

![]()





THE search is on for quality properties that suit buyer needs.
Much like the post-Covid market, finding the house that meets demand is getting harder and harder.
Peter TeWhata at Tom Offermann Real Estate said significant enquiry was coming from those already living in Noosa and were shifting to improve position, style of house or downsizing.
At the same time there were those who had been renting for quite some time, waiting for the property that suits their needs to become available.
He said those inspecting a single-level home with pool at Noosa Heads were a mixture of downsizers, young families and those attracted by the zoning for short-term accommodation.
The property, at 6 White Beech Rd, offers four bedrooms, two bathrooms and three-car accommodation. It goes to auction at 11am Saturday, 16 May.
“It’s a beautiful single-level home on a 707sq m block,’’ Peter said. “North facing, custom design and with a triple garage - that’s a rarity here.
“There is great separation with a media room and main bedroom at one end of the house, and the other bedrooms plus second lounge at the other end.
“Very private from the street, it is a modern contemporary home in today’s market, extremely garage a bonus
Established planting of bird-attracting sub-tropical shrubs in the front garden provide privacy and complement the Elysium estate’s strong connection to the lake and park surrounds.
Inside, the designer residence features open-plan, high-ceilinged living/dining spaces with banks of windows, plantation shutters and glass sliders to maximise natural light

The ’disappearing’ doors reveal a lush lawn and a wide green backdrop to the fenceline. Taking centre stage and optimising the northerly aspect is an undercover terrace which stretches to incorporate the pool.
The kitchen comes with a stone-topped island bench, Westinghouse free-standing stove with five-ring gas cooktop and oven, LG dishwasher, lustre-tiled splashback, white 2-pac cabinetry, and a walk-in pantry and wine fridge.
In the north wing and accessing outdoors is the main ensuite with plantation shutters of two walls, and a walk-in robe. The grey-tiled ensuite has a double vanity, glass doors on the shower and the toilet, also a big white oval tub.
Nearby is a media room with block-out blinds, also a laundry with heaps of storage and a drying court.
In the east wing is a retreat with a hang-out zone, three carpeted double bedrooms with built-in robes, shutters, a family-size bathroom with a skylight, plus a powder room.
Peter recently sold a three-bedroom house with media room in Elysium for sub-$2m and has another single-level home in that locality about to hit the market.
RING
Ringing the auction bell recently was Anita Nichols of Laguna Real Estate.
A three-bedroom, three-bathroom, two-car penthouse apartment at 10/30 Edgar Bennett Ave, Noosa Heads, has sold post-auction for $2.425m.
The appeal was the view of the whole Noosa River system from a spacious rooftop terrace, as well as the spacious living area and kitchen.
There was a lot of interest from Sydney and Brisbane, but the eventual buyers were from Victoria’s Mornington Peninsula.
Anita then sold a two-bedroom, two-
bathroom, one-car river-front apartment postauction with colleague Craig Taylor to Brisbane buyers.
Making it three sales in a row for Anita was the two-bedroom, one-bathroom, one-car apartment 10/2 Dolphin Cres, Noosaville, that sold to Brisbane buyers for $935,000.
With two bedrooms and renovated bathroom upstairs, the lower level featured an open-plan kitchen, dining and living areas opening to a north-facing courtyard.
HINTERLAND SUCCESS
Hinternoosa’s Henry Reynolds had a successful outcome at a Doonan auction that came down to the last two standing.
The three-bedroom, three-bathroom house on 6128sq m at 15 Mallee Close needed attention and the six registered bidders were aware of the condition it was in.
Bidding started around the $1m and stalled at $1.37m, then some cheeky $500 rises became $1000s and a knock-out bid of $2000 saw it go at $1.430m to a young family.
“It was heart-in-the-mouth bidding,’’ Henry said. “The winners came to buy.
“He works in construction and they had already reconfigured the floorplan to suit the family.’’
Henry has a house on 0.77ha in Doonan going to market in the high $1m; also a house with pool at Peregian Springs in which they are looking at offers around $1.7m.
SPACE AND FLEXIBILITY
It’s a great home for families of all ages and in a top location on a large corner block.
Rick Daniel at Coastal Noosa is taking the four-bedroom, three-bathroom, one-car house, pool, at 18 Oceania Cres, Sunshine Beach, to auction Friday, 22 May, at 12pm.
“This is a house with character but also

A four-bedroom, two-bathroom, two-car house, pool, on 6829sq m, shed, at 58-62 Marlock Ct, Doonan, goes to auction Friday, 15 May, at 3pm. (549654)

A three-bedroom, three-bathroom, two-car penthouse apartment 10/30 Edgar Bennett Ave, Noosa Heads, has sold post-auction with Anita Nichols of Laguna Real Estate. (549654)
solid double-brick construction which you don’t too much of these days,’’ he said. “With a park around the back, you are close to the Sunshine Beach village as well as the schools.’’
Set on an 869sq m corner block, the twolevel house combines space, lifestyle, and flexibility. It features dual living zones and a versatile fourth bedroom/office.
The ground level showcases a beautifully renovated kitchen that easily connects to the outdoor deck and entertaining area.
This level also incorporates an open-plan living area with fireplace, a fourth airconditioned bedroom configured as an office or guest suite, and a separate bathroom.
Expansive north-facing decks extend the living space outdoors, flowing to the 8m pool.
Upstairs, the main bedroom offers a walk-in robe, private ensuite and its own deck overlooking tranquil natural surrounds. Two additional bedrooms are serviced by a stylishlyrenovated central bathroom.
As well as air-conditioning to the main living area, there are ceiling fans throughout.
The property also features off-street parking, ideal for storing recreational items such as trailers, boats or caravans.
Caroline Johnstone at Hinternoosa has listed quite a diamond at Doonan, and it goes to auction Friday, 15 May, at 3pm.
The four-bedroom, two-bathroom, two-car house on 6829sq m, shed, at 58-62 Marlock Ct comes with infinity pool and thatch-roofed pavilion. Set in a quiet end-of-court position, this colonial-style charmer is a single-level brick home on flat, fully-usable and fully-fenced land.
It offers space, privacy and an exciting opportunity to renovate and add value, Caroline said.


The home features comfortable family living enhanced by ducted air-conditioning and a combustion fireplace.
The family kitchen overlooks the backyard and pool area, making it ideal for everyday living and entertaining while keeping an eye on children.
Outdoors, the infinity-edge swimming pool is complemented by a thatched-roof pavilion that creates space for entertaining.
As well as a 9m by 6m shed, there is a 9m by 3m carport, two-car accommodation, solar power, and an electric gate with a sealed double entry driveway.
FORTHCOMING AUCTIONS
FRIDAY, 15 May
Doonan
• 58-62 Marlock Ct: 4bed, 2bath, 2car house, pool on 6829sq m, shed, 3pm, Caroline Johnston 0409 953 311 Hinternoosa

SATURDAY, 16 May
Castaways Beach
• 27/516 David Low Way: 4bed, 3bath, 2car beachside house, pool, 2pm, Cameron Uruqhart 0411 757 570 Tom Offermann Real Estate
Noosa Heads
• 6 White Beech Rd: 4bed, 2bath, 3car house, pool, 11am, Peter TeWhata 0423 972 034 Tom Offermann Real Estate
• 24 Noosa Pde: 5bed, 2bath, 2car waterfront house, jetty, 12pm, Rebekah Offermann 0413 044 241 Tom Offermann 07 5449 2500 Tom Offermann Real Estate
Noosaville
• 32/24 Munna Cres: 2bed, 2bath, 1car subpenthouse waterfront apartment, 1pm, Eliza Coppin 0423 726 639 Tom Offermann Real Estate. ●








AUCTIONSATURDAY 12.00PM



Itisirrefutable.NoosaParadeisarealestateHolyGrail, aselectrowof36houseswithacoveted,absolute riverfrontaddress,onthedoorstepofglamorous HastingsStreet.And24NoosaParadeisattheprime endofthisstrip,amere10housesfromtheGarth ProwdBridgeandElysiumResort.Boastingincredible bay-spanningviewsandanortherlyaspectacrossa wideandtranquilreachoftheNoosaRivertoapristine
stretchofbushland,edgedbyawispofshimmering sand.Atributetoitslocation,naturalenvironmentand perfectlypoisedonasizeableyetprivatesitewitha 20mwaterfrontageandjetty,thisretro,playfulparadise isacelebrationofcolour,quirkinessandcontrasts.
Auction Saturday16May12.00pm
View Saturday11.30am


Agent RebekahO ermann 0413044241 rebekah@o ermann.com.au


Agent TomO ermann tom@o ermann.com.au tom@o ermann.com.au
AUCTIONSATURDAY 1.00PM




Imaginetheunbeatablemagnetismofasubpenthouse blessedwithscene-stealing180°viewsofbobbing pleasurecraftontheriver,pelicansandospreys glidingabove,whilstembracingawaterfrontdotted withswayingcoconutpalms,addingsplashesofthe Caribbeantocomplementthecurvaceousarchitectural linesofaholidayparadise.Inside,freshfromthe glossypagesofBelle,theimpossiblebeautyofthe
reimaginationisenrichedwithcustomdesign,furniture andaccessoriesusingbluehuestocomplement. Admirethewhite-brightwallsofplantationshutters, stunningtilesandstonetexturesandhowdisappearing doorstothesemi-wraparoundterracewith entertainingoptionsgalore,invitesnaturallightto shadowdanceonthewhite-washedoakflooring. Thisistheheartofclass.
Auction Saturday16May1.00pm
View Saturday12.30pm
Agent ElizaCoppin 0423726639 eliza@o ermann.com.au


AUCTIONSATURDAY 2.00PM




Imaginecloudlessblueskies,white-tippedwavesrolling infromtheturquoiseCoralSea,andsqueakywhite sandalmostatyourdoorstep,witheagle-eyeviews stretchingnorthandsweepingsouthalongtheeastern beachestoPointArkwright.Thisislessahome,morea fullyrealisedcoastalescape.
Privatelynestledwithintheexclusiveandtightlyheld NoosaDunesenclave,justmomentstotoes-in-the-
sand,theelevatedresidencecapturespanoramic seascapesfromeveryvantage.Designedwithstrong form,enduringmaterialsandminimalmaintenance inmind,it’sasanctuarywhereoutlookandocean soundscapetakecentrestage.
Wakedailytotherhythmofwavesanduninterrupted horizons.Paradisefound?Absolutely.
Auction Saturday16May2.00pm View Saturday1.30pm
Agent CameronUruqhart 0411757570 cameron@o ermann.com.au






Seizetheday!Thisravishingbeauty,fashionedwith 5-starclassreallytugsattheheartstringswith sophistication,anditsindisputablycovetedlocationis onasitelargerthanmost.Terracesostensiblyhover overthelily-paddedlakeseparatingthesubstantial residencefromthe17thfairwayandbeyondtowide viewsofthelushinternationallyratedcourse. Beinstantlycaptivatedbythegallery-likehallway,
whereastrikingwallofglassconnectstothe spectacularpoolpavilionandsun-drenchedterrace, evokingtheambienceofaboutiquehotel.Expansive living,diningandleisurezonesflowseamlesslyindoors andout.Asanaddedlifestyleadvantage,theproperty alsoincludesa12-monthgolfmembershipcomplete withbuggy,offeringexclusiveaccesstoapremier gol ngexperience.
Price $5.5M View
Saturday11.00am-12.00pm
Agent JillGoode 0418714653 jill@offermann.com.au


Privatelypositionedwithinapeacefulcul-de-sac,9CapriCourtdeliversspace, serenityandexceptionalconvenience,justmomentsfromthevibrantheartof NoosaJunction.Light-filledinteriorswelcomewithaninvitinglivingzone, owingto aprivatealfrescoterracedesignedforeffortlessentertainingandrelaxedcoastal living.
Atitscentre,thewell-appointedkitchenoffersgenerousstorage,breakfastbar seatingandseamlessconnectiontodiningandoutdoorspaces.Thetranquilmaster suiteenjoyscourtyardaccessandaleafyoutlook,whilethreeadditionalbedrooms providecomfortableaccommodationforfamilyorguests.
Beyond,theexpansivereargardenpresentsexcitingpotentialforapoolorfuture extension,withscopetocapitaliseonelevatedviewsacrosstheNationalParkand coastline.

Auction
Saturday23May12pm
View Saturday&Wednesday 10.00am-10.30am

Agent NicHunter 0421785512 nic@offermann.com.au
ThelureofSunshineBeachisimpossibletoignoreespeciallywhentheutopian dreamisaprivate,safe,secureunrivalledlifestyle,500mtothesurfclub,beachand villagehub;jointhefitandsuper-stokedforanearlymorningoceanswimorcatch treasuredsurfbreaksintheNoosaNationalPark’sAlexandriaBay,just550maway! Sensationallysequestered,takethemeanderingpathwaytotheentryofthis covetedtownhome,neighbouringanexpansivepark.
Insideisdesignedforthegoodlifeandmimicsoutdoorswithcomplementaryfit outandcuratedartifacts.Banksofdisappearingdoorsacrossthedesignatedhighceilingedlivinganddininglevels,invitenaturallightfrombothundercoverterraces toshadowdanceacrossthelimewashed-effectstone oor.

A 3 B 2 C 1

Auction
Saturday23May1.00pm
View Sat10.30am-11.00am Wed11.30am-12.00pm

Agent Steven Field 0447915953
steven@offermann.com.au

Adesirablebeachsidelifestyleisonofferwiththepurchaseofthisquality-built, well-designeddoublestoreyfamilyhome,inanelevatedpositionona780m2 block,whereprivacyandnaturallightaremaximised;literallytwominutes’walkto kilometresofspectacularcoastline:thesoundofthesurfwilllureyoutothesand everysingleday.
Thefloorplanisultrafamily-friendlyprovidinggoodseparationandfacilitating seamlessindoor/outdoorlivingverymuchinsymmetrywiththeNoosaclimateand lifestylewherethesunnyweatherenticesoneoutsideforexercise,relaxation,and entertaining.
Sophysicallyclosetoawhisper-quietstretchofbeachwhereyoumightnotpass anothersoulonyouroceansidesojourn;thisiscoastalblissofacalibremaycanonly dreamof…

Auction Saturday30May1.00pm
View Sat9.30am-10.00am &Wed10.30am-11.00am

Agent Steven Field 0447915953 steven@offermann.com.au
IntheglamorousheartofHastingsStreet,Apartment5TheEmeralddelivers thequintessentialNoosalifestylejuststepstocafés,restaurants,boutiquesand thegoldensandsofNoosaMainBeach.Light-filledinteriorsspillseamlesslytoa generousundercoverterrace,whereleafygreeneryframesglimpsesofHastings Street’svibrantenergy.Theoversizedmastersuitewithsleekensuiteaddsrare apartment-styleluxury,whileresortfacilitiesincludingaheatedlagoonpool,spa, sauna,li accessandsecureparkingcompletethepicture.Withstrongyear-round holidaybookingsandprofessionalon-sitemanagement,thisbeachy-chichavenisa superblifestyleandinvestmentopportunity.

Price $3.65M
View
Saturday 1.00pm-1.30pm

Agent JesseStowers 0414367282 jesse@offermann.com.au


PICTURE the unbeatable magnetism of a lavish hideaway with squeaky white sand on your doorstep, and the ever-changing visual tableaux of scene-stealing 180° views of the Noosa River. Imagine if the waterfront apartment with the perfect northerly aspect was yours? Easy. Just bring your holiday spirit in spades, also sunscreen and fundamentals. Everything else is here.
Halcyon days begin at the front entrance with a unique dose of cool factor whilst maintaining the perfect uber chic-meets-classic look, thanks to a recently completed high-end refurbishment.
Lofty ceilings, plantation shutters, and next level bragging rights come into play, when a wall of disappearing doors and diaphanous sheers invites bright light to shadow dance over the natural stone-hued flooring, in the expansive individually-styled living and dining spaces.
Adding to the monochromatic aesthetic treat with a serious nod to nature, are sink-into fabric covered sofas, bold solid timber coffee tables, custom cabinetry, hessian rugs, and specially chosen artworks in various mediums. Note the complementary accessories in the dining space with oak table, rattan and oak chairs, plus wine fridge and glasses cabinetry for those with a penchant for dinner parties.
Ensuring entertaining is a breeze indoors and out, the designer kitchen is commensurate. It has a stainless-steel benchtop and creamywhite cabinetry; the stone-topped island breakfast bar has a linear pendant; and every culinary hero will love having the hydro tap and suite of the latest Miele appliances.
Outdoors as the pristine Noosa River flows past the dream terrace and exclusive-use lawn with a couple of steps to the river foreshore, thoughts of fishing, kayaking, boating, maybe walking to Hastings Street disappear into the joy of just lying there in the sun with a cool one in hand and watching others making hay until the sun sets.
When it comes to dreamtime there are three classy bedrooms. The white-bright premier suite has access to the terrace also beautiful views to wake up to. The king bed has custom timber headboard, comfy chair and ottoman to have a cuppa or watch television, solid timber bedside tables with lamps, and a walk-in robe. The stunning ensuite with pastel grey tiles including hexagonal mosaics, has cream stone-topped two-basin cabinetry and a bathtub.
Two bedrooms with plantation shutters and built-in robes have been similarly styled, also the bathroom with stone-topped single basin cabinetry, and the shower has timber seating
“This totally charismatic and larger type apartment on Noosa River waterfront exudes
5-stars,” comments Tom Offermann Real Estate agent Jesse Stowers, “plus it’s in a location that’s second-to-none. It’s a short walk to Quamby Place with popular waterfront restaurants and bars also park-side cafes and speciality shops. And don’t forget, take a ferry ride to Hastings Street from the jetty at Rickys.
“Hastings Street with its sophisticated boutiques, art galleries, beachside restaurants and bars is a short level stroll away, also Noosa Main Beach, plus a little further is the famous Noosa National Park and world recognised surfing reserve. What’s not to love?
“The amenable climate and a town brimful with natural assets, turns holidaymakers and astute investors into property buyers and it is not going to stop. Many of these buyers will not compromise on having an exclusive Noosa Heads’ address. Sundrenched especially in winter, it affords the convenience of living in the hub with everything wonderful to eat, see and do, safe in the knowledge their investment is underpinned by a never-ending pool of future buyers also wanting the same.” Insider Intel:
• Apartment Area: 197m²
• Inventory: fully inclusive to cater for highyielding visitor market
• Approved for full time short term holiday letting
• Noosa Quays Complex: 25 luxury apartments; North facing; heated pool, sauna, BBQ facilities, half court tennis, mooring & jetty on private beach, on-site management
• North-facing undercover terrace; lawn area & garden, few steps onto beach
• Interior Design: refreshed, refurnished & restyled April 2026; complete reno 2019;
• Features: ground floor, 1 neighbour; end of building; plantation shutters incl side windows; secure screen & front entry doors; natural stone hued flooring; hessian rugs; artworks; mirrors; ducted a/c & fans; wispy cream sheers to terrace
• Living/Dining: 2 cream fabric sofas; solid timber coffee tables, custom cabinetry & wall shelving; oak dining table w 5 timber & rattan chairs; wine fridge & glasses cabinetry
• Kitchen: L-shape w stainless steel benchtop & creamy white cabinetry; 1.2m stone-topped island breakfast bar w linear pendant & stools; pantry & soft close drawers; HydroTap; Miele oven, cooktop, integrated dishwasher & fridge
• Bedrooms: 3, incl bright premier king suite w access to terrace & views; timber headboard, comfy chair & ottoman, sold timber bedside table w lamps; WIR; ensuite w stone topped 2 basin cabinetry, bathtub; 2 bedrooms w

plantation shutters; BIRs & bathrooms w pastel grey tiles incl hexagonal mosaics; cream stone topped single basin cabinetry; shower w timber seating
• Extras: laundry w grey tiles, SS sink, Simpson Dryer & LG washer; ample storage; undercover designated single car park w storeroom
• Location: close to Quamby Place restaurants/ cafes, bottle shop, general store, Noosa Ferry stop; short walk to Hastings Street, Noosa Main Beach, Noosa National Park, transport links; Noosa Village & Gibson Road shopping precincts; Gympie Terrace restaurants, Noosa River activities & boat hire; riverside picnic areas & cycle tracks.

Address: 1/4 Quamby Place, NOOSA HEADS Description: 3 bedrooms, 2 bathrooms, 1 garage
Auction: Saturday 6 June 1pm Inspect: Satuday 12.00-12.30pm
Contact: Jesse Stowers 0414 367 282, TOM OFFERMANN REAL ESTATE














COULD this be the waterfront apartment you’ve been dreaming of?
Positioned directly on the Noosa River foreshore with sparkling, uninterrupted views and a peaceful nature reserve as your backdrop, this is Noosa living at its most enviable.
From the moment you arrive, this serene and sophisticated retreat leaves a lasting impression. Flooded with natural light and cooled by gentle breezes, the interior strikes a perfect balance between relaxed and refined — rich timber floors, louvred windows, crisp white shutters, and a elegant grey palette come together to create an effortlessly contemporary feel.
The boundary between inside and out simply disappears, thanks to a generous wraparound entertaining balcony that embraces the open-plan living. A coconut palm sways within arm’s reach of the outdoor setting as the river frames an ever-changing scene of beauty — sunlight dancing on the river’s surface, pelicans coasting past, kayakers heading upstream, and paddleboarders making the most of one of Queensland’s most enviable stretches of waterway.
Down below, life gets even better. There’s a jetty for fishing or tying up the boat, a residents-only waterfront pool, and a bbq terrace beside lush lawn that rolls gently down to the white sandy foreshore and the river’s calm, clear shallows. For the kids, it’s basically paradise — buckets, spades, sandcastles, and safe swimming right on the doorstep.
Back inside, the master bedroom continues the river view theme, complete with a VJ-panel feature wall, built-in robes, and a well-sized modern ensuite. A beautifully curved hallway wall with timber detailing makes a striking impression, leading through to a media room with fold out sofa bed that has a screening option for privacy and seclusion when hosting added guests. Further along another bedroom is configured with two single beds and features stylish VJ walls. The shared family bathroom incorporates an integrated laundry and separate toilet.
The sleek galley style kitchen is fitted with quality modern appliances and enjoys abundant natural light alongside glorious river views. Comfortably nearby, the timber dining table will cater to the hosting home chef, though with the convenience of being strolling distance to the 5 star restaurant precinct at Quamby Place and cafe culture of Hastings Street, it will be a tough decision not to indulge out.
“You’re walking distance to everything that makes Noosa so special — the boutiques and vibrant atmosphere of Hastings Street, Laguna Bay and north-facing Main Beach, where the conditions for swimming and surfing are fantastic year round.”
4/7

“This beautifully presented apartment sits within an intimate complex of just six, tucked away in a peaceful cul-de-sac,” says Jesse Stowers of Tom Offermann Real Estate, who is taking the property to auction on Saturday, 23rd May 2026.
Facts & Features:
• Area: 125m² under roof plus allocated car park with two private lockable storage spaces
• Complex: Pisces — exclusive boutique complex of just 6 apartments; quiet cul-de-sac
• On-site facilities: Waterfront swimming pool, private jetty / pontoon, lawn area extending to the water’s edge, BBQ pavilion.
• Parking: Single secure allocated parking with two private secure store rooms
• Kitchen: Westinghouse oven, cooktop & refrigerator; Fisher & Paykel dish drawer
• Security: Keypad/Key operated pedestrian gate and sliding motored vehicle gate
• Climate control: Split-system air conditioning in living area plus ceiling fans throughout
• Inclusions: Fully furnished for instant use and enjoyment
• Location: Walk to Hastings Street, Noosa Main Beach & Gympie Terrace; Noosa National Park and the world-renowned surfing reserve




Sky-High Masterpiece with Unrivalled 180 Coastal Views Across Noosa
Perched at the pinnacle of prestige and crafted without compromise, this extraordinary residence is a triumph of design and craftsmanship by acclaimed architect Tim Ditchfield, masterfully brought to life by Peter Curley as his own private sanctuary. This is more than a home, it is a statement of lifestyle, location, and legacy.







4 3 2
OPEN SATURDAY 12 - 12:30PM THURSDAY 5 - 5:30PM
PRICE: CONTACT AGENT
Commanding what is arguably one of the finest positions in Noosa Heads, the home captures uninterrupted, never-tobe-built-out 180-degree panoramic views sweeping from Laguna Bay across the Noosa River, stretching to Noosa North Shore, and beyond to the distant beauty of Double Island Point.








Adam Watts

Director and Principal 0410 512 364



adam@wattspropertygroup.com.au

watts Direc adam
wattspropertygroup.com.au




Rikki Roberts PA to Adam Watts 0439 632 922 rikki@wattspropertygroup.com.au

2/29 Sunshine Beach Rd, Noosa Heads 2/24 Duke Street, Sunshine Beach
eads each oberts m Watts com.au




A peaceful, leafy stroll from the energy of Hastings Street, Apartment 14 at The Lookout Resort is elevated high among the treetops, immersed in the natural beauty of Noosa National Park. Generously scaled for such a tightly held central address, this is a rare opportunity to secure a refined resort residence where privacy, position and lifestyle converge.
Accessed via direct lift and designed for effortless single-level living, the apartment immediately impresses with soaring 2.7m ceilings and expansive open-plan interiors. The kitchen, living and dining domain flows seamlessly to a covered alfresco terrace, where wide banks of windows frame a tranquil tree-canopy outlook — creating a calming, immersive connection to nature reminiscent of the elevated serenity so admired in our recent Picture Point offering.
The well-appointed U-shaped kitchen provides ample storage and functionality, perfectly suited to both relaxed holiday living and extended stays. Ducted air-conditioning services the living area and all three bedrooms, ensuring year-round comfort.
The master suite is privately positioned and beautifully proportioned, complete with its own ensuite and access to a secluded balcony where full-width windows capture lush tropical vistas. Two additional bedrooms with built-in robes are serviced by a central bathroom with bathtub, ideal for families or guest accommodation. A separate laundry and excellent internal storage further enhance practicality and liveability.
In this prestigious hillside setting, you can leave your vehicle securely parked and embrace a true walk-to-everything lifestyle — from Hastings Street’s boutiques and dining to Noosa Main Beach and the National Park coastal trails. Impeccably managed and tightly held, The Lookout Resort offers pristine tropical gardens, a heated lagoon-style pool, spa and gymnasium, reinforcing its reputation as one of Noosa’s most meticulously maintained complexes.
Whether secured as a private coastal retreat or a high-performing holiday investment, Apartment 14 presents a compelling blend of lifestyle, elevation and long-term capital growth in one of Noosa Heads’ most desirable resort addresses.

































PERFECTLY positioned just five minutes from Hastings Street, Noosa River and the beautiful beaches of Noosa, this stunning Villa offers the ultimate combination of privacy, tranquillity and luxury living.
Nestled in the sought-after Woods Precinct on an elevated block, the home is thoughtfully designed to capture the eastern sunrise and soothing coastal breezes, while taking in filtered golf course views through lush established gardens.
Step inside and you’ll immediately appreciate the generous open-plan layout, filled with natural light and connecting seamlessly to multiple indoor and outdoor entertaining areas. The main living, dining and kitchen zones flow effortlessly to the sparkling fully tiled in-ground pool, the best pool area in Noosa Springs and surrounded by manicured gardens and the peaceful private view of the golf course.
A second living area sits at the heart of the home, opening onto a sunny private courtyard — the perfect spot for a morning coffee or quiet retreat. The lower level also includes a sought after downstairs spacious bedroom, ideal for
guests or a home office.
Upstairs, two beautiful ensuite bedrooms are positioned at opposite ends of the villa for privacy. The master suite enjoys a serene outlook across the golf course, providing the perfect sanctuary to unwind.
Lovingly maintained by its current owners, who are keen to sell, as committed elsewhere.
Features include:
• Mature, landscaped gardens
• Sparkling fully tiled in-ground pool
• Multiple indoor/outdoor living areas
• Air conditioning and ducted vacuum system
• Separate Golf buggy garage
• Private and secure setting
Within the prestigious gated Noosa Springs Golf & Spa Resort, residents enjoy 24-hour security and access to world-class facilities including:
• Award-winning championship golf course
• “Relish” restaurant and bar
• State-of-the-art gymnasium and 45m heated lap pool
• Renowned health spa and wellness retreat Experience luxury, lifestyle and peace of mind — all in one of Noosa’s most exclusive communities.

Address: 314/61 Noosa Springs Drive, NOOSA HEADS Description: 3 bedrooms, 3 bathrooms, 2 garage Price: $2,750,000 Inspect: By appointment
Contact: Joe Langley 0419 883 499, JOE LANGLEY REAL ESTATE


















IMAGINE stepping through your secure gated access and within moments feeling the soft, golden sands of Noosa’s Main Beach beneath your feet. A destination celebrated world-wide for its surf, tranquillity, and stunning natural beauty.
Positioned at the exclusive, tightly held eastern end of Hastings Street, adjacent to the pristine Noosa National Park, “Sandcastles” presents an extremely rare opportunity to secure a premier beachfront residence in a truly coveted location.
This exceptional ground floor apartment strikes a seamless blend of luxury, lifestyle, and investment pedigree. Dual access directly connecting you to the sparkling pool and the sandy shoreline, this property is a magnet for holidaymakers seeking a quintessential Noosa escape—ensuring strong guest demand, repeat bookings, and exceptional rental performance.
The thoughtfully designed one-bedroom layout features a full-sized kitchen, a generous living area with additional sofa bed, and an open-plan flow that effortlessly accommodates family and guests alike. Whether your vision is a high-performing investment, a private coastal sanctuary, or an elegant combination of both,

this residence delivers on every level.
Beyond your door lies one of Australia’s most celebrated precincts — world-class dining, boutique retail, and the scenic promenade of Hastings Street, all within a leisurely few minutes’ stroll.
Supported by professional on-site management, the impeccably maintained complex offers both peace of mind and
consistent income potential in a market where absolute beachfront opportunities remain tightly held and highly sought after.
Features:
• Absolute beachfront, north-facing orientation for stunning ocean views and sunlit living
• Prime ground floor position with dual access to pool and beach
• Spacious one-bedroom apartment with

car space
• Proven income stream with professional management
• Immediate access to Noosa’s famous sands and vibrant local cafe, retail, and restaurant scene
Don’t miss this once-in-a-lifetime opportunity to own your slice of Noosa’s legendary coastline — where every day feels like a holiday.
Address: “Sandcastles” Apt 7, 1 Hastings Street, NOOSA HEADS Description: 1 bedroom, 1 bathroom, 1 car Price: Upcoming Auction Inspect: Contact Agent Contact: Rick Daniel 0411 737 767, COASTAL NOOSA



Prime Sunshine Beach opportunity! Set on a substantial 869sqm corner block, this solid brick home combines space, lifestyle, and flexibility in a well- positioned pocket of Sunshine Beach. Dive into your own 8-metre pool, enjoy a huge yard perfect for families and pets, and entertain effortlessly outdoors.
22ND MAY AT 12:00PM
OPEN HOME: SATURDAY & THURSDAY 10:00AM - 10:30AM

RICK DANIEL 0411 737 767
3X
Located within both the primary and high school catchments of Sunshine Beach State School, this prime location is just a short stroll to Noosa National Park and the vibrant Sunshine Beach village, with its scenic parkland walkway. Additionally, convenient pedestrian access to Noosa Junction enhances everyday ease, connectivity, and lifestyle convenience.
coastalnoosa.com.au

EMBRACE the carefree spirit of white-water views stretching across the Coral Sea’s vibrant blue, with glimpses of golden sand below and dolphins dancing in the waves. This is coastal living at its most spectacular, perched in one of Sunshine Beach’s most tightly held streets where opportunities simply don’t come along often.
Set over three deliberately designed levels to capture every ray of light and maximize those breathtaking ocean panoramas, 22 Enterprise Street is a testament to sophisticated coastal architecture. The concrete construction ensures solidity and permanence, while the clever trilevel configuration creates distinct zones for living, entertaining, and pure retreat.
Adult sanctuary above the world
The top floor is reserved for ultimate indulgence. Here, the main suite reigns as a true private haven, complete with study space, walk-in wardrobe, and ensuite finished to exacting standards. Wake to whales breaching, fall asleep to the rhythm of the waves; this is your personal escape above it all.
Designed for the way life should be lived
The heart of this residence is the expansive open-plan living area: a space conceived

for gatherings, celebrations, and everyday moments that deserve a spectacular backdrop.
Step onto the large terrace where coastal breezes keep things perfectly comfortable yearround.
Three generous bedrooms plus a versatile bunk or rumpus room provide flexibility for families and guests, serviced by four luxurious bathrooms. The sparkling swimming pool offers your own private sanctuary when the beach feels just that touch too far.
Effortless modern living
Every detail has been considered. Air conditioning in every room ensures comfort in all seasons. Automated blinds and drapes
respond at your command. The large internal access double garage houses a Tesla battery and charger; where sustainability meets sophisticated convenience.
A street worth the wait Enterprise Street isn’t just tightly held, it’s treasured. Good neighbours who gather for an annual street party. A genuine sense of community that’s increasingly rare. Bordering Noosa National Park with walking tracks winding through to Alexander Bay and Hastings Street, you’re literally on the doorstep of nature’s playground where bush meets beach in the most extraordinary way.
The current owners, moving forward with an exciting new build project out of town, have made the decision to pass this spectacular home to its next custodians.
“Opportunities to buy in this tightly held street don’t come up often. This beach house is seriously for sale so well worth your enquiry,” states Tom Offermann Real Estate agent Steven Field. “How fabulous will it be to wake up to that amazing view every day!”
For those seeking a private, secure and matchless lifestyle with never-to-be-interrupted white water views from one of Sunshine Beach’s
most revered streets, this is the supreme seaside escape. The future value of this prized location will always be underpinned.
Insider Intel:
• House Area: 298m2
• Land Area: 506m2
• Short stay letting approved
• Uninterrupted white water Coral Sea views with beach glimpses
• Concrete construction; three-level design maximizing light and views
• Top floor master retreat with study, WIR, ensuite and those views
• Air conditioning throughout; automated blinds and drapes
• Large terrace perfect for whale watching
• Swimming pool; open-plan entertainer’s living space
• Tesla battery and charger in double internal access garage
• Bordering Noosa National Park; tracks to ABay and Hastings Street
• Tightly held street with sense of community; annual street parties
This is more than the idyllic seaside location, it’s your front row seat to 180° Coral Sea and Beach Views.
Address: 22 Enterprise Street, SUNSHINE BEACH Description: 3 bedrooms, 4 bathrooms, 2 garage, pool Price: On application Inspect: By appointment
Contact: Steven Field 0447 915 953, TOM OFFERMANN REAL ESTATE
BelliPark
Saturday16thMay
10.00AM-10.30AM19LockesLane328OffersOver$2,100,000Hinternoosa0404344399
BoreenPoint
Saturday16thMay
1.15PM-1.45PM2MangoLane323BYNEGOTIATIONPrestigePropertyGroupNoosa0415558656
CastawaysBeach
Saturday16thMay
10.00AM-10.30AM4DriftwoodDrive433AuctionTomOffermannRealEstate0447915953
1.30PM-2.00PM3/512DavidLowWay432AuctionTomOffermannRealEstate0411757570
Wednesday20thMay
11.00AM-11.30AM4DriftwoodDrive433AuctionTomOffermannRealEstate0447915953
Cooroibah
Saturday16thMay
12.00PM-12.30PM346LakeCooroibahRoad432$2,150,000TomOffermannRealEstate0423972034
Wednesday20thMay
12.00PM-12.30PM346LakeCooroibahRoad432$2,150,000TomOffermannRealEstate0423972034
Cooroy
Saturday16thMay
12.15PM-12.45PM5NorthedenCourt424OffersOver$2,395,000Hinternoosa0404344399 Doonan
Thursday14thMay
3.00PM-4.00PM58to62MarlockCourt423AuctionHinternoosa0409953311
Saturday16thMay
9.00AM-9.30AM23ValleyCourt422OffersOver$1,999,000Hinternoosa0404344399
10.00AM-11.00AM86LagunaGrove532Offersover$1,720,000SuzieMcDonaldRealEstate0420874813
11.00AM-11.30AM65NylanaWy334Offersover$2.4MCentury21ConollyHayGroup0400730457
Eumundi
Saturday16thMay
10.00AM-10.30AM6CookStreet332O/O$1,400,000LagunaRealEstate0411328488
10.00AM-10.30AM140JocelynDrive322OffersOver$2,999,000Hinternoosa0404344399
10.00AM-10.30AM127BMemorialDve433ByNegotiationWattsPropertyGroup0456636443
11.00AM-11.30AM8BooniahCourt432OffersOver$1,399,000Hinternoosa0404344399
NoosaHeads
Thursday14thMay
9.00AM-9.30AM14/1PicturePointCrescent321$3,200,000McLureRealEstate0400084975
10.00AM-10.30AM63/52HastingsStreet221AUCTIONMcLureRealEstate0400084975
11.00AM-11.30AM147/1EdgarBennettAvenue221$1,390,000McLureRealEstate0400084975
Friday15thMay
10.00AM-10.30AM14/1PicturePointCrescent321$3,200,000McLureRealEstate0400084975
11.00AM-11.30AM147/1EdgarBennettAvenue221$1,390,000McLureRealEstate0400084975
1.30PM-2.00PM63/52HastingsStreet221AUCTIONMcLureRealEstate0400084975
Saturday16thMay
9.00AM-9.30AM541/61NoosaSpringsDrive443GUIDE$3,495,000PrestigePropertyGroupNoosa0415558656
9.30AM-10.00AM2/10NatashaAvenue322ContactAgentCentury21ConollyHayGroup0438259956
9.30AM-10.00AM24KatharinaStreet222ContactAgentCentury21ConollyHayGroup0438259956
9.45AM-10.15AM232/61NoosaSpringsDrive32.52FROM$2.3MPrestigePropertyGroupNoosa0415558656
10.00AM-10.30AM14/1PicturePointCrescent321$3,200,000McLureRealEstate0400084975
10.00AM-10.30AM14WesleyCt532ByNegotiationCentury21ConollyHayGroup0429827224
10.00AM-10.30AM9CapriCourt422AuctionTomOffermannRealEstate0421785512
10.00AM-10.30AM154/61NoosaSpringsDr322$1.9millionJoeLangleyRealEstate0419883499
10.30AM-11.00AM135/61NoosaSpringsDrive332.5GUIDE$2.65MPrestigePropertyGroupNoosa0415558656
10.30AM-11.00AM6WhiteBeechRoad423AuctionTomOffermannRealEstate0423972034
10.30AM-11.00AM4/16SerenityClose322$4,150,000TomOffermannRealEstate0413044241
11.00AM-11.30AM314/61NoosaSpringsDr332$2.75millionJoeLangleyRealEstate0419883499 11.00AM-11.30AM147/1EdgarBennettAvenue221$1,390,000McLureRealEstate0400084975 11.00AM-11.30AM515/61NoosaSpringsDrive442$5,500,000TomOffermannRealEstate0418714653 11.00AM-11.30AM4/7PezaCourt221AuctionTomOffermannRealEstate0414367282 11.00AM-11.30AM15WyonaDrive322ByNegotiationWattsPropertyGroup0413582670 11.00AM-11.30AM1SanctuaryAvenue422OffersOver$2,250,000WattsPropertyGroup0410512364 11.00AM-11.45AM11LittleCoveRd442$14.6MCentury21ConollyHayGroup0422719041
11.15AM-11.45AM2SmokeBushDrive434GUIDE$2.3MPrestigePropertyGroupNoosa0415558656 11.30AM-12.00PM24NoosaParade522AuctionTomOffermannRealEstate0413044241 12.00PM-12.30PM346/61NoosaSpringsDrive43.52AUCTIONPrestigePropertyGroupNoosa0415558656 12.00PM-12.30PM1/4QuambyPlace321AuctionTomOffermannRealEstate0414367282 12.00PM-12.30PM7/1HastingsStreet111AuctionCoastalNoosa0411737767 12.30PM-1.00PM34ArkanaDrive432ContactAgentWattsPropertyGroup0410512364 1.00PM-1.30PM5/42HastingsStreet321$3,600,000TomOffermannRealEstate0414367282 2.00PM-2.30PM49WeybaEsp322ExpressionsofInterestCentury21ConollyHayGroup0422719041 2.00PM-2.30PM14BWyandraStreet432$3,100,000TomOffermannRealEstate0414367282
Wednesday20thMay
10.00AM-10.30AM9CapriCourt422AuctionTomOffermannRealEstate0421785512 10.00AM-10.30AM14/1PicturePointCrescent321$3,200,000McLureRealEstate0400084975 11.00AM-11.30AM147/1EdgarBennettAvenue221$1,390,000McLureRealEstate0400084975 12.00PM-12.30PM7/1HastingsStreet111AuctionCoastalNoosa0411737767
Thursday21stMay
5.00PM-5.30PM34ArkanaDrive432ContactAgentWattsPropertyGroup0410512364
Friday15thMay
3.30PM-4.00PM39DolphinCres322AuctionCentury21ConollyHayGroup0429827224
Saturday16thMay
9.00AM-9.30AM19SternlightStreet422$2,395,000TomOffermannRealEstate0423972034 10.00AM-10.30AM3/8PortsideCourt32+2POALagunaRealEstate0407379893 10.00AM-10.30AM2/22-24NannygaiStreet111$795,000LagunaRealEstate0434236110 11.00AM-11.30AM25RoseAshCrescent422SuitBuyersHigh$1MsLagunaRealEstate0434236110 11.00AM-11.30AM3/229-231GympieTerrace32+2$3,950,000LagunaRealEstate0407379893 12.00PM-12.30PM1&2/23EdwardStreet322OffersFrom$4.3MCentury21ConollyHayGroup0417624059 12.00PM-12.30PM30RegattaCircuit422$2.285MMcLurePrestige0499270691 12.30PM-1.00PM1/7WilliamSt323ContactAgentCentury21ConollyHayGroup0422719041 12.30PM-1.00PM32/24MunnaCrescent221AuctionTomOffermannRealEstate0423726639
Wednesday20thMay
11.00AM-11.30AM3/229-231GympieTerrace32+2$3,950,000LagunaRealEstate0407379893
PeregianBeach
Saturday16thMay
9.30AM-10.00AM338DavidLowWay421ContactAgentWattsPropertyGroup0410512364 10.00AM-10.30AM106PersimmonDrive432PriceGuide$3,000,000TomOffermannRealEstate0413319879 11.00AM-11.30AM9ShearwaterStreet532$5,250,000TomOffermannRealEstate0413319879 11.00AM-11.30AM97OrioleAve311ByNegotiationCentury21ConollyHayGroup0401807697
Pomona
Saturday16thMay
1.30PM-2.00PM51HollisRoad533OffersOver$1,799,000Hinternoosa0404344399
SunriseBeach
Saturday16thMay
10.00AM-10.30AM40NetherbyRise542$6,500,000WattsPropertyGroup0413582670
SunshineBeach
Thursday14thMay
10.00AM-10.30AM18OceaniaCrescent431AuctionCoastalNoosa0411737767
Saturday16thMay
9.00AM-9.30AM2/9CulgoaStreet211ContactAgentWattsPropertyGroup0413582670 9.00AM-9.45AM46EnterpriseSt322ContactAgentCentury21ConollyHayGroup0422719041 9.00AM-9.30AM21CrankStreet432ContactAgentTomOffermannRealEstate0421785512 10.00AM-10.30AM20AdamsSt432ContactAgentCentury21ConollyHayGroup0417624059 10.00AM-10.30AM49PacificAve424ByNegotiationCentury21ConollyHayGroup0401807697 10.00AM-10.30AM18OceaniaCrescent431AuctionCoastalNoosa0411737767 10.00AM-10.45AM17DukeStreet211$2.6mSunshineBeachRealEstate0417637697 10.00AM-10.30AM3/43DukeStreet221$1,650,000TomOffermannRealEstate0414367282 10.30AM-11.00AM27AdamsStreet433ContactAgentWattsPropertyGroup0410512364 11.00AM-11.30AM3/1FerrisStreet321AuctionTomOffermannRealEstate0447915953 11.30AM-12.00PM1/12BelmoreTerrace324ContactAgentWattsPropertyGroup0410512364 12.00PM-12.30PM1/18BryanSt431OffersFrom$3.8MCentury21ConollyHayGroup0400730457 12.00PM-12.30PM1/18BryanSt431OffersFrom$3.8MCentury21ConollyHayGroup0400730457
Wednesday20thMay
12.00PM-12.30PM3/1FerrisStreet321AuctionTomOffermannRealEstate0447915953
Thursday21stMay
10.00AM-10.30AM18OceaniaCrescent431AuctionCoastalNoosa0411737767 4.00PM-4.30PM27AdamsStreet433ContactAgentWattsPropertyGroup0410512364
Tewantin
Thursday14thMay
4.30PM-5.00PM9GumnutCourt313PriceGuide$1,190,000.00LagunaRealEstate0411774699
Friday15thMay
12.00PM-12.30PM2/11HiltonEsplanade322Auction7June@11amWattsPropertyGroup0418758465
4.00PM-4.30PM14AdaStreet324PresentalloffersLagunaRealEstate0438026300
Saturday16thMay
10.00AM-10.30AM2/11HiltonEsplanade322Auction7June@11amWattsPropertyGroup0418758465
10.00AM-10.30AM14AdaStreet324PresentalloffersLagunaRealEstate0438026300
11.00AM-11.30AM28CooroibahCrescent422O/O$1,750,000ConsideredLagunaRealEstate0411328488
11.30AM-12.00PM52WerinStreet422OffersOver$1,795,000WattsPropertyGroup0456636443
11.30AM-12.00PM61StAndrewsDrive322AuctionOnSiteSat16May12pmLagunaRealEstate0438026300
12.00PM-12.30PM26OutlookDrive321ByNegotiationLagunaRealEstate0434236110
Tuesday19thMay
4.30PM-5.00PM9GumnutCourt313PriceGuide$1,190,000.00LagunaRealEstate0411774699
Wednesday20thMay
11.00AM-11.30AM14AdaStreet324PresentalloffersLagunaRealEstate0438026300
CastawaysBeach
Saturday16thMay
2.00PM-2.30PM3/512DavidLowWay432AuctionTomOffermannRealEstate0411757570
Saturday30thMay
1.00PM-1.30PM4DriftwoodDrive433AuctionTomOffermannRealEstate0447915953 Doonan
Friday15thMay
3.00PM-3.30PM58to62MarlockCourt423AuctionHinternoosa0409953311 NoosaHeads
Friday15thMay
2.00PM-2.30PM63/52HastingsStreet221AUCTIONMcLureRealEstate0400084975
Saturday16thMay
11.00AM-11.30AM6WhiteBeechRoad423AuctionTomOffermannRealEstate0423972034
12.00PM-12.30PM24NoosaParade522AuctionTomOffermannRealEstate0413044241
Saturday23rdMay
12.00PM-12.30PM9CapriCourt422AuctionTomOffermannRealEstate0421785512
3.00PM-3.30PM4/7PezaCourt221AuctionTomOffermannRealEstate0414367282
Saturday6thJune
1.00PM-1.30PM1/4QuambyPlace321AuctionTomOffermannRealEstate0414367282
Friday12thJune
10.00AM-10.30AM7/1HastingsStreet111AuctionCoastalNoosa0411737767
Noosaville
Friday15thMay
4.00PM-4.30PM39DolphinCrescent322AuctionCentury21ConollyHayGroup0429827224
Saturday16thMay
1.00PM-1.30PM32/24MunnaCrescent221AuctionTomOffermannRealEstate0423726639
SunshineBeach
Friday22ndMay
12.00PM-12.30PM18OceaniaCrescent431AuctionCoastalNoosa0411737767
Saturday23rdMay
1.00PM-1.30PM3/1FerrisStreet321AuctionTomOffermannRealEstate0447915953
Saturday13thJune
11.00AM-11.30AM6/21ParkCrescent321AuctionCentury21ConollyHayGroup0438259956
12.00PM-12.30PM2/25ParkCrescent322AuctionCentury21ConollyHayGroup0438259956
Tewantin
Saturday16thMay
12.00PM-12.30PM61StAndrewsDrive322AuctionOn SiteSat16May12pm LagunaRealEstate0438026300
Sunday7thJune
11.00AM-11.30AM2/11HiltonEsplanade322Auction7June@11amWattsPropertyGroup0418758465















CENTRALLY positioned in Outlook Drive, walking distance to the local shops including an IGA, pharmacy, popular bakery, coffee shop, bottle shop and pizza and other fast food options, this home offers everyday convenience at your doorstep.
Designed for family living, the wellconsidered layout includes two separate living areas, a dedicated dining room and a spacious kitchen flowing seamlessly to an established
garden and covered alfresco—ideal for entertaining or relaxed outdoor living.
Private and solidly constructed, the home enjoys a leafy green outlook from every room. Features include split system airconditioning in the lounge room, ceiling fans throughout, a master bedroom with walk-in robe and ensuite, and three generously sized bedrooms with excellent separation for family comfort. There’s also the bonus of a separate laundry.
Well maintained and move-in ready, there’s ample space to add a pool on the large 762m2 allotment and further enhance the property. It’s a short drive to Tewantin village shops, cafes, Woolworths and medical services, plus the Noosa Marina for dining, bars and live music and the newly renovated Royal Mail Hotel - all the amenities and enjoyment you could want for an easy lifestyle for you and the family.
Caddy up your golf clubs for a few swings
at the Noosa Golf Course only 2kms away, or in the other direction for glorious sunset “happy hours” at the Noosa Yacht Club or take a leisurely walk along the Noosa River, 5kms from home. For a change of pace, another 10 minutes to cosmopolitan Hastings Street, Main Beach and Noosa National Park.
This lovely home is a real find in a “locals’ secret” area - and an opportunity not to be missed. Visit Anita at the Open Home or contact for your private inspection.
Address: 26 Outlook Drive, TEWANTIN Description: 3 bedrooms, 2 bathrooms, 1 garage Price: By Negotiation Inspect: Saturday 12.00-12.30pm; Wednesday 11.00-11.30am
Contact: Anita Nichols 0434 236 110, LAGUNA REAL ESTATE
POSITIONED in St Andrews Drive, you’re a short stroll next door to local shops and cafes, with easy access to Tewantin, Noosaville and the Noosa Hinterland.
This beautifully presented Tewantin home delivers relaxed family living with a beautifully modern renovated spaces, light filled interiors and great flexibility for modern lifestyles.
Inside, open plan living and dining zones
connect seamlessly to a large covered outdoor entertaining area, perfect for alfresco meals and weekend gatherings. With three bedrooms, a dedicated study, two bathrooms (main with bath), air conditioning, ceiling fans and a fully fenced yard for privacy, this is a home designed for comfort, space and everyday ease.
A standout feature is the separate bonus space with its own entry, ideal as a home office, studio, consultation rooms, or a teen retreat.
Property Features
Home
• 3 bedrooms plus dedicated study
• 2 bathrooms (main with bath)
• Central open-plan kitchen
• Separate living and dining zones

• Air-conditioning and ceiling fans
• Large covered outdoor entertaining area
• Fully fenced yard with high fencing for privacy
• Double carport plus additional off-street parking
• Two garden sheds
• Separate Bonus Space (Own Entry)
• Reception/waiting area with separate entry
• Two additional rooms suited to offices, studio or treatment rooms
• Off-street parking available
This property is currently tenanted until December 2026 at $950.00p/w.

Address: 61 St Andrews Drive, TEWANTIN Description: 3 bedrooms, 2 bathrooms, 2 garage Inspect: Saturday 11.30am – 12.00pm Auction: On Site Saturday 16th May at 12pm
Contact: Glenda McKenzie 0438 026 300, LAGUNA REAL ESTATE

