of experience and allowed for tempers heating up at political meetings. He believed that the words had been used, but dismissed the case as a trifling matter, with each party to pay their own costs.

Disappointed by the anti-climax, the crowd filed out, but then Sergeant Ellis, keeping the peace at the court door, heard Robertssuddenly kickingupafearfulfuss about something. He rushed to report this to the Bench, and Roberts was recalled.

“What’s this all about?” demanded a

very fed-up Mr Jackson.

Mr Roberts was incandescent with rage. As he had left the court, Robert Johnston hadhissedintohisear,“Whydon’tyougive Briggs a nice kiss and become friends?”

Mr Jackson understood why this constituted an intolerable provocation and again demonstrated his wisdom by declaring the incident closed.

Mr William Howey, having learned what Williamstown could be like in the grip of political passions, was deeply demoralised. Rather than hankering for UAP gentlemen to usher in a new era of peace and prosperity, the locals seems to prefer tokickpolicemen, screamdrunken threats , wreck meetings, and haul one another into courts and police stations.

Mr Howey had done his utmost and nobody could blame him for all that had transpired. After all his heroic efforts, it would be pleasant to report a landslide win, but alas. The damage was done. So, who won the seat of Melbourne Ports? Jack Holloway, for the ALP and Mr Howey abandoned Williamstown to its fate.

Barb McNeill.

New leader for Hobsons Bay

Hobsons Bay council’s search for a new chief executive is over, with Phu Nguyen appointedtotherole.

Originally from Melbourne’s western suburbs, Mr Nguyen is currently the chief executive of the City of Onkaparinga in South Australia and has previously held seniorexecutivepositionswithcouncilsin VictoriaandNewSouthWales.

Mr Nguyen will take up the position on 19 January, almost a year to the day from whenhispredecessor,AaronvanEgmond, was suspended pending an investigation intoworkplacesafetyconcerns.

Mr van Egmond resigned as chief

executive in April, and in July the investigation reported that Hobsons Bay council had become a “toxic“ workplace under his leadership, with sexual harassment,bullying,excessiveworkloads andadrinkingcultureamongtheissuesit identified.

HobsonsBaycouncilhasbeenwithouta permanent leader since Mr van Egmond’s suspension, with former Maribyrnong and Wyndham chief executive Kerry Thompsoncurrentlyactingintherole.

Mr Nguyen has enacted cultural and governance reforms at Onkaparinga council since becoming chief executive there in 2023 and Hobsons Bay mayor Daria Kellander said this made him the

standoutcandidate.

“The CEO Employment Matters Committee structured its selection process around the specific context in which council is working at the moment, which includes an identified need to rebuild its governance, culture and brand while refocussing on service delivery and longer-term strategic priorities,” Cr Kellandersaid.

“Mr Nguyen is a very experienced executive who grew up in Melbourne’s westandunderstandstheissuesfacingthe region.

“Council is very excited about Mr Nguyen’s appointment, and we look forward to welcoming him back to the

Council honours a community hero

Footscray icon Wally Hopkins OAM was honoured at Tuesday night’s Maribyrnong council meeting, the first since his death lastmonthaged101.

Standing orders were suspended so tributes could be paid to Mr Hopkins who died on 19 September and whose funeral was held at the Footscray Town Hall on 3 October.

MembersofMrHopkinsextendedfamily filledthepublicgalleryasCrCucLamledthe tributes, detailing his many achievements and record of community service that resultedinsevenlifememberships.

Among them were the AFL Umpires

Association for the more than 300 senior games he officiated throughout Victoria followed by years as an umpires coach; Victoria University where he graduated as anengineeringapprenticeatitspredecessor institute,theFootscrayTechnicalSchool,in 1939,andtheYMCAwherehespentdecades asvolunteer.

He was also awarded Australian Scouting’s highest honour for his eight decadesofservicetothe1stFootscrayScout group.

His commitment to community service resulted in him being named Maribyrnong CitizenoftheYearin1984and2008andan

OrderofAustraliain1998.

Inmorerecentyears,MrHopkinsbecame known for his friendship with neighbour and fellow centenarian, Vern Roberts, who he shared a fence with for more than 70 years.

“Dad was a passionate Footscrayite, he never lived anywhere else,” his daughter JulieHopkinstoldthemeeting.

“We appreciate very much the acknowledgementdad’sreceivedandwe’re veryproudofhim.”

Wally Hopkins is survived by children, Julie, Neville, Sue and Greg and their families.

west and working with him to build a bright future for council and the community.”

Mr Nguyen said he was thrilled to be appointedtoleadandreformHobsonsBay council.

“I have been given a clear mandate from council to focus on building a high-performing team culture and supporting staff while rebuilding corporategovernance,”hesaid.

“I am excited to return to Melbourne’s vibrant west and to work alongside staff on building a proud organisation that will be known for delivering exceptional communityoutcomes,financialresilience andagreatorganisationalculture.”

Tunnel stack fight

Mr Wurt disputed the minister’s claim that the government had not been provided with a copy of the report, pointing out that MTAG shared a draft version with Environment Minister Steve DimopoulosandFootscrayMPKatie Hall at a meeting in May and that attemptstomeetwithMsHornehad beenrebuffed.

He said a copy of the final report had also been provided to the Environment Protection Authority Victoria (EPA), which he wants to convene a conference of concerned citizens to discuss the findings beforeitgivefinalapprovaltotunnel operatorTransurban.

A spokesperson for the EPA wouldn’t confirm if a copy of the report had been passed on to the government,butsaidgroundlevelair pollution levels would be monitored closely once the tunnel opened and datareleasedmonthly.

However, the spokesperson said all assessments and modelling had indicated that air pollution levelswouldbelowandnotahealth risk.

A spokesperson from tunnel operator Transurban agreed, adding that the stack’s current exhaust fans wouldbesufficient.

“Independent assessments by the Environment Protection Authority (EPA) and other expert bodies have confirmed that the ventilation system will meet or exceed all relevant air quality performance requirements.”

Well known Footscray identity, Wally Hopkins OAM, who died last month aged 101. (Ljubcia Vrankovic) 475736_01

Norm’s fight begins again

A saying once went, “It’s strange to go to the Lawler’s for a cup of tea – you could be sitting with the prime minister, the governor or the premier.”

SuchwasNormLawler’sdomainoverthe Point Cook Homestead that he hosted the likes of Sir Henry Bolte, world renowned hunters and British peers – teaching them all a thing or two about shooting.

Now97,themanwhoearnedthemoniker ’The Little White Hunter’, is not shooting many quail – or stirring up nobility and having his name endearingly mentioned to Queen Elizabeth II– but he is going guns blazing to save his former abode … again.

For the last 15 years, the homestead has been vacant, vandalised and arguably in one of the worst conditions it has been in sinceitwasbuiltbytheChirnsidefamilyin 1857.

The man whose sheer willpower saved the place in the 1970s and guarded it until 1995 has one simple message:

“After 30 years, the fight begins again.”

To understand the essence of the homestead, you have to understand Norm.

BeforehewasTheLittleWhiteHunter,he was just a lad from Footscray growing up through The Great Depression and World War II who discovered shooting.

“In 1942, during the war, I started an apprenticeship when I was 14 years old at Hansen the builders,” Norm said.

“There was another fellow who worked there and on his bike he used to have this canvas bag tied on the handlebars.

“So I asked him one time, ‘what is in that bag?’”

The teenager laid his eyes upon a gun.

“I said,“ What do you do with it? “ and he said when I knock off work, I ride out along the road there and shoot a rabbit or two.

“I got interested and he said ‘would you like to come with me.?’”

During the austerity of the war, it was common for people to jump the train and head to towns to hunt rabbits in spots like Werribee and Geelong for supper or a few sixpence.

The “Rabbiters Express “ would leave every Sunday morning at 6.30am for Geelong.

“OnthewaythroughYarraville,Newport and all those places, blokes would be getting on the train with boxes of ferrets, nets and guns, and they were going out to get a feed for their families,” Norm said.

“That is where shooting started with me.

“Gradually I started to get known as a guide for shooters and then a doctor rang up one time and said ‘would you be able to take me out shooting?

“Shooting was a way of life, most houses had a rifle because rabbits were all you could get.”

In 1944-1945, the latter years of the war–unbeknownst to those living through it – drives in Werribee would net up to 4000 rabbits which locals donated to the army and hospitals.

Despite trying to enlist a few times while underage, Norm was knocked back.

In 1946, the 18-year-old marksman had no idea he was about to stumble upon the site of his life’s battle.

“One day the Altona boys said to me “come down and shoot some rabbits at Point Cook,” Norm said.

“I had never been to Point Cook and I am now 18 years of age, so we went to Altona to pick them up and they were waiting there in a boat.

“I said, “I thought we were going to shoot rabbits, and they said ‘Yeah, we are.’

“So we got in this bloody boat and we went around to where the Skeleton Creek reaches the sea.”

“The Aboriginals used to refer to the Werribee Plains as the treeless plains, but right down the end I could see this belt of

trees and it intrigued me – there must be something.

“I said I won’t bother shooting because I was drawn towards the trees.

“I gradually walked down, and it’s a long walk, and I was amazed at the rabbits, quails and ducks there, it was a wonderland.

“Eventually I burst through these old boxthorns, and there was a site that I have never been able to get out of my mind.

“First thing I saw was the old stables, then there was the old house and the other buildings. There was no one there and it was very neglected.

“I looked and everything I loved in life was there.”

Fromthatpointon,hewouldneverbefar away from the place he would describe as 10 miles from the city but 100 miles from everywhere.

As Norm’s farm and shooting business in Tarneit kept him busy, he moved his family into a house on the corner of Homestead Road and Aviation Road in 1965.

In 1973 the homestead’s caretaker told him it had been purchased by a company.

“The place was then vacant for three years and that is when the damage started to get bad, the vandals and stuff started to get in there,“ he said.

“I even found out who West Point Holdings were in Sydney, so I rang them.”

One day Norm’s phone rang at 8am followingyearsofpesteringandpetitioning the powers that be.

It was the Melbourne Board of Works.

“They said, “we want you to meet us at Point Cook at 10am, and I said, “what the helldoBoardofWorkswantmefor?“Norm recalled.

The Little White Hunter was informed thatthestategovernmenthadacquiredthe homestead.

“That was the first shock,” Norm said.

“Then the next thing they said was we have to have someone here 24-seven to protect it and we want someone to look after it until we make up our minds about what is going to happen with the place.

“They said I want you to take the job.

“I said how much time have I got to let

you know and they said you’ve got until 3pm.

“So I contacted my wife and she knew I loved the place, so she said the decision is yours.

“They said you’d be a hypocrite if you didn’t take the job, it’s through you the government has been forced to do something.”

By nightfall, there was a caravan, a portaloo and a man on a mission to clean the place up.

“I was there until six months later when they decided they were going to make it into a park.

“They advertised for a ranger but said the job is yours if you want it.

“I took the job and then from 1978 to 1995 we lived in part of the house and we gradually bought it back.”

Letters of thank you flooded in, while families, friends and functions characterisedthatpocketofPortPhillipfor a generation.

Until the rules of the public service caught up with the public servant.

“Isavedtheplaceandthenwegotmoreor less kicked out because it was compulsory retirement at 65 years of age,“ Norm said.

From 1995-2010, the glory days turned into a slow decline.

“Then they leased it out – there were four

leases over 15 years, everyone went broke and the last one had a liquidation sale,“ he said,

“It’s deserted, empty and it is an insult to all the people who call Point Cook home.”

When Norm first trudged up the shallow banks of Skeleton Creek, Point Cook had a RAAF base, a few farms and was more a geographical point than a locality.

Today, it is Australia’s largest suburb by population with more than 70,000 residents, by some estimates its most multi-ethnic, and home to Lawler Street behind the town centre.

What hasn’t changed is Norm’s dedication to that bluestone house.

Parks Victoria district manager Craig Bray said damage caused by recent vandalism last Christmas have been fixed.

“In the interim, Parks Victoria has temporarily boarded the homestead, and installed a CCTV and monitored alarm system to mitigate the risk of further damage,” Mr Bray said.

Parks Victoria welcomes the views of community members on how to reactivate the site and we’ll continue to work with Wyndham City Council and local groups on a solution.”

No commitments to a long term restoration plan have been made, but the fight is well and truly back on.

Norm Lawler. (Damjan Janevski). 497375_02
Councillor Susan McIntyre, Mark Connell, Les Day, Norm Lawler and Sian Day. (Damjan Janevski) 495965_01

MY PLACE

Cas Bukor is well known in Williamstown for her annual Williamstown Calendar. She chats to Laura Michell about her love for the “most scenic inner suburb” and her involvement with Hobsons Bay Yacht Club.

What is your connection to the inner-west?

I have lived in the west for over 40 years. Volunteered for numerous activities and groups like the Williamstown Festival (now defunct), Art In Industry, gardening and assisting with cooking via EdConnect to local schools and of course, lots of volunteer hours at Hobsons Bay Yacht Club (HBYC). I also belong to the Williamstown Camera Club. Williamstown is a visual feast, a fantastic place to take photographs Many of the locals would know I produce a Williamstown calendar every year. Next year will be my 12th year doing the calendars.

Whatdoyoulikeaboutwhereyoulive?

Almosteverything!Theeclecticmixoflocal residents, being surrounded by the sea, the friendliness of passers by, the eateries and coffee shops, and the views across the bay. You can get almost anything locally, without even getting in the car.

What, if anything, would you change aboutwhereyoulive?

It would be good to have more seating and some improvements of our public areas, especially along the foreshore. The council and state government, have done a great job of rejuvenating Altona foreshore recently, but very little seems to have been invested in what is possibly the most scenic inner suburb in Melbourne.

Howlonghaveyoubeeninvolvedwiththe yachtclub,andhowdidyourinvolvement comeabout?

IgotinvolvedwithHBYCaboutseven years ago when I downsized and moved a stones throw away. HBYC arguably, has the best view across the bay from the upstairs deck, a welcoming and friendly, atmosphere. I started out as a social member, and then I became a member of the social committee for a few years. With the encouragement of the recent manager, Rod Austin, I did a ’Start to Sail Course’ at the club and started to sail. As a photographer, I love taking photos of sail boats, especially when they heeloverinwild,windyconditions.In2024 I was thrilled to win Print of the Year at my camera club, capturing a chaotic wild start to the Geelong Regatta. Earlier this year, the sailing bug bit me, and I became a crew member, sailing and racing more regularly. HBYC offers many pathways to start sailing, in fact I am currently involved with a new ’Women’s Working Group’ aimed at encouraging more women and girls to give sailing a go. And just recently I joined another sailing committee ’KISS - Keelboat Introduction to Sailing Savvy’ where over 14 weeks, experienced female sailors share their knowledge with other women who want to sail keelboats. The goal is to build confidence and community while you learn.

What is something people would be surprisedtoknowaboutyou?

My family and I migrated (escaped) from Hungary many years ago and our first residence in Australia was at the Bonegilla RefugeeCamp,nearAlbury.MysonJackson andIwenttoafewmonthsago.Bonegillais now preserved as a tourist attraction.

Cas Bukor. (Damjan Janevski) 509343_08

Furlong 2025 gets underway over Melbourne Cup carnival

A statewide road policing activity called Operation Furlong 2025 will be conducted overtheMelbourneCuplongweekendfrom Friday 31 October to Tuesday 4 November. This has been identified as a period of potentially high risk in terms of exposure to road trauma to the Victorian community.

Focus on Road Safety

Operation Furlong 2025 aims to increase driverawarenessandencourageresponsible driving to reduce the exposure to road trauma on road users during this time of increasing road use. Police will target high risk driving that has been identified as the maincausesofliveslostandseriousinjuries in crashes, including:

• Speeding

• Distracted driving, especially involving mobile phones

• Notwearingaseatbeltalongwithrestraint compliance

• Driving while fatigued

• Driving under the influence of alcohol or drugs (impaired driving)

“We’ll be out in force to educate drivers and enforce the rules, with a view to preventing lives lost and serious injuries” says road policing advisor Senior Sergeant Fletcher Pearson. “Our goal is to prevent tragedies and keep everyone safe.“

Senior Sergeant Pearson, from Westgate Highway Patrol, said the operation will be conducted throughout all operational police regions and police service areas during the five days. Police will be out in force both to educate drivers and to enforce road rules, with a view to preventing lives lost and serious injuries.

The extra-long weekend provides an opportunity for families to free themselves from their usual commitments and it is

anticipated that large numbers of people will use Victorian roads, often driving long distances in unfamiliar driving conditions.

The times of highest risk are when people are leaving for holiday destinations and returning home

We’re watching your speed. Are you?

Motorists are requested to stay within the speed limit, don’t drink alcohol or take drugs and drive, leave your mobile phone out of reach, wear your seatbelt and make sure you are well rested.

Fatigue is one of the biggest killers and is a major cause of the loss of life on Victorian roads. Drivers are requested to plan their trip, be patient and ensure that you take at least a 15-minute break at least every two hours and don’t drive if you are tired.

Drivers planning to travel during this period can expect to see an increase in vehicles travelling on our major freeways and highways throughout the state.

Road trauma isn’t just about the lives that are lost – it’s about the enormous impact on the community, from the family members, to the emergency services workers who have to deal with these tragedies on a daily basis, to the police who have to deliver the devastating news to loved ones.

Community Effort

RoadSafe Westgate Community Road

Safety Council chairman Jim Giddings said it has been demonstrated that speed is a contributing factor in most road crashes. Therefore stay within the speed limit and drive to suit the conditions.

Speeding affects both the risk of a crash happening and the severity of injuries sustained when a crash does happen.

Mr Giddings said to make sure you’re not putting yourself or others at risk on the roads, put your phone away where you can’t betemptedtouseit,forexampleintheglove box or in the boot to avoid being distracted.

He said the work of his group along with initiativesliketheOperationFurlongduring the Melbourne Cup long weekend would hopefully reduce the number of serious road crashes on our roads. He asked the community to report speeding drivers to Crime Stoppers on 1800 333 000.

Plan Your Trip, Stay Safe

Here are some key tips for a safe long weekend:

• Plan your trip: Check traffic conditions and plan rest stops to avoid fatigue

• Stick to the speed limit: Every km/h over the limit increases your crash risk

• Don’t drink and drive: If you plan to drink, arrange alternative transport

• Put down your phone: Distracted driving is dangerous

• Wear your seatbelt: It’s the law and could save your life

• Get enough sleep: Fatigue impairs your driving ability

• Check your vehicle: Ensure tyres, brakes, lights, and windscreen washers are in good condition

Holiday driving has its challenges and drivers should drive in the hours they are normally awake, take regular breaks to reduce fatigue and allow extra space between vehicles.

Ifyouplantohaveadrinkthenplannotto drive,takingabigrisklikedrinkanddriving is just not worth endangering your live or the lives of other road users.

Before embarking on any driving trips driversshouldchecktheirtyres,windscreen washers, brakes and lights.

Remember, travel so that you arrive at your destination safely and enjoy your Melbourne Cup Holiday weekend.

DRIVING IS NOT A GAME!

SPEED KILLS!

Senior Sergeant Fletcher Pearson. (Ljubica Vrankovic) 476674_10

1ST PRIZE

$100

Blitz leads to 230 arrests

A police blitz targeting recidivist family violence perpetrators in the north-west resulted in 230 arrests.

The offenders were tracked down and apprehended by police across multiple daysthroughoutSeptemberandOctoberin Victoria Police’s north-west metro region.

Detectives from the Westgate Family Violence Investigation Unit and Broadmeadows Family Violence Investigation Unit teamed up to lead the blitz, with the Family Violence Command Taskforce and the Public Order Response Team.

Thosearrestedhaveallegedlycommitted multiple violent crimes against current and former partners and their children, police said. The blitz focussed on repeat family

violence perpetrators who are known to offend on multiple occasions across a 12-month period and specialist support services were also engaged, helping to disrupt patterns of violence. Those arrested included a 42-year-old man who was wanted by police after failing to appear in court for serious family violence offending; a 35-year-old man who allegedly committed a family violence-related aggravated burglary; a 42-year-old woman who allegedly assaulted another woman at a shopping centre; an 18-year-old man who allegedly committed multiple counts of deception and damaged his parents property; and a 37-year-old man who allegedly persistently contravenedafamilyviolenceintervention order.

Police also served 187 family violence intervention orders and executed more than 120 outstanding warrants throughout the blitz.

Westgate Family Violence Investigation Unit Detective Acting Senior Sergeant Fiona Waters said police were serious about ensuring recidivist family violence perpetrators are held responsible for their actions.

“Family violence is completely unacceptable – which is why we will continue to work tirelessly to target and apprehend offenders and keep victims safe,” she said,

Broadmeadows Family Violence InvestigationUnitDetectiveSergeantChris Couacaud said, “Whether it’s committing violent assaults against their loved ones,

breaching a family violence intervention order or using technology to stalk or harass – those that choose to engage in this behaviour should think again. They will be tracked down by police and held to account”.

If you are concerned about your own or someone else’s behaviour support services are available.

No to Violence runs a Men’s Referral Service which helps men who use violence to change their behaviour and can be contacted on 1300 766 491.

Spooky Halloween craft

Each month, Stephanie Martinez will share an exciting craft project designed to inspire and spark creativity.

Stephanie starred in the first season of Making It on Network 10, where she discovered and ignited her passion for crafting.

Join Stephanie as she explores the endless possibilities of crafting and turn everyday materials into something extraordinary.

This month, Stephanie is creating a spooky ghost tassel.

Black EVA foam

Support is available 24 hours a day through Safe Steps by calling 1800 015 188 or emailing safesteps@safesteps.org.au In an emergency call triple-0. If you can’t get to a phone, ask someone else to do it for you.

10cm piece of cardboard Wrap yarn around cardboard about 100 times.

Tie the top with a

Step 3: Cut the loops at the bottom and slide off the cardboard.

Step 4: Put a straw in the middle and fold the yarn over it.

Step 5: Tie a ribbon around the neck of the ghost.

Scan the QR code and follow the links for more creative ideas.

Spooky ghost tassel
Stephanie Martinez.

Outback Music Festivals return

The Australian Outback will sing again in 2026 with the return of two iconic camping-based music festivals, The Big Red Bash which is renowned as the world’s most remote music event, and Australia’s Biggest Outback Music Festival the Mundi Mundi Bash.

Each features three days of music and unique outback entertainment - from worldrecordattemptsandcharityfunruns to camel rides, comedy and outdoor film nights. The Birdsville Big Red Bash will return to the Simpson Desert across July 7-9 next year, while the Broken Hill Mundi Mundi Bash will return to the Mundi Mundi Plains across August 20-22 with both blockbuster Outback music events putting tickets on-sale this week. The 2026 festival line-ups are a roll call of Australian music royalty with Missy Higgins (Big Red Bash only), The Teskey Brothers, Hoodoo Gurus (Big Red Bash only), Jon Stevens (Mundi Mundi Bash only), John Butler (Mundi Mundi Bash only), The Living End (Big Red Bash only), Birds of Tokyo (Big Red Bash only), Jessica Mauboy and other legendary acts set to hit two of the most extraordinary stages on earth.

The full event line-ups include:

Birdsville Big Red Bash: Missy Higgins, Hoodoo Gurus, The Teskey Brothers, The LivingEnd,BirdsofTokyo,JessicaMauboy, Shannon Noll, Kate Ceberano, The Whitlams, Tim Finn, Troy Cassar-Daley, Chocolate Starfish, Ross Wilson, Furnace and the Fundamentals, ‘50 Years of Fleetwood Mac’, Shane Howard, Wes Carr, Jem Cassar-Daley, Tom Busby and Gypsy Lee.

The2026eventwillseeGypsyLeejoinher mother and Bash regular Kate Ceberano for the first time in Birdsville, while Jem Cassar-Daley will also join her father Troy at the event for another familial moment on the edge of the Simpson Desert.

Broken Hill Mundi Mundi Bash: The Teskey Brothers, Jon Stevens, John Butler, Boy & Bear, Baby Animals, Jessica Mauboy, TheWhitlams,LeoSayer,TimFinn,Richard Clapton, Troy Cassar-Daley, Chocolate Starfish, Furnace and the Fundamentals, Wendy Matthews, The Radiators, Shane Howard, Fanny Lumsden, ‘50 Years of Fleetwood Mac’, Hot Potato Band, Tom Busby and Wes Carr.

Greg Donovan, Bash event founder/ owner and Managing Director of the Outback Music Festival Group who stage botheventssaid2026marksajoyfulreturn to form.

“We’re stoked to be bringing back the full Birdsville Big Red Bash after taking a breather this year,” he said.

“Our team are recharged and ready to give festival-goers an unforgettable outback adventure. Tickets are already sellingfast,we’resogratefulfortheongoing support of our festival goers.

“After the first hour of on sale tickets are already 40 per cent sold for the Big Red Bash and we’re hoping for an equally great response when the Mundi Mundi Bash tickets go on-sale.”

ForDonovan,theBashfestivalsareabout more than music - they’re about moments.

“Watching families dance in the shadow of the 40-metre-high Big Red sand dune as the sun sets behind it, or seeing thousands on the Mundi Mundi Plains under that endlessskywiththeBarrierRangesbehind them is pure magic,” he said.

Missy Higgins is looking forward to headlining the Big Red Bash’s return.

“My band and I absolutely love playing in the desert for The Big Red Bash,”

she said.

“Surrounded by giant sand dunes and people having travelled miles in their dusty caravans to get there… it’s so unique and so Australian. There is an incredible line-up set for 2026 and we’re all thrilled to be invited back to play again.”

Meanwhile, The Teskey Brothers are eager to make their Bash debut.

“We’ve heard a lot about these desert shows from our friends and we can’t wait togetoutthereinthereddustandseewhat it’s all about,” Josh Teskey added.

“Very excited for these shows.”

The 2026 edition of the Big Red Bash will also mark the return of crowd favourites Hoodoo Gurus.

“We’re psyched to be making a return visit to The Big Red Bash next year,” frontman Dave Faulkner said.

“Our first-and only-time there in 2023 was one of the most memorable gigs of our lives. What an insane idea: gather a motley crew of merry misfits and savvy self-starters and headout to the

back-of-beyond to enjoy a few days of music, mirth and merriment?! Whoever thought of that is a genius because it was amazing and I can’t wait to experience it again.” Event organisers are working on a new activity to replace the world-record breaking Nutbush dance-offs at both Bash events with further announcements to come. Both events are all-ages, dog-friendly and BYO and offer a rare kind of freedom where thousands of campers share songs, stories and sunrise views that stretch on forever. Heavily reduced ticket prices for kids under 18-years-old are available.

ThefestivalsofferupuniquelyAustralian destination adventures for families, grey nomads, camping and caravanning enthusiasts and intrepid travelers alike with around 10,000 expected to converge on Big Red outside of Birdsville and close to 15,000 on the Mundi Mundi Plains.

More information head to: www. bigredbash.com.au and www. mundimundibash.com.au.

The Hoodoo Gurus on stage at Mundi Mundi.
The Nutbush World record from the air. Preparing for the festival.
Enjoying the outback serenity.
Kicking up some fun and dust at Mundi Mundi.

7 Nights

Full-Board River Cruise

3 night Murray River cruise on board PS Murray Princess with all meals and sightseeing

Tour of Murray River Bridge and historic Roundhouse

Guided nature walk of Salt Bush Flat

Taste Riverland food and wine

Dragon-Fly flat-bottomed boat wildlife tour

Hotel Stays

3 nights five-star hotel stay in Adelaide with breakfast

1 night four-star hotel stay in Kangaroo Island with breakfast, lunch and dinner

Fully Escorted

Barossa Valley Tours

Full day Barossa Valley tour with lunch and wine tastings including:

Saltram wine estate, lunch and wine tasting at Lambert Estate, visit to Barossa Valley Chocolate Company, photo stop at Menglers Hill Lookout, vineyard tour & wine tasting at Jacob’s Creek visitor centre, stop at Beerenberg Farm, and free time in Hahndorf to explore the historic German settlement

Fully Escorted Kangaroo Island Tours

2 day Kangaroo Island tour including: Emu Ridge Eucalyptus

Distillery, Clifford’s Honey Farm, In-Flight Birds of Prey Display at Raptor Domain, Seal Bay Conservation Park guided beach walk, lunch at Emu Bay Lavender Farm, Kangaroo Island Wildlife Park, and Flinders Chase National Park

All Flights, Taxes & Transfers

Lisbon to Istanbul or vice versa

36 DAYS | 10 COUNTRIES

29 GUIDED TOURS

SET SAIL: MAR, APR, SEP 2027; MAR, AUG 2028

From $33,195pp in Veranda Stateroom

From $40,695pp in Penthouse Veranda

MEDITERRANEAN EXPLORER

Lisbon to Athens or vice versa

29 DAYS | 9 COUNTRIES

23 GUIDED TOURS

SET SAIL: FEB-JUN, AUG, SEP 2027; FEB, MAR, MAY, JUN, AUG 2028

From $24,095pp in Veranda Stateroom

From $28,695pp in Penthouse Veranda

SPAIN & PORTUGAL DISCOVERY

Lisbon to Barcelona or vice versa

8 DAYS | 3 COUNTRIES

6 GUIDED TOURS

SET SAIL: OCT, NOV 2026; FEB, APR-JUN, SEP-DEC 2027; JAN-JUNE, SEP 2028

From $4,995pp in Veranda Stateroom

From $6,195pp in Penthouse Veranda

COMMUNITY CALENDAR

WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Star Weekly Community Calendar, Corner Thomsons Road and Keilor Park Drive, Keilor Park, 3042, or email to westeditorial@starweekly.com.au by 9am Wednesday the week prior to publication

Laverton Community Choir

It’s that time of the year - the Laverton Community Choir is busy rehearsing Christmas songs for the festive season, and would love to add more voices. Everyone is welcome, and you don’t need to be able to read music - just come and experience the joy of singing in a friendly and relaxed atmosphere. The choir meets on Thursday from 7-9pm to sing, have supper and a chat, and then sing some more. You will leave feeling so much better! Laverton P12 College, 91 Bladin Street, Laverton.

 Sue, 0418 386 147, or lavertoncommunitychoir@gmail.com

Yin Yoga Yin Yoga classes are running at Brooklyn Community Hall during term four. Five classes are held per-week on Wednesdays, Saturdays and Sundays. Classes are costed for community: $8 for concession, $12 for 45 min sessions and $18 for 60 min sessions. Star Weekly readers can get a complimentary first session to try it out. Yin Yoga is a gentle, passive practice that invites stillness and subtlety - offering up powerful physical benefits by targeting the body’s connective tissues, joints, and fascia. For all bodies - stiff, sore, injured or just in need of deep release!

 Hong, 0412 112 422, or yogawithhong.com

Craft, laugh and connect

Join us for a fun, calming session filled with creativity and connection. All craft styles and skill levels are welcome. Bring your favourite craft - knitting, drawing, colouring, puzzle, anything that brings you joy (no painting please). It’s a great way to meet people, connect with your library and explore new creative activities. The craft sessions are held at Altona North Library from 1-3pm on Tuesdays from 21 October. Free of charge and no bookings required.

 9932 3005, 0407 247 087 or www.hobsonsbay.vic.gov.au/Libraries

Maribyrnong River

Friends of the Maribyrnong Valley are holding a twilight watering activity Thursday 30 October from 6-7.30pm. Bring a picnic dinner and help the friends group water hundreds of native plants in need of a drink. Meet at Jack’s Magazine Car Park, Magazine Way, Maribyrnong. info@fmvonline.com

Bridge club

The Williamstown Bridge Club has bridge sessions each week on Wednesday night at 7.25pm and Friday afternoon at 1.25pm for experienced players and a supervised session Friday 10am at Hobsons Bay Sport & Game Fishing Club, 17 Altona Road, Altona. All levels welcome and partners can be provided.

 Sandi, 0417 315 760, Alan, 0430 309 255 or www.bridgewebs.com/williamstown

Jumble sale

The annual community jumble sale is on Saturday 15 November from 9am-4pm in the church hall, Montague Street, Yarraville. There’s 36 individual stalls and a barbecue. The aim is to raise $2000 for United Housing Co-operative which is based in Yarraville. Books, plants, clothing, vinyl, artwork, Pokémon cards, sports collector cards and much more! Reserve a table for $25 and run your own stall.

 Graeme, ghodgart13@gmail.com

Mainly music

A music-playgroup program for kids and their carers from birth to school age. Held every Thursday from 9.30-10.30am during school terms at Westgate Baptist Community, 16 High Street, Yarraville. The

This week’s photographer’s choice photo is of Brookfield resident Jacqueline Licitra’s elaborate Halloween decorations in her front yard. Pictured is Jacqueline with her grandsons Maddix, 3, and Zanon, 1. (Damjan Janevski) 511243_01

cost is $7 per family, per week.

 Jenny, 0401 651 012, Ruth, 0409 635 468 or westgatebaptist.org.au/mainlymusic/

Westgate diabetes support group

Meets on the first Tuesday of each month at Altona bowling club at 10am.

 Elaine, 0415 030 996

Social square dancing

Come along to the Maribyrnong Community Centre on Thursday nights from 7.30-10.30pm to learn social square dancing for beginners in a safe and friendly environment. The teaching is in a group but is self paced so there is no pressure to maintain a rate of learning.

 Janine, 0421 371 883, or contact@essendonsquares.com

Free English conversation classes

If English is your second language and you want to improve your English language skills, practice speaking with friendly volunteer tutors in informal and interactive group sessions held every Monday at 1-3pm in the meeting room at Altona Library, 123 Queen Street, Altona. Light refreshments provided.

 Jill MacKenzie, 0439 994 705 or jill.mackenzie111@gmail.com

Chit Chat Tuesdays

A ladies chit chat group which is on every Tuesday from 1.30-3pm at Louis Joel Arts and Community Centre in Altona. As an extension of this sometimes we host guest speaker events for women in the community.

 Dione, 9398 2511 or LJAC.com.au

Altona North Combined Probus

The Altona North Combined Probus Club meets on the fourth Wednesday of each month at Altona Sports Club. Includes a speaker, organised trips and outings, and a friendly atmosphere.

 Lesley, 0414 481 442

Footscray CWA

Meet on the fourth Monday of every month

from 7-9pm at Footscray Scout Hall next door to Footscray Police Station, 4a Hyde Street.

 cwaofvicfootscray@gmail.com or https:// www.facebook.com/CWAofVicFootscray/

Williamstown Seniors

The group meets every Tuesday at 1-3pm at Denis Reserve. It is a small group looking for more seniors both male and female. Members enjoy two hours of singing as well as afternoon tea. Cost is $5 for the afternoon.

 Marlene, 0402 769 204

Walking group

The Braybrook and Maidstone Neighbourhood House are holding a walking group from 9-10am every second Wednesday. The walking group is open to everyone and starts from the neighbourhood house at 113 Melon Street, Braybrook.

 9317 5610 or jodie@bmnh.org.au

Computer classes

Scams, MyGov, software, online shopping, banking, email, whatever. We all need to keep up with the internet, IT, computers, and changing technology. Classes every day of the week , mornings and afternoons, in Williamstown and Altona North.

 Lynne, 9397 6168

Laverton Bowls Club

Experience the fun and skill of lawn bowls, a game which is suitable for all ages. Laverton Bowls Club is recruiting new members, so if you are looking for a friendly atmosphere and the opportunity to bowl both socially or at pennant level Laverton is the place to be.

Come to the club on Tuesday or Thursday mornings for practice beginning at 10am. All welcome at 77-87 Hall Street, Altona Meadows.

 9369 1034 or secretary@lavertonbowls.com.au

Musicians welcome

Do you play any percussion, brass or woodwind instruments? The Hobsons Bay

City Band is seeking musicians to join their community band. Please note that rehearsals are held under the directorship of Wayne Bowden OAM every Monday evening from 7.30pm at the Spotswood South Kingsville RSL, 59 The Avenue, Spotswood.

 Hannah Prouse, hbcityband@gmail.com or www.hbcb.org.au

Walking group

The Mighty West Heart Foundation Community Walking Group meets Monday, Wednesday and Friday at 10am. Walk at your own pace for up to 60 minutes. Discover the many health benefits (physical and psychological) of walking together. All welcome.

 0411 566 862

Alcoholics Anonymous (AA) Meetings

- Williamstown

Alcoholics Anonymous (AA) offers support to anyone who wants to stop drinking. The Western Unity AA Group holds weekly in-person meetings in Williamstown. If you think you may have a drinking problem, you are welcome to attend. Friends and family members supporting a loved one are also encouraged to come along.

 https://williamstown.aagroup.org.au/, aawilliamstown@gmail.com or 1300 222 222

Women Working Together

A program connecting women aged 50 and above and in need of assistance, with mentors and mentees. Open to women across the western suburbs, including Maribyrnong and Hobsons Bay.

 9655 2131, EmploymentSupport@ cotavic.org.au, or https://cotavic.org.au/ our-programs/employment-support/

Musicians Wanted Westgate Concert Band, Established in 1979 is seeking new members. Rehearsals are held on Saturday mornings during school terms, 9am-noon at Braybrook College.  westgateconcertband@gmail.com

Ribbons weave memories

Artist Yoonjung Kim records emotions and sensations through painting, drawn from personal memories and experiences, in a new exhibition opening in Brimbank this month.

‘Interwoven’ is Kim’s first solo exhibition since relocating from Seoul to Melbourne in 2020.

“Theworksexplorememoryandemotion through painterly gestures, inspired by decorative objects, plants, and animals discovered across Melbourne’s western suburbs,” Kim said.

A ribbon motif also features throughout works, which Kim said she uses to unfold

her inner narratives.

“The ribbon is a really familiar object to me. It seems to bring out all sorts of emotions. I wanted to use them as a structure to hold or wrap my emotions or memories,” Kim said.

For Kim the ribbon also evokes joy and celebration, love and friendship, while carrying the weight of social expectations and tension.

Kim said other objects in the paintings act as symbols for her emotions.

“Sometimes it’s nostalgia, very warm feelings in my childhood, and sometimes anxiety too,” she said.

Kim said she hopes audiences reflect on their own lives through her works.

“I want them to find their own memories through my paintings because my work is a bit symbolic, people can feel all different feelings and memories,” she said.

‘Interwoven’, supported by Brimbank council, is open from 24 October until 10 January at the Bowery Gallery, 33 Princess Street, St Albans.

The exhibition is free of charge and is available to view Monday to Friday from 9am-5pm and on Saturdays from 9am-12.30pm.

Details: creativebrimbank.com.au

Join Lucy Durack for a festive performance

Who said it was too early to start getting intothefestivespiritandspreadChristmas cheer?

Actress,singerandtelevisionpersonality

Lucy Durack will be bringing her voice and swagger to the Encore Events Centre in Hoppers Crossing on Tuesday 9 December.

Running from 2.30-4pm, the joy of the festive season will be on full display with a show of much-loved Christmas classics for the whole family to sing along to.

A music theatre and carols sensation, Durack will ring in the holiday season with all-time favourites like ‘Silent Night’, ‘All I

Want for Christmas’, and ‘O Holy Night.’?

If Durack’s name is unfamiliar you are bound to have seen– or heard– her sometime in the last two decades.

Some of her most notable roles have been playing Glinda in the Australian production of Wicked, and Elle Woods in the Australian production of Legally Blonde.

MorningMelodiesisafeel-goodmorning music series held on the second Tuesday of each month.

It’s a chance for friends to come together and experience great music, sing and

dance along to many iconic hits from an Aussie icon.

Whileitisapopularstapleamongretired members of the Wyndham community and from elsewhere in the west, everyone is invited to come and bring those closest to them.

It may only be October, but it is never too early to start making preparations for the silly season.

Tickets are $14 and include a morning tea. Details: https://www.wyndham.vic. gov.au/whats-on/morning-melodies-lucydurack-christmas-show-0

DJ series set to bring summer vibes to Yarraville

It’s going to be all pink flamingos, postcard-perfect palm trees and tropical cocktails at Kindred Bandroom in Yarraville as it hosts a new summer DJ series, Del Boca Vista.

Set to become a new Sunday ritual in the inner west, Del Boca Vista will offer music, community, nostalgia, and that laid-back banana lounge energy where everyone’s welcome to catch a groove, sip something cold, and keep the weekend going.

Each week, a rotating line-up of the city’s best selectors will get you moving and grooving, spinning funky selections from the arvo to golden hour as part of this free series that is family and dog friendly.

It begins on Sunday 26 October with cosmic-dancegroupMildlifeDJsalongside 6-piece groove unit Steppers (live) and DJ Colette.

From then on, weekly line-ups will be posted on Kindred Bandroom’s Instagram page, but regardless of who’s on the decks,

Halloween creeps into Moorabool

Jack-o’-lanterns will light up Moorabool this week as residents prepare to celebrate Halloween –with several events held across the municipality marking the spooky occasion.

Younger residents aged 11–17 are invited to the council’s ‘Youth Spookaball’ event at the Darley Civic Hub Pavilion on Thursday 30 October for an evening packed with games, activities, music, and dancing.

Attendees are encouraged to come dressed in their best Halloween costumes for the chance to win a prize.

The event will run from 6–8pm and registration is essential, with details available on Moorabool’s website.

Another opportunity to dress up in your scariest attire is the Halloween Fun Fest, which will be hosted at Rotary Park in Bacchus Marsh from 4–10pm on 31 October.

Itwillincludeananimalfarm,large format games, market stalls, food trucks,dancingfun,andcompetitions with prizes.

There will also be a screening of the 2019 animated supernatural comedy ‘The Addams Family,’ following the quirkyandmuch-lovedfamilycreated by cartoonist Charles Addams.

Entryis$5atthegate,andtheevent is hosted by MooraFun.

MooraFun event coordinator Dotty Hazel said this will be the third year of running the event, with previous festivals attracting positive feedback.

She said that attendees could leave the event to do some trick-or-treating andthenreturn,aswristbandswillbe supplied upon entry.

Pets are welcome if kept on a short leash.

Further details and contact information for this event can also be found on the Moorabool website.

funky groovers, vintage-themed cocktails and an unreasonable amount of flamingo content is guaranteed.

So grab your cabana wear, come and chill by the alligator infested shell pool, let your hair down, and get down to Del Boca Vista where it’s always Sunday.

The unadulterated good times are at Kindred Bandroom, 3 Harris Street, Yarraville, every Sunday afternoon from 2pm.

Details: https://kindredstudios.com.au/

DJ Colette is playing at Del Boca Vista, a new Sunday DJ series at Kindred Bandroom. (Supplied)
Lucy Durack. (Supplied)
Artist Yoonjung Kim. (Supplied)

SPORTS QUIZ

1. NBL star Bryce Cotton is currently playing his first season with which NBL club?

2. The total prize money for this year’s Melbourne Cup has risen to what exact figure?

3. The Stonehaven Cup is awarded to the winner of which competition?

4. And who is the current cup holder?

5. When dribbling in basketball, your hand cannot be where in relation to the ball?

6. NRL star Jonah Pezet has negotiated contract deals to play for which three separate clubs in as many seasons?

Which country did Australia beat to advance to the semifinals of the ICC Women’s World Cup?

And which cricketer achieved back-to-back centuries following the victory?

With a population of just over half a million, which island nation recently made history by qualifying for their first FIFA World Cup?

Which country is set to host the 2029 Women’s Rugby World Cup?

11. How many clubs are competing in this season’s A-League Men following the removal of Western United by Football Australia for financial reasons?

12. Which swimmer, following a series of world-class performances for Australia, recently set a short course 200m world record?

13. The 2026 FIFA World Cup is being held in the US, Canada and which other country?

14. Which 48-year-old racing driver won the Bathurst 1000 for the sixth time this year?

15. What is the name of the netball Test series played between Australia and New Zealand?

16. In golf, an albatross is the rare achievement where a player completes a hole in how many strokes under par?

17. In the MLB, for which team did Shohei Ohtani become the first player to hit three home runs and throw 10 strikeouts in a game?

18. Which AFL club did forward Charlie Curnow join during the competition’s trade period?

19. In which year did Dylan Alcott last win a Paralympic gold medal in wheelchair tennis?

20. Jamie Melham became the first female jockey to win which major horse race?

21. How many total medals has Australia won at the Winter Olympic Games?

22. Which famous Irish playwright played two first-class cricket matches in the 1920s?

23. Saya Sakakibara won a gold medal for Australia at the 2024 Paris Olympic Games in what event?

24. How many home and away rounds is the AFL Women’s season currently?

25. Who captained Australia’s one day cricket team in the recent series against India?

26. How many Grand Prix races are scheduled in total for the 2025 Formula One season?

27. And up until the recent US Grand Prix, how many races has Oscar Piastri won this season?

28. In NFL, what section of the field must you reach to score a touchdown?

29. Mason Cox was recently delisted after playing 11 seasons with which AFL club?

30. Which country won the first women’s soccer World Cup?

YOUR NEW CAREER

Star Weekly seeks an enthusiastic Full or Part time Sales Executive to work across our print, digital, social and online platforms.

Star Weekly is an independently owned company which prides itself on its long history of community experience but also its investment in the future.

The successful applicant will need to possess good people skills to enable them to meet with local businesses to sell solutions through our advertising platforms to help promote their business.

Applicants will need their own reliable vehicle for which we will provide an allowance.

The position is salaried, plus we offer an open ended commission scheme.

Send your application letter and resume to: Advertising Sales Manager, Mandy Clark mandy.clark@starnewsgroup.com.au www.starnewsgroup.com.au

To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.

1 Without a fixed address (8) 5 Climb (6)

Churlish (5) 11 Emission of energy (9)

Ultra (7)

Harsh (8)

Plaster artwork (6)

Rib (6) 20 Yearbooks (8) 21 Cannabis derivative (7) 24 Desired (6) 27 One of seven children (9) 28 Appropriate (5) 29 Killer (6)

Adieu (8)

Citrus preserve (9)

Faithful (5)

Observation (8)

Lazy (4)

Combination into a whole (9)

Across the region

Variety of hot drink (5,3)

Free time (7)

22 Dividing walls (5)

23 Aid (4)

25 Passageway between seats (5)

26 Small duck (4)

368

1. Linen is made from the cellulose fibres of which plant?

2 How many points is the letter Y worth in a game of scrabble?

3 A common dessert component, frangipane is made primarily from what ingredient?

4 CanneryRow is a 1945 novel by which American author?

5 The nicknames ‘Satchmo’, ‘Satch’ and ‘Pops’ belonged to which influential Jazz singer and trumpeter?

6 Morel, lion’s mane, oyster and enoki are all types of what?

7 What spirit is used to make Irish coffee?

8 On February 3, 1959, which three American musicians were killed in a plane crash near Clear Lake, Iowa?

9 In what year did Ireland join the European Union?

10 What was Amy Winehouse's (pictured) last studio recording before her death in 2011?

Emergency funding boost

The state government has announced it will commit an additional $6 million to western suburbs emergency departments to hire more staff, open more treatment spaces and improve patient flow.

Western Health will receive over $4.5 million of the funding to hire more doctors, nurses and allied health workers at Sunshine Hospital which the state government said will increase emergency department capacity, and improve ambulance offload times.

“Families are flocking to Melbourne’s west and whether it’s opening Urgent Care Clinics, building new hospitals or hiring more doctors and nurses – we’re making sure they can get the care they need.”

As part of the funding, Western Health will recruit two discharge coordinators as well as additional nursing and support staff to help patients transition from hospitaltohomeandfreeupbeds,thestate government said.

Premier Jacinta Allan announced the new funding in Sunshine on 23 October. “Our paramedics, nurses and doctors have never been busier. This investment means more support for them, faster care for Victorians – and ambulances back on the road sooner,” Ms Allan said.

New use for bamboo at zoo

Werribee Open Range Zoo is making do with bamboo in some ways that are pretty new.

Using bamboo donated from Geelong Botanic Gardens, keepers have been putting their DIY skills to the test and crafting everything from wind chimes to treat-dispensing totem poles.

Savannah Keeper Laura Harbridge said the team had a blast inventing new enrichment devices for giraffes, camels, nyala and tammar wallabies using the two tonnes of bamboo.

“We take inspiration from other zoos around the world, and our keepers and volunteers come up with ideas like, ‘how fun would it be to make a meerkat-apult?,’” Ms Harbridge said.

“For the giraffe, we built a feeder that

encouraged them to use their dexterous tongues to work the food out, it’s all about getting them to think, stretch and behave as they would in the wild.”

Geelong Botanic Gardens coordinator Keelee Reissinger said the donation was a perfect way to be sustainable.

“We donated bamboo to Zoos Victoria to protect our heritage trees at the Geelong Botanic Gardens from being impacted by its growth,” Ms Reissinger said.

“If it wasn’t reused, the bamboo would have gone to landfill and taken up to eight years to break down.”

Visitors can also join in the fun through the Giraffe Behind-the-Scenes Experience, where they can help create their own bamboo feeding devices.

Western Health will also use the funding to expand their ‘fast-track’ model of care.

‘Fast-track’ cubicles allow for quicker assessment and discharge of patients with less serious injuries and illnesses.

The model helps to reduce wait times and improve patient flow for those arriving to hospitals via ambulances, the state government said.

As part of the model, additional clinical staff will be recruited to open the six overnight cubicles at Sunshine hospital.

Mercy Health will also receive over $1.5 million to establish the ‘fast-track’ model of care.

According to the state government, paramedics and emergency departments arefacingrecorddemandwithparamedics responding to more than 98,000 code one callouts, and emergency departments having more than 513,200 presentations last quarter.

HealthMinisterMary-AnneThomassaid the investment will help improve response times and emergency care for locals.

“This is just another way that we are investing in emergency care to make sure all Victorians get the care they need, because in an emergency, every second counts,” Ms Thomas said.

1. Held by the Victorian Turf Club, the first Melbourne Cup was run in which year?

2. The highest Melbourne Cup Day attendance of

3. And which horse won in that year?

4. This year the annual Melbourne Cup Trophy Tour commenced with a visit to which city?

The winning strapper is presented with what trophy?

What is the type and colour of the traditional buttonhole flower worn on Cup Day?

Bart Cummings holds the record for winning the Melbourne Cup how many times?

The silk colours of which famous Cupwinner featured the stars of the Southern Cross?

Sheila Laxon, joint trainer of 2024 winner Knight’s Choice also prepared which other Melbourne Cup winner?

10. Which owner was represented by six runners in the 2013 Cup?

11. Which Melbourne Cupwinning horse originally raced in New Zealand under the name Flash Guy?

12. The 2024 Cup winner Knight’s Choice was bred near which NSW country town?

13. In 1965 famous British supermodel Jean Shrimpton sparked controversy by wearing what at Flemington?

14. Which Melbourne Cup winner was trained in Germany?

15. Which famous Cup winner carried 66kg to victory?

16. Runners in the 2025 Melbourne Cup will compete for how much prize money?

17. What percentage of the prize money does the winning jockey receive?

18. A popular cocktail served at Flemington on Cup day is called what?

19. Which country did 2006 Cup winner Delta Blues represent?

20. Which champion Australian jockey of the modern era fell off at his first ride in the Melbourne Cup?

21. How many female jockeys have ridden in the Cup?

22. What has been the most successful barrier in Melbourne Cup history?

23. And who is the only horse to have won the Melbourne Cup from barrier 18?

24. Who was the last grey horse to win the Melbourne Cup?

25. The race is now run on the first Tuesday in November, but originally it was run on which day of the week?

26. Which horse was the first and only to win the ‘Spring Grand Slam’, winning the Caufield Cup, Cox Plate, and Melbourne Cup in the same year?

27. And which country did that horse come from?

28. Queen Elizabeth II’s only attempt at capturing Australia’s crown for stayers was with which horse?

29. Who was the last favourite to win the Cup?

30. Winning connections of the first Melbourne Cup received what?

Two giraffes enjoying their DIY bamboo feeders. (Zoos Victoria)

Rear view in Forester focus

While Subaru’s most popular model has taken up with the hybrid age, changes are mostly cosmetic, including cabin layouts that have not changed much over the past four years, no impediment to the many Foresterfans,ofwhichtherearemany.

Needless to say, there is an impressive list of standard equipment in the Forester, right down to the bargain basement. Things such as Subaru Intelligent Drive (IntelligentandSportmodes),X-Modewith hill descent, front cornering lamps and steering responsive headlights, dual zone air-con, six-speaker audio and EyeSight DriverAssistareonhanddependingonthe model.

Prices start at $43,490 for the entry-level Forester and includes seven variants, four petrol only and three hybrids, featuring Subaru’s Symmetrical All-Wheel Drive sendingconstanttractiontoallfourwheels.

ATouringvariant,thetestvehicle,comes in at $50,990, while the range is topped off by the Forester Hybrid Touring at $55,990. Additions include gloss black radiator grille, leather and suede upholstery and 10-speakersoundsystem.

Making a debut in the new Forester is Subaru’s next generation Hybrid e-Boxer system mating a 2.5-litre horizontally opposed ICE with 90kW electric motor and 1.1kWhbattery,givingthevehicleaclaimed rangeofmorethan1000kmonafulltank.

Forester petrol and hybrid models are covered by Subaru’s five-year unlimited kilometre warranty and 12 months roadsideassist.

Styling

Subaru says the new SUV shows off a ‘bold evolution’ in Forester design that’s wider, more athletic and purpose-built for Australian conditions, with C-shaped LED headlamps, incorporating LED daytime running lights and cornering lamps for bettervisibilityatintersections.

While aerodynamics was a major consideration in shaping the vehicle –sleeker door mirrors mounted lower, for example – there’s still more than a nod to theoriginalruggedSUVshape.

All models have 18- or 19-inch alloy wheels, depending on the grade. The Touring rolls on the latter and is singled out for gloss black front grille, front and rearbumperaccents,plussidemirrorsand low-profileroofrails.

Every Forester sports an aluminium bonnet – reducing weight but adding strength with a view to enhancing pedestrian protection – while maintaining asolidSUVidentity.

Interior

Seatinghascomeinforparticularattention, with Subaru engineers working with anatomy experts to develop better support for the lower back and hips, helping keep the spine aligned and reduce tiredness on longjourneys.

Seat rails are mounted directly on to the chassis to minimise sway and absorb vibration giving a smoother ride, while safety is enhanced by a new side bolster design that helps reduce whiplash in a collision.

The Touring takes up leather and suede upholstery in black or brown with brown interiorstitchingandheatedandventilated frontseats.

Infotainment

Inside, the Forester has been revamped to lift comfort, connectivity and cabin

refinement. At the centre of the dash is an 11.6-inch full-HD infotainment touchscreen, designed for ease of use for wireless Apple CarPlay and wired and wirelessAndroidAuto.

An on-screen digital multi-function display and a second information screen arepositionedtoreducedriverdistraction. Belowisawirelessphonechargepad.

Front and rear USB ports include high-output USB-A and USB-C connectionsforfastercharging.Frontports offer convenient access for both device connectivity and power delivery, with rear ports enabling passenger charging, keeping tablets and smartphones powered upandreadythroughoutlongerjourneys.

The 10-speaker Harman/Kardon sound system with subwoofer supplies audio of a standard far beyond that expected in a mid-rangemarketvehicle.

Engines/transmissions

Petrol-only Foresters are powered by Subaru’s tried-and-true 2.5-litre Boxer engine developed for improved reliability andresponsewithlessnoise,vibrationand harshness.

Petrol-powered models feature Subaru’s latest-generation Lineartronic CVT, re-tuned for sharper performance and improved efficiency. A broader gear ratio range (now 8.1, up from 7.0) allows for stronger take-off acceleration and more relaxed highway cruising. Lower first and reverse gears aid hill climbing – even in reverse – while a new eight-speed manual modeenhancesdriverengagement.

ThisCVTispairedwithSubaru’supdated Active Torque Split AWD system, which

dynamically adjusts torque distribution –optimised to the vehicle’s weight balance – to deliver better steering response and more confident handling across varying surfaces.

Safety

One thing that has changed dramatically over the years since the first Forester made landfall Down Under is protection of passengers and pedestrians. For a start, new-generation vehicles, across the board, are fitted with nine airbags, including far-sideandfrontpassengercushion.

Latest generation EyeSight Driver Assist technologyisstandardacrosstherange.

Featured are a new wide-angle monocularcameradisplayingawiderfield of view, and the new emergency driving stop system, Subaru vision assist, and drivermonitoring.

Active systems include adaptive cruise control, autonomous emergency braking (front and rear), active torque vectoring, autonomousemergencysteeringandblind spotmonitoring.

The above is backed by emergency lane-keep assist, front side radar, lane centring,lanechangeandlane-keepassist.

Slow manoeuvres, including parking, is helped by rear cross-traffic alert, rear parking sensors, while traffic sign recognition and tyre pressure monitoring playtheirpartinsafedriving.

Driving

The2.5-litrepetrolengineproduces136kW of power at 5800rpm and 247Nm of torque at 3700rpm, its broad, flat torque curve ensuring smooth acceleration and strong

performanceacrossawiderangeofdriving conditions, particularly when overtaking orcarryingafullload.

A broader gear ratio range (now 8.1, up from 7.0) allows for stronger take-off acceleration and more relaxed highway cruising. Lower first and reverse gears aid hillclimbing–eveninreverse–whileanew eight-speedmanualmodeenhancesdriver engagement.

ThisCVTispairedwithSubaru’supdated Active Torque Split AWD system, which dynamically adjusts torque distribution –optimised to the vehicle’s weight balance – to deliver better steering response and more confident handling across varying surfaces.

Subaru rates Forester Touring fuel consumption at 7.9 litres per 100km on the combined urban/highway cycle with 180g/km carbon dioxide emissions. The test Touring recorded a tad over 10 litres per 100km around city and suburbs and less than six litres per 100 kilometres at motorwayspeeds.

Enhancedcabininsulationandvibration dampinghavereducedinteriornoise,while 360-degree Surround View Monitor has increased visibility and hence a pleasing on-andoff-roaddrivingexperience.

And with Subaru’s Symmetrical All-Wheel Drive system, enhanced Australiansuspensiontuning,plus220mm ground clearance, the Forester Touring is purpose built for local on- and off-road conditions.

Summary

No worries, the New Age Subaru Forester stillhasitsSUVchops.

Forester Touring is purpose built for local on- and off-road conditions. (Pictures: Supplied)

It took until week four of the summer season for the rain to impact matches across Melbourne’s north-west. However, StarWeeklyphotographer Ljubica Vrankovic still managed to capture some of the action among the wet on Saturday.

Heavens open up on play

Taylors Lakes’ Arjun Upadhyay. 512547_10
Altona Roosters’ Thanuj Thisakuttige and Aiden Elkington. 512549_05
Melton’s Joel Mitchener. 512547_03
Sunshine United. 512549_01
One let slip for Bacchus Marsh. 512545_07
Shanin Silva bowls for Bacchus Marsh. 512545_25
Some of the crowd at the first turf game at Bacchus Marsh Racecourse. 512545_15
Some of the crowd at the first turf game at Bacchus Marsh Racecourse. 512545_17
Some of the crowd at the first turf game at Bacchus Marsh Racecourse. 512545_20
Taylors Lakes batters. 512547_07

History for the Imperials

When the Williamstown Imperials were seeking volunteers to fill in for their fourth XIside,LydiaBrownjumpedatthechance.

One of the new players at the club and part of the club’s first women’s side, Brown made history when she stepped out with the fourth XI on 18 October.

Brown became the first female in the club’s history to play for one of the men’s teams.

She said it was an experience she wouldn’t forget.

“It’s pretty cool and everyone was super welcoming,” she said. “I was supported by the boys to play on Saturday.

“They made room for me and gave me a go and it was really fun.”

Brown said she’d always been keen to play with the men but the opportunity had never presented itself.

With the women’s side having a bye on

the weekend, the opportunity arose.

“We were training on Thursday night,” shesaid.“Theyneededpeopletofillinwith VCE. A lot of younger ones couldn’t play.

“They asked if any of the women would fill in and I said I could play.”

PlayingintheWesternSuburbsChurches and Community Cricket Association, the Imperials faced the Altona Roosters and got the win.

Brown had the chance to both bat and bowl.

“Unlucky that I was straight out for duck, but it was still pretty cool,” she said.

“My bowling was the best it has been for a few weeks. It was so awesome.”

It’s been a big few weeks for Brown as played in the club’s first women’s side as well.

She made 20 retired not out in the first game.

“To be able to play and having them backing the opportunity for a women’s

team, it’s a positive for the girl Imps going in the future,” she said.

BrownjoinedtheclubfromWilliamstown CYMS where she was part of a premiership team last season.

With the side not having the numbers, she made the move to the Imperials and hasn’t looked back.

“They are super supportive of us and they come to watch us play and help us at training,” she said.

“It’s a different league and you get to play with a full team and it’s good to learn as well.”

Brown said they had kept their expectations low being a new side with some new players in the team.

“We are super competitive and want to come away with the win.”

As for playing with the men again?

“I’m keen to play,” she said. “I enjoy playing cricket.”

Young volleyballer Chan is on the rise

Friendship ties at primary school helped forge a budding volleyball career that has already seen this month’s Don Deeble Sports Star play for Australia.

Denise Chan only started her volleyball career in 2021 because her school friends enjoyed playing.

“I tried many different sports including gymnastics, dancing, swimming, soccer and table tennis because my dad played it. Only one took my passion,” she said.

Chan started playing competition in 2022 with Western Region Volleyball on a Friday night in a social competition, gaining immediate recognition.

She quickly made her first state team.

“I played for the Victorian state team in 2022 and 2023, in the under-14 and under-15 White team,“ she said.

“In 2022, I trialled late as an emergency due to a few players being unable to play and luckily made the team and ended up as the team most valuable player.

“In 2023 I was the captain and awarded MVP of the white team again.”

It was while playing in that team Chan was exposed to better players and began her journey on the elite pathway in Australian Volleyball.

In 2024, she had a breakout year.

She trialled for the School Sport Victoria volleyball team and made the squad.

Following that national tournament she was selected in the All Schools Australian team.

She was selected in the Volleyball Victoria under-16 blue team and was made vice-captain.

Chan was awarded MVP in her side’s gold medal winning performance.

While success came quickly, Chan kept thingssimpleandisverygratefulforallthe opportunities that come her way.

After competing in the 2023 Australian Youth Volleyball Championships as the team captain and MVP, she attended an Australian volleyball camp in late 2023 for young aspiring volleyball players.

“The next thing I know I getting an email saying I’d made the under-16 Australian teamtoplayinThailand.Ididn’tevenknow they were scouting for that team,“ she said.

“While I knew most of the girls from playing against them at the under-16 Australian Championships we had never played together in a tournament until we arrived in Thailand. “We all quickly gave ourselves to the team, I had to learn a new role when one of our players took ill.

“While we didn’t reach the ultimate success in that competition it taught us all so much about the game and what it takes to be the best.”

Chan returned from Thailand with a sore back but then continued to play back-to-back tournaments.

Sadly, that took its toll and she had to withdrawfromplayingin2025tobeableto rehabilitate her injury.

Chan has thrown herself into her rehab.

“One saving grace is that I attend Maribyrnong Sports Academy which allows me to rehab at school with strength and conditioning staff.”

She undertakes five sessions a week which all involve strengthening her back and whole-body movement.

Chan said her strengths are her composure and ability to play any role required.

Sports shorts

NWMCA

Yarraville Club fell just short of victory in the North West Metropolitan Cricket Association Geoff Law Shield women’s competition on Sunday. The Clubbers made 4-101 from their overs with Simmerdeep Kaur top scoring with 23 at the top of the order. Moonee Valley made 5-106 in reply, hitting the winning runs in the 17th over. In the south west social competition, Spotswood lost to Gellibrand 2.

Baseball

Williamstown Wolves and Newport Rams had tough days in the Baseball Victoria summer league premier 1 first nine competition on Saturday. The Wolves, who made last season’s grand final, went down to Malvern, 10-8, leaving them with one win from three games. The Rams remain winless after a 14-1 loss to Essendon.

VTCA

Yarraville Club’s batters had another day out in the Victorian Turf Cricket Association senior division on Saturday. Facing Aberfeldie in a two-dayer, the Clubbers batted first and made 7-351 off 69 overs. Michael Hill scored 107 as the top four all made half centuries. Aberfeldie will resume at 1-17 after facing eight overs. Meanwhile, Altona North has already conceded first innings points to Sydenham-Hillside. Altona North was bowled out for 125, while Sydenham-Hillside finishing day one of the match at 3-129.

VTCA

“Also my leadership skills which I suppose is helped by my composure,” she said.

When asked about her sporting heroes, Chan went quiet, before saying, “my dad, Ivan just ran his first marathon last weekend in Melbourne, he is my hero!”

WhatdoesthefuturelooklikeforChan?”

“My dream is to represent Australia at the Olympics in volleyball,” she said.

“I would like to pursue my career by getting into college in America playing sports and pursuing my academic goals.”

The Don Deeble Sports Star Award is sponsored by the Yarraville Club Cricket Club, Strathmore Community Bank, the Deer Park Club, Ascot Vale Sports and Trophies and StarWeekly

If you would like to nominate a monthly winner or attend a dinner, contact swrsportsclub@gmail.comor0408556631.

St Andrew’s Footscray is on top after day one of its match with Wyndham Vale in the Victorian Turf Cricket Association Russell Pollock Shield match. St Andrew’s made 8-270 before declaring. Usman Khan top scored with 66. The decision proved to be the right one, with the Vales 2-12 at stumps. Meanwhile, the Williamstown Congs will need early wickets on day two against Donnybrook. The Congs were bowled out for 169, with Donnybrook 1-51 at stumps. Praveen Munigala top scored for the Congs with 48 at the top of the order.

Denise Chan. (Ljubica Vrankovic) 412070_06
Lydia Brown. (Supplied)

Hudson steps up at Devils

New North Footscray coach Robbie Hudson iskeentocontinuewhathasbeenstartedthe past couple of years at the Western Football League division 2 club.

Hudson has been an assistant coach at the Devils as they’ve gone from struggling to field one side to making the division 2 grand final this year.

When coach David Battistella decided to stepdownascoach,theyturnedtohisassistant coach to take on the role.

“It’s exciting and has been humbling enough to be part of the club the last two years,” Hudson said.

“I’vebeenfasttrackedintotheseniorrole

and it’s pretty humbling.”

Hudsonsaidhealwayswantedtogetinto coaching.

Hewasaplayingassistantcoachlastyear, before retiring and just being an assistant coach this year.

Stepping straight into the senior role wasn’t what he was planning on.

“I thought I would do some junior stuff first before stepping into a senior role,” he said.

“With Batts hanging up the coaching board it just felt right and the reaction and excitement from the group has been humbling.”

Hudson admits he had to think about taking on the role with a young family and

a business.

He said he quickly realised with the support of his family that it was too good an offer to turn down.

“Nothing is timed perfect,” he said. “It was a no brainer and it’s a great opportunity.”

Hudson said coming off a grand final has theclubinagoodpositiontobuildevenfurther.

Last season, they fielded their first third open age side showing the growth at the club.

“The culture has improved the last two years,” he said. “That’s been not only myself but the other coaching staff, committee and it’s exciting to take over in this position.”

Woodsmen hang tough and get the win

TherainheldofflongenoughforSpotswood to get an important win against Hoppers Crossing in the Victorian Sub-District Cricket Association east-west on Saturday. With the two sides expected to be among the contenders this season, the match was a good test of where both sides were at.

The Woodsmen made 279 on day one of the match, with Lachie McKenna top scoring with 93.

There were a few nervous moments on Saturday, but the Woodsmen bowlers were able to get the job done, bowling the Cats out for 258.

WoodsmencoachPaulBakersaiditwasa really good result.

“I thought the rain was going to come and ruin it for us,” he said. “It looked like it would hit and possibly wash us out.

“There was only light drizzle for 45 minutes to an hour.”

Baker said it was a tough day in the field, with the Cats batting really well.

He said while they could have had more runs on the board after a strong start to their

innings, but they were happy with 279.

“The boys fought it out and it was a hard score to chase,” he said.

On Saturday, Brett Smith proved to be the danger man for the Cats as he looked to guide his side to victory.

He finished 103 not out but ran out of partners in the end.

“I thought after the last drinks that they might get it,” Baker said.

“If we didn’t get the wickets, they would have got the runs.”

Sandeep Mandalika took 5-67 to be the pick of the bowlers for the Woodsmen.

The Woodsmen are one of five undefeated sides after two rounds.

The team is aiming to bounce back after missing finals last year.

Baker, who has taken on the coaching role this season, said they were happy with the squad they had put together

“It’sagoodmixandthere’sfewyoungfellows that have come into the club,” he said.

“One made 100 in the twos and some are bowling well, there’s a little bit of depth.”

The big signing for the Woodsmen was that of Blayde Baker from Victorian Premier

Hudsonsaidtheyhadprettymuchsigned everyone who had played senior football this year.

He said they would look to add a few more pieces.

“We’re having chats with a few extra guys who we are keen to top up with,” he said.

“We’re not a club to go out and splurge and pay big money to players.

“I don’t believe in that, it starts with culture and developing players and men.

“We’ll look at players who fit the team culture and the club and work hard with who we have.”

“We’ll look to add a couple more to get a little stronger and be the strawberries and cream on top.”

Seagulls sign former AFL player

Former Carlton midfielder-forward David Cuningham has joined Williamstown for next year’s Victorian Football League season.

Cuningham arrives at the Seagulls after a nine-year AFL career with Carlton, and a stint at Footscray’s VFL side this year.

Cuningham played 58 senior games for the Blues, kicking 30 goals during his time.

The 28-year-old, originally selected with pick 23 in the 2015 AFL draft, was a NAB AFL rising star nominee back in 2017.

Cuningham had a career-best season in 2023, averaging 13.8 disposals, 3.7 tackles, and 2.2 marks per game.

In 2025, Cuningham spent time with the Bulldogs, playing six games and kicking five goals.

Cricket.

Paul said it was nice to get his son across and he would help fill the hole left by Taylor Tatterson.

“Blayde has started the season well and added that extra depth of experience,” he said.

“Taylor is set to take 12 months off and come back next year.

“It’s hard to replace a quality player like that. Hopefully we get him back next year and add more depth to the side.”

The Woodsmen face Noble Park this Saturday.

Bakersaidtheyareastrongteamwiththe bat and it would be a good challenge.

Elsewhere, Altona got the job done against Werribee.

The A’s finished 4-155 in reply to the Tigers’ 153.

Yarraville had a strong bowling performance to skittle Mt Waverley for just 90 well short of the Eagles 9-244.

Williamstown avoided an outright loss against Noble Park.

The Seagulls finished 5-19 in their second innings.

Williamstown football operations general manager Ash Collins welcomed Cuningham’s arrival.

“We’re excited to have David join the Seagulls,” he said.

“He brings AFL experience, strong skills, and a competitive edge that will be invaluable for our team.

“He adds versatility across midfield and forward lines, combined with his determination and leadership, will strengthen our team as we aim for a strong next season.”

Cuningham is the second new signing for the Seagulls with AFL experience, joining Braydon Preuss in crossing to the club. The Seagulls have continued to announce re-signings with Max Philpot the latest to recommit to the club.

He has signed on for his 10th season having played 78 games for the club so far. Collins said Philpot is the type of player every club wants.

Lachie McKenna top scored on day one. (Ljubica Vrankovic) 510981_19
David Cuningham has joined Williamstown. (AAP Image/Darren England)

Altona eyes strong season

Altona is keen on not just making up the numbers in the Bowls Victoria weekend pennant premier division this season.

Having just missed out on finals last season, the A’s the side recruited a number of players to give themselves plenty of depth.

Coach Dane McKinnon said they had looked to strengthen the squad across all their sides.

“Looking from a club’s perspective, we’re always looking to bring in new players or experiencedplayersfromotherclubs,”hesaid.

“In premier we just missed finals and it came down to the last game. We didn’t have the same depth as some of the premier league sides.

“It cost us in the end.”

McKinnon said they would have a squad of about 26 for the premier division side, meaning players had to perform and there would be selection headaches.

He said the players understand that it takes a whole squad to have success at this level.

“We’ve bought in quite a few new faces, some experienced ones and a bit of youth,” he said

“It will help us this season.

“The squad understands you need to take a group mentality. There’s the hunger to play every week.”

Brett Dodd is the biggest signing for Altona.

He’s played for the club previously on a

couple of occasions and brings plenty of experience to the side.

McKinnon said they had also recruited a number of guys from the Geelong region who had been pretty impressive so far.

The A’s started their season on Saturday against MCC.

The match went down to the wire, with Altona winning by one shot, 74 (14)-73 (4).

Nathan Wilson had a one shot win for the A’s, while McKinnon had a two shot win. Matt Lawrence and Aaron Wilson both suffered one shot losses in their rinks.

McKinnon said naturally they want to rise up the ladder, but know it wouldn’t be an easy task.

“Our aim is we don’t want to make up the numbers,” he said. “We want to win the

Imps celebrate scoring an outright victory

Williamstown Imperials responded to a disappointing round one loss in the best possible way in the Victorian Turf Cricket Association Steve McNamara Shield.

On a day where rain ruined some games without a result, the Imperials capitalised on the opportunity to get an outright win against West Newport.

West Newport was bowled out for just 91 on day one with Kendrick Hatton and Brad Paull taking four wickets each for the Imperials.

The Imperials top order quickly got the job done, making 2-220 before declaring.

Andrew Henry made 115 off 94 balls.

West Newport lost two quick wickets and will resume at 2-25, still 104 runs behind.

The wickets continued to fall on day two as the Imperials bowled West Newport out for a second time, this time just for 67. Hatton took another six wickets to finish with 10 wickets for the game.

Imperials coach Tom Burton said they were pretty happy with that result.

“It was a good performance this week,” he said. “I think we let one slip in round one losing at Grand United.

“To bounce back with an outright is always pleasing. We got four wins on the weekend, it was a pretty good effort.”

Burton said while there was a chance of an outright win, it was about focusing on the basics.

He said they wanted to continue to what they did on day one and continue to put the ball in the right areas.

With rain on the horizon that was also something to consider.

“We were able to do that,” he said. “We were lucky enough to get it done before the rain.

“To take 20 wickets is really good. Sometimes it’s hard enough to get 10 wickets. It showed how well we bowled.

“To bounce back the way we did showed what we were able to do.”

Burton,whotookoverascoachintheoff season, said it had been a really good lead up to the season with the support of the other coaches.

“It was a really solid month and it’s been going really well which reflects in the results, hopefully they will continue this year.”

The Imperials this week face Gellibrand in a one-dayer.

Burtonsaidtheywillhavetobeatthetop of their game and were confident of getting the win at home.

In other results, Newport-Digman had to share the points with Tullamarine after the match finished in a tie.

Chasing the Demons’ 8-251 the Bulls also finished on 8-251 after a single on the final ball to level the scores.

at

315, Gellibrand was bowled out for just 88.

competition like all seven other teams.

“It’s such a competition and it’s so exciting. The first thing is to qualify for finals and then finis as high as we can.

“We want to give ourselves the best chance to make finals. We want to win the thing, but every side would be saying that.” Altona this week faces Bundoora on Saturday.

In other results, Yarraville Footscray lost the grand final rematch with Deer Park on Friday night.

It was a dominant display by the Parkers, who lost last season’s grand final, winning 87 (18)-60 (0).

Nathan Black’s rink lost by one shot for the Bulldogs, but all the other losses were by five or more shots.

McDonald’s rising star nomination

Western Bulldogs young gun Emma McDonald has been named the round 10 AFLW rising star nominee after a breakout performance against the Gold Coast Suns in Mackay.

The 19-year-old key forward kicked three goals from 11 disposals and took three marks in the 66-point win at Great Barrier Reef Arena on Sunday afternoon.

A basketball convert, McDonald was the Bulldogs’ top selection of the 2024 draft class, taken with pick eight from Oakleigh-Ashburton.

She made her league debut in the opening round against Melbourne and has played all but one game this season. McDonald’s selection makes her the Bulldogs’ first Rising Star nominee of the 2025 AFLW premiership season..

Meanwhile the Bulldogs finals hopes ended in a wet loss to Geelong in Ballarat. The Cats led by 15 points at three-quarter time of Sunday’s match but were left clinging to a five-point lead when Bulldogs midfielder Jessica Fitzgerald nailed a set shot with just under two minutes remaining.

A late soccered goal from Geelong forward Aishling Moloneywhich hit the goal umpire’s leg but was later deemed to be on track to be going through - sealed the 6.1 (37)-3.8 (26) win for the Cats.

The Bulldogs finish their season on Sunday against St Kilda.

Harry Butler top scored with 70. Williamstown CYMS lost a thriller to Sunbury.
Resuming
4-89 in reply to the Roar’s 161, the CYs were bowled out for 159 in the
64th over. GellibrandsufferedabiglosstoWestCoburg St Andrews.
Chasing
Tristan Alsop. (Ljubica Vrankovic)
Emma McDonald. (James Wiltshire/AFL Photos)

Dear Property Owner,

Are you satisfied with the way your investment property is currently managed?

Are you confident that the service you receive from your current agent reflects the fees you pay?

Do you receive regular updates on your property’s performance?

Do you know the current market value of your property?

If you answered “No” to any of these questions, it may be time to consider River Edge Real Estate for personalised property management and sales services.

At River Edge Real Estate, property is our passion, and service is our commitment. Referred to as “the property people”, we pride ourselves on delivering exceptional client service tailored to your needs. Our fees are competitive and negotiable, ensuring you receive the maximum return on your investment, supported by sound advice from our experienced property managers and sales consultants.

With our professional property management team, landlords can have peace of mind knowing their investment is in safe and competent hands.

For a free, no-obligation discussion regarding your investment property—whether renting or selling—please contact the team at River Edge Real Estate on:

Phone: 9488 0588

Email: akarlis@riveredgerealestate.com.au Website: www.riveredgerealestate.com.au

Kind regards,

The River Edge Real Estate Team A 20/157 Hyde Street, Yarraville VIC 3013 | E

Turn static files into dynamic content formats.

Create a flipbook
Star Weekly - Hobsons Bay Maribyrnong - 29th October 2025 by Star News Group - Issuu