PROPERTY
A TREASURE SURROUNDED BY NATURE
PROPERTY MATTERS
IT’S like experiencing an episode of Grand Designs, in which Kevin McCloud speaks about the creation of some extraordinary houses.
A four-bedroom, four-bathroom, two-car house, pool, on 2.01ha, shed, at 24 Amaroo Place, Cooroibah, is one of the better singlelevel homes on the market, according to Tom Offermann agent Peter TeWhata.
The house, designed to a very high standard and specification level to define quality requirements, goes to auction Saturday 18 April, at 2pm.
“From the moment you walk in it has that ‘wow’ effect,’’ Peter said. “You look straight to the pool area - that is an experience in itself.
“It is one of the best contemporary homes on the market at the moment.’’
Enclosed with the slide-away, UV-rated Florida insect screening, is the expansive outdoor room, kitchen with stone-topped cabinetry and overhead heating.
Beside it is a pool pavilion with sun terrace and 10m heated pool with screened ceiling, suggesting swimming in the rain.
Aptly named Amaroo, meaning beautiful place, the property is exclusively gated and with pristine surrounds north-facing to a nature reserve and walking trails around Lake Cooroibah.
Statement double timber-framed lami-glass doors open to the foyer of the home, then to the tall doors and walls of glass, high ceilings and skylights that allow sunlight to splash over the Italian pastel grey stone flooring.
Sprawling living areas connect to outdoors, including a dedicated lounge room with feature lighting and surround sound.
The open plan dining space includes the massive kitchen with two parallel island breakfast bars, black and white-streaked stonetopped cabinetry, soft-close deep drawers, sizeable butler’s pantry with three-dimensional
lustre wave tiles and the latest appliances from Miele induction cooktop and oven, to integrated AEG dishwasher and a Samsung four-door fridge with television.
There are four equally stunning bedrooms with walk-in robes and ensuites with Italian wall and floor tiles, and custom stone-topped cabinetry.
The premier suite in the east wing has a walk-in robe, ensuite with double shower heads and a deep, free-standing, stone bath.
The laundry has lustre wave tiles, a stonetopped bench, a wall of black glass sliding doors plus access to the drying area. Stonetopped cabinetry and latest tech is in the office
The two-car garage also has a studio/gym; a sound proofed storeroom on the north side houses various equipment such as the Bionizer water treatment system; and security systems include perimeter CCTV recording cameras also a zoned alarm system.
Other features include ducted 6kW airconditioning; a 14.6Kw Solar inverter system and Elgas 90Kg Downunder underground gas supply inside the gate.
Outbuildings include a fully-insulated and powered 18m by 9m barn on the west side, and there’s a water lily-covered deep dam with fish.
SET UP FOR HORSES
Just listed with Peter TeWhata is a 2.09ha horse property at Cooroibah with eventing arena and shed.
The property at 346 Lake Cooroibah Rd features a contemporary-design 600sq m house with pool.
Backing on to Lake Cooroibah, the property is set for auction on Friday, 1 May.
CLASSIC BEACH COTTAGE
It’s a property that captures the heart as much as it commands attention.
An original Sunshine Beach cottage set on a leafy medium-density block has been attracting attention right from being listed.
Caitlyn McConnell at Sunshine Beach Real Estate said the two-bedroom, one-bathroom, one-car cottage on 611sq m at 17 Duke St was of solid block construction, and tightly held by same owner for 35 years.
Set for auction on Saturday 11 April, at 2pm, interest has been mostly from local buyers, looking for a family home, and Brisbane-based buyers searching for a beach house.
“People love the privacy, beautiful established gardens and the proximity to everything,’’ Caitlyn said. “It has a really warm relaxed feel.
“We’ve also had interest from buyers looking for projects.’’
Framed by a magnificent old mango tree at the entry, there’s an immediate sense of charm and nostalgia. With a lush, elevated outlook, it is a flat 550m walk to the patrolled beach, surf club and village cafes.
One of the earliest solid block homes in Sunshine Beach, this cottage is privately positioned and fully fenced.
A deck stretches the full width of the home, capturing a north-easterly outlook.
Inside, there is a timber kitchen featuring original bamboo benchtops that complement
the relaxed coastal aesthetic. Soaring raked ceilings create an impressive sense of volume and light, while the loft-style bedrooms upstairs offer a peaceful, retreat-like feel.
The bedrooms open onto a private rear deck nestled in the tree canopy.
RIVERFRONT BLISS
With uninterrupted north-facing water views from every room, a two-bedroom, two-bathroom, one-car riverfront apartment 36/5 Quamby Pl, Noosa Heads, is turning heads.
Anita Nichols and Craig Taylor of Laguna Real Estate are taking the apartment to auction Saturday 18 April, at 10am.
Set within the sought-after Culgoa Beach Resort, the property is an end unit on the first level and has lift access.
It has had the same owner for almost 30 years in this tightly-held holiday location.
With excellent on-site management, the apartment offers an exceptional blend of coastal lifestyle and investment appeal, the agents said.
Residents and guests enjoy a recently upgraded pool precinct featuring a 20m heated lap pool, children’s pool and spa, along with a full suite of resort facilities including a gym, sauna, tennis court and guest lounge.
The barbecue facilities are on the podium level with beach front views amongst three acres of tropical landscape gardens.
Adding to its unique appeal, the resort includes a private jetty with direct access to the Noosa River—ideal for boating, kayaking or simply enjoying the waterfront setting.
ERLE LEVEY
A two-bedroom, one-bathroom, one-car house at 17 Duke St, Sunshine Beach, goes to auction Saturday 11 April, at 2pm. (544258)
A two-bedroom, one-bathroom, one-car house at 17 Duke St, Sunshine Beach, goes to auction Saturday 11 April, at 2pm. (544258)
A two-bedroom, one-bathroom, one-car house at 17 Duke St, Sunshine Beach, goes to auction Saturday 11 April, at 2pm. (544258)
A two-bedroom, one-bathroom, one-car house at 17 Duke St, Sunshine Beach, goes to auction Saturday 11 April, at 2pm. (544258)
A four-bedroom, four-bathroom, two-car house, pool, on 2.01ha, shed, at 24 Amaroo Place, Cooroibah, goes to auction Saturday 18 April, at 2pm. (542693)
A four-bedroom, four-bathroom, two-car house, pool, on 2.01ha, shed, at 24 Amaroo Place, Cooroibah, goes to auction Saturday 18 April, at 2pm. (542693)
FORTHCOMING AUCTIONS
SATURDAY 11 April
Noosa Heads
• 33/5 Quamby Pl: 2bed, 2bath, 1car waterfront apartment, 1pm, Luke Chen 0417 600 840 Tom Offermann Real Estate
Sunrise Beach
• 50 Tingira Cres: 4bed, 4bath, 2car beachfront house, pool, 12pm, Rebekah Offermann 0413 044 241 Tom Offermann Real Estate
Sunshine Beach
• 17 Duke St: 2bed, 1bath, 1car house on 611sq m medium-density block, 2pm, Caitlyn McConnell 0417 637 697 Sunshine Beach
Real Estate
FRIDAY, 17 April
Black Mountain
• 235 Black Mountain Range Rd: 3bed, 2bath, 2car house and cabin on 7.25ha, dam, 11am, Jeanette Catalano 0422 923 851 Mario Catalano 0400 613 879 Hinternoosa
Noosa Heads
• 3/31 Katharina St: 2bed, 1bath, 1car apartment, 1pm, Sharon McLure 0400 084 975 Alexandra McLure 0484 356 225 McLure Real Estate.
A four-bedroom, four-bathroom, two-car house, pool, on 2.01ha, shed, at 24 Amaroo Place, Cooroibah, goes to auction Saturday 18 April, at 2pm. (542693)
A four-bedroom, four-bathroom, two-car house, pool, on 2.01ha, shed, at 24 Amaroo Place, Cooroibah, goes to auction Saturday 18 April, at 2pm. (542693)
A two-bedroom, two-bathroom, one-car riverfront apartment 36/5 Quamby Pl, Noosa Heads, goes to auction Saturday 18 April, at 10am. (542744)
A two-bedroom, two-bathroom, one-car riverfront apartment 36/5 Quamby Pl, Noosa Heads, goes to auction Saturday 18 April, at 10am. (542744)
A four-bedroom, four-bathroom, two-car house, pool, on 2.01ha, shed, at 24 Amaroo Place, Cooroibah, goes to auction Saturday,18 April, at 2pm. (542693)
A four-bedroom, four-bathroom, two-car house, pool, on 2.01ha, shed, at 24 Amaroo Place, Cooroibah, goes to auction Saturday 18 April, at 2pm. (542693)
A two-bedroom, two-bathroom, one-car riverfront apartment 36/5 Quamby Pl, Noosa Heads, goes to auction Saturday 18 April, at 10am. (542744)
A two-bedroom, two-bathroom, one-car riverfront apartment 36/5 Quamby Pl, Noosa Heads, goes to auction Saturday, 18 April, at 10am. (542744)
A two-bedroom, two-bathroom, one-car riverfront apartment 36/5 Quamby Pl, Noosa Heads, goes to auction Saturday 18 April, at 10am. (542744)
3/235GYMPIETERRACE, NOOSAVILLE
Ovationsforlivingandlovingthehighlifeneverlookedbetterwithaprivilegedsunsplashedfrontrowaddressboastinga180-degreepelican-eyeview.Justlooknorth fromtherivermouthandalongtheNoosaRiverfromthetop oorapartmentof aptlynamedRiversidecomplex.Easytoappreciatewhythisisawinner.
Admirethewhite-brightcontemporaryaesthetic,highrakedceiling,sophisticated designtendingtowardsbeachysimplicitywithimportanceplacedonimmaculate furnitureandaccessoriesinnaturalhuesandpopsofblue. Naturallightinvitesitselfindoorsthankstobanksofdisappearingdoorswhichopen fromthesizeablelivingspacetoaterraceforentertainingoptionswhateverthe reasonorseason.Notforgettingsunsetsanddrinkinginthosesensationalviews.
A 3 B 2 C 1 D
Price $2.425M
View Saturday 10.00am-10.30am
Agent ChrisMiller 0412894542 chris@offermann.com.au
5/42HASTINGSSTREET, NOOSAHEADS
IntheglamorousheartofHastingsStreet,Apartment5TheEmeralddelivers thequintessentialNoosalifestylejuststepstocafés,restaurants,boutiquesand thegoldensandsofNoosaMainBeach.Light-filledinteriorsspillseamlesslytoa generousundercoverterrace,whereleafygreeneryframesglimpsesofHastings Street’svibrantenergy.Theoversizedmastersuitewithsleekensuiteaddsrare apartment-styleluxury,whileresortfacilitiesincludingaheatedlagoonpool,spa, sauna,liftaccessandsecureparkingcompletethepicture.Withstrongyear-round holidaybookingsandprofessionalon-sitemanagement,thisbeachy-chichavenisa superblifestyleandinvestmentopportunity.
A 3 B 2 C 1 D
Price $3.65M View
Wednesday 11.00am-11.30am
Agent JesseStowers 0414367282 jesse@offermann.com.au
63GOLFCOURSEDRIVE, TEWANTIN
Framedbybushland,thisQueenslander-inspiredresidencedeliversalifestyle ofprivacy,charmandeffortlessindoor-outdoorliving.Wraparoundverandahs extendfromthefronttothesideandrear,offeringaselectionofsunlitandshaded spacestoenjoymorningcoffeeoreveningdrinksamidstalush,leafybackdrop.
Inside,alight-filledopenplanliving,diningandkitchenareaformstheheartofthe home,enhancedbywarmtimberfloorsthataddcharacterandappeal.Thekitchen capturestranquilgreenoutlooksandfeaturesexcellentstorage.Withsideaccess, multiplecarports,ashedandnoneighbourtooneside,thisinvitingproperty presentsarareopportunitytoenjoypeacefullivingimmersedinnature.
A 3 B 2 C 2
Auction Friday24April11.00am
View Sat10.00am-10.30am Wed10.30am-11.00am
Agent EricaNewton 0410603519
erica@offermann.com.au
37COOROIBAHCRESCENT, TEWANTIN
MovethefamilytothecovetedNoosaBanksenclavewiththepurchaseofthis expansivesinglelevelresidenceon2814m2parklikegroundsbackingdirectlyonto leafyreserveenhancingprivacyandoutlook,andofferingadesirablecoastal lifestylewherethelivingiseasy…
SpendyourweekendsboatingandfishingontheNoosaRiver,swimminginthe oceanatLagunaBay,orhikingthroughNoosaNationalParkandthenreturnhome forana ernoonBBQpoolsidefollowedbyagameofbackyardcricketorfootyand letthegoodtimesroll.
Withawell-designedfloorplanfacilitatingexcellentseparationandfunctionality, alongwithallthemoderncomfortsandextrasthataddvalueandappeal;thistruly istheperfectfamilyhomeineverysense.
A 5 B 3 C 2 D
Auction
Friday24April1.00pm
View Sat11.15am-11.45am Wed11.30am-12.00pm
Agent EricaNewton 0410603519
erica@offermann.com.au
‘TALLOW’4/16 SERENITYPLACE, NOOSAHEADS
Stepintoaworldbeyondtheordinary,theheightof eleganceandtheserenityoflivinginasliceofparadise -ahouse-sizedapartmentinaprizedlocation. Expectunmissablegoodtimes,somewhatcossetedby Nature,albeitthescintillatingnaturereservespilling outbeforeyoureyesandlookingoverthepool.Also rememberitisonlya4-minutestrolltoajettyonNoosa Sound,andwithinwalkingdistancetoNoosaMain
Beach.Admirethecurvaceousflutedwallsofthefoyer andhallway,theemphasisoncapaciousness,relentless commitmenttodesignsupremacy,howsunshine shadowdancesovertheItalianporcelaintiles,andlots ofentertainingoptionstoenjoywhateverthereasonor season-indoorsoroutwherenaturerulesasthelocal birdlifetrillchorusesofdelight.
Price $4.15M
View
Saturday9.00am-9.30am
Agent RebekahO ermann 0413044241 rebekah@o ermann.com.au
15NATURALISTPLACE, DOONAN
Immerseyourselfinnature,awakentobirdsong, savourthearomaticscentsofnativefloweringshrubs, andembraceladolcevitaeverysingledaywiththe purchaseofthisultra-elegantQueenslandertucked awayinawhisper-quietcul-de-sacinDoonan,arguably theNoosaHinterland’smostdesirablesuburb. ArecentYourtownprizehometheresidenceisbeing soldfullyfurnished;turnkeyreadytomovestraight
intoandliveyourverybestlife,whetherlazingbythe heatedsaltwaterpool,hostingmorningteainthe sunroom,keepingcosyandwarminwinterbythe fireplace,orpicnickingbythedam,thereissomuch tosavour.Yourpeaceful,private,NoosaHinterland lifestylesanctuaryawaits,anditistrulymagnificent!
Price ContactAgent View Saturday1.00pm-1.30pm Agent EricaNewton 0410603519 erica@o ermann.com.au
346LAKECOOROIBAHROAD, COOROIBAH
Ifyou’veeverhadthedesireforanescapetothe countryandembracegentlesmallacreageliving withoutisolation,theLakehouseis100%privatewith fullyusablelandyetameretenminutesfromcafé centralonNoosaRiver’sGympieTerrace.Melding infusionsofrusticcharmwithcontemporarydesign andcomforts,itistrulygoingtomakeyourheartsing! Comeinside.Notethecustomisedfixturesandfittings
thatenhanceitswarmthandcharacter,suchaswhitebrightseriouslyhighrakedceilingsandbeams,VJ panelledwalls,woodburningfireplaceinthelounge, expansivedining,andlivingspacewhichflowstoa terracewiththefeelsofanoutdoorroom.Additional terracesabuttheglisteningpoolandspa,connectingto andenhancingthespectacularlocation.
Auction Saturday8May11.00am
View Saturday&Tuesday 12.00pm-12.30pm
Agent
PeterTeWhata 0423972034 peter@o ermann.com.au
6106/5MORWONG DRIVE, NOOSAHEADS
Taketheplungewithlavidalocaandthelightand languidechoesofanendlesssummermereminutesto NoosaMainBeach,andworld-famousNoosaNational Park.Pictureasparklingprivateandvirtuallynew 2-leveloasiswithfrontrowseats,seeminglyperched atopthesub-tropicalrainforestcanopywherekoalas callhomeandthechorusofnativebirdlifeisasheer delight.Araregemlikenootherintheacclaimed
PeppersNoosaResort,itboastsaromanticpaletteof colour,naturaltimberandstone,customfurnishings throughout,lavishbathroomsandthekitchen,which putsentertainingfrontandcentreintheexpansive livingareas.Notethealmostinvisiblelinebetween indoorsandouttotheroomyterracewithwide overhangsandawningso eringshade,andalfresco entertainingisatitsbest.
Auction Saturday2May11.00am
View Friday1.00pm-1.30pm
Agent ChrisMiller 0412894542 chris@o ermann.com.au
24AMAROOPLACE, COOROIBAH
ImaginesomewherebetweentheseasprayofNoosa MainBeach15-minutesaway,andthealmostlost-world traditionofasafe,secureunrivalledlifestyle,whereit’s possibletoloseyourselfcompletely.
Experiencetheexhilarationofravishingaptlynamed Amaroo,exclusivelygatedwithabsolutepristine surroundsmorphingacrosstwoeasyhectaresand north-facingtoanaturereserveconnectedtoLake
Cooroibah.
Stretchingalmostthewidthonthenorthsideismore thanjustanundercoverterrace.Totallyenclosedwith theultimateslide-awayinsectscreenistheexpansive outdoorroom,foralfrescolounginganddining. Besideit,thepiecederesistanceisthepavilionwith 10mheatedpool,theceilingaboveopen-to-theelements,albeitscreened,suggestingsingingintherain!
Auction Saturday18April2.00pm View Saturday&Wednesday 11.00am-11.30am
Agent
PeterTeWhata 0423972034 peter@o ermann.com.au
AUCTIONSATURDAY 1.00PM
33/5QUAMBYPLACE, NOOSAHEADS
Lookingforloveatfirstsightandholidaysbeyondjoy? It’sallhere!
Marvelattheawe-inspiringviewofbobbingboats attheexclusiveeight-berthmarinaoranchoredin theluminousturquoiseestuarywhichextends,then sweepsnorth-easterlyalongthePalmfringedNoosa River.
Ine ectitisafewfishingrodsawayacrossan expansivepalmfringedlawnareatothewater’s edge.Easytobesmittentoobytheresort’s305mof iridescentwhitesand.
Auction Saturday11April1.00pm View Friday4.00pm-4.30pm& Saturday12.30pm Agent LukeChen 0417600840 luke@o ermann.com.au
AUCTIONSATURDAY 12.00PM
50TINGIRACRESCENT, SUNRISEBEACH
Isthisdazzlingdiamond,perfectlypoisedononeofthe widestsitesintheabsolutefrontrowofSunriseBeach, with180°viewswhicharenevercompromised,from LionsHeadintheNoosaNationalParktothenorth, southtoPointCartwright,andamere1-minutetotoesin-the-squeakywhitesand,theultimateprize?Insidebe overwhelmedhowtheluminousqualityoftheocean ismatchedbytheinteriorasfreshandexhilaratingas
anearlymorningswim.It’svivacious,e ortlesslycool yetquintessentiallymid-centurymodernastomorrow. Voluminousdoubleheightspaces,wallsofmassive panesanddisappearingdoors,endlesstravertine, allformingtheheartoftheresidenceandmimicked alfresco.Enoughtomakeyousigh!
Auction Saturday11April12.00pm
View Saturday11.30am
Agent RebekahO ermann 0413044241 rebekah@o ermann.com.au
HOME FOCUS
ENVIABLE LIFESTYLE & CONTEMPORARY DESIGN
THERE is much to love about a residence that captures and combines the spirit and green surrounds of the exclusive estate with a prestigious avenue-style address, complemented by an ingenious statement of design.
The striking façade uses a raw palette of materials, and an imposing statement door opens to a raked foyer and expansive hallway revealing lofty ceilings, with clerestory windows allowing sunlight to drench the neutral tones throughout.
Look ahead and note the sense of space. On the right is a media, fourth bedroom or lounge if you prefer, while further along light-filled over-sized living and dining spaces, thanks to a northerly aspect, also louvres and banks of sliding glass doors, provide a seamless indoor/ outdoor connectivity to the undercover alfresco terrace. Surrounded by sub-tropical gardens, it is a wonderful area for year-round entertaining big families and many friends.
Needless to say, the long galley-style kitchen with stone waterfall benchtop, walk-in storageaplenty pantry & also Bosch appliances, is commensurate to the needs of any culinary whizz.
The carpeted master bedroom suite has a garden outlook, is conveniently located at the back of the residence, has a massive walk-in robe to suit any fashionista, plus walk-in shower and double vanity basins, in the capacious ensuite.
In the west wing, two bedrooms with built-in robes and a share family-size bathroom, could be the domain of teenagers.
Additional spaces include a laundry and powder room.
“The stand-out yet serene Estate has a strong connection to nature,” comments Tom Offermann Real Estate agent Peter Te Whata “There are walking trails and bike tracks along Lake Weyba, also through the Noosa National Park with its plethora of flora and fauna. More inclined to serious workouts? A resident’s only private recreational facility has two tennis courts, two solar-heated swimming pools, gym and changing rooms.
“This residence is perfect for tree-changers as a championship golf course is in the ‘hood’, sea-changers as Noosa Main Beach and Sunshine Beach are close, also those who travel frequently and want to lock-up-and-leave without worrying.
“This residence designed for a family to nurture and relish is in a highly desirable neighbourhood with a Noosa Heads’ postcode.” Facts & Features:
• Land Area: 569m2
• House Area: 234m2
• External Area: 36m2
• About: high light filled raked entry foyer 4.1m - 3.8m in height with clerestory windows; remaining ceilings 2.7m; floor tiles; aircon/ fans; extra-large garage & garden shed
• Kitchen: galley-style; stone benchtops, cabinetry doors wood look laminate/ 2pac; walk-in
HOME ESSENTIALS
pantry ; dishwasher; Bosch Appliances
• Exterior: north-facing alfresco area 3.5m x 9.2m – length of living/dining space; established easy care gardens incl front yard.
• About Elysium Noosa: walk & bike tracks along Lake Weyba, through part of Noosa
National Park; close to Noosa Springs’ championship golf course & clubhouse; resident’s only private recreational facility with 2 tennis courts, 2 solar-heated swimming pools, gym & changing rooms
• Location: short drive to numerous public &
private schools, shopping centres, essential services, restaurants/cafes/bars, Aquatic Centre & sporting fields, Hastings Street, Noosa National Park main entrance + Noosa Main Beach; close to transport links & doggy park
Address: 21 Smoke Bush Drive, NOOSA HEADS Description: 3 bedrooms, 2 bathrooms, 2 garage Price: $1.795M Inspect: Saturday 11 April, 10:00 AM - 10:30 AM
Contact: Peter Tewhata, 0423 972 034, TOM OFFERMANN REAL ESTATE
ULTIMATE STANDARD IN BEACHSIDE LIVING
SETTING a new standard in beachside sophistication, Amara is a boutique collection of light-filled, single-level apartments with elevators, perfectly positioned on a premium 2606 m² north-east facing corner parcel. Just 350 metres from patrolled swimming, each residence combines effortless coastal living with refined design, capturing the essence of sun-drenched elegance and serene beachfront lifestyle.
A collaboration between nationally acclaimed building designer Chris Clout and award-winning Damien Davidson Builders; Amara is an aesthetically striking masterpiece combining flowing forms, gentle curves, natural materials, height and light. Offering an aspirational lifestyle with a level walk to the beach, Amara will firmly establish itself as a stunning landmark development in this bluechip pocket of Peregian Beach.
With only eight individual residences across four buildings each benefiting from seamless integration of interior and alfresco space, lift access, cooling sea breezes, coastal views, an atrium-style internal garden, expansive terraces with built-in outdoor kitchens; the design is flawless, the interiors are elegant, and each residence makes its own statement.
This development also offers secure subterranean dual car parking with lift access to each level and apartment, as well as huge designated storage room each. It has been carefully curated to provide everything you need for an ideal downsizing opportunity or the ultimate, sublime weekend escape.
The ground floor apartments each boast an exclusive sun-drenched inground pool and garden; and the first-floor apartments each have two separate terraces, with the premier suite flowing out to its own private terrace. The floor plans have been exquisitely crafted to complement the Queensland lifestyle and climate, with inside/outside flow so integrated there is a calming, palpable sense of floating from one zone to the other.
Exquisite fixtures and bespoke finishes define this residence, where Miele appliances and an integrated fridge/freezer meet blonde oak timber doors, honed marble benches and splashbacks, and brushed nickel tapware. A commanding fireplace framed by a stone feature wall, thoughtfully designed custom lighting, and fully integrated home automationincluding sound and security-create an environment of effortless sophistication. A soft, refined colour palette imbues timeless elegance, harmoniously reflecting the natural surrounds and enhancing the home’s serene, elevated ambience.
HOME ESSENTIALS
Lounge around by the pool soaking up the fresh salty sea-air in the warmer months, toast the good life by the fire in the cooler months, host a barbecue with your loved ones after a morning at the beach; and indulge in a coveted beachside lifestyle all year around across all seasons and all-weather conditions.
“This is Peregian Beach’s most exciting opportunity for 2026, and with only eight in the complex, in such a coveted beachside location just footsteps to the sand and a pleasant walk to the vibrant village square so close to home, the location could not be more convenient or sought-after,” said Tom Offermann Real Estate agent Tracy Russell, proudly marketing Amara to prestige beachside buyers.
“This is a development that combines effortless easy-care lock-and-leave living with world-class sophistication and panache, that truly more than holds its own in the ultradesirable Noosa beachside market.”
With these apartments coming out of the ground quickly, you’re invited to inspect the finishes firsthand and feel the difference.
Address: 66 Peregian Esplanade, PEREGIAN BEACH
Description: 3 bedrooms, 2 bathrooms, 2 garage Inspection: By appointment
Price: From $4.85M Contact: Tracy Russell 0413 319 879, TOM OFFERMANN REAL ESTATE
HOME FOCUS
DESIGNER COASTAL LIVING WITH SPACE
COMMANDING a substantial 738m² corner parcel in a peaceful, family-friendly pocket of Peregian Springs, this impeccably renovated and extended dual-level residence delivers a sophisticated lifestyle of scale, privacy and contemporary luxury.
Beautifully transformed throughout, the fivebedroom, four-bathroom home is defined by warm timber finishes, clean architectural lines and a refined contemporary palette. Beyond the grand double-door entry, soaring ceilings, abundant natural light and a beautifully layered selection of textures and tones create an immediate sense of quality and space. At the heart of the home, an expansive open-plan living and dining domain is anchored by a statement kitchen featuring a stone island with breakfast seating, pendant lighting, sleek downlights and a well-appointed butler’s pantry, allowing the main kitchen to remain effortlessly streamlined and beautifully minimal.
Full-height sliding glass doors, complemented by remote blinds, create a seamless connection to the outdoors, where a covered alfresco terrace, manicured lawns and a sparkling in-ground pool combine to deliver an exceptional setting for entertaining, relaxed family living and year-round enjoyment.
HOME ESSENTIALS
A striking staircase with glass balustrade leads to the upper level, where the master suite is designed as a true parents’ retreat. Generous in scale, the bedroom opens to a large private balcony capturing tranquil leafy vistas and elevated views across the pool. A spacious walk-in robe and a luxurious ensuite featuring a double vanity, backlit arched mirrors, frameless glass shower and freestanding bath complete the suite with a distinct resort-inspired feel. This level also includes two oversized bedrooms, family bathroom and a separate retreat-style living area, a great zone for children or teenagers.
On the lower level, a bedroom suite with walk-in robe and private ensuite opens to the outdoor area,
Address: 1 Crestview Drive, PEREGIAN SPRINGS Description: 5 bedrooms, 4 bathrooms, 2 garage
Contact: Brad Schultz 0493 063 023, RICHARDSON AND WRENCH NOOSA
making it an excellent space for guests or extended family. An additional bedroom on this level offers flexibility as a home office or study.
Additional appointments include zoned ducted air-conditioning with separate upstairs and downstairs systems, app-controlled room zoning, a separate laundry and a double lock-up garage with internal access. Facing a leafy nature reserve, the home enjoys a wonderful sense of privacy and a serene green outlook. The fully fenced grounds provide a secure environment for children and pets to enjoy both the front and rear yards, while the prized corner position further enhances the feeling of space and separation. A 5-minute drive away is Peregian Springs Shopping Centre with Coles, a pharmacy, gym and cafes. An 8-minute drive
connects you to the patrolled swimming beaches of Peregian Beach and vibrant Peregian Village, home to IGA, boutique shopping, cafes and restaurants. Noosa, Eumundi Markets, and the Sunshine Coast Airport are 20 minutes away, making it easy to embrace the very best this region has to offer.
Celebrated for its relaxed ambience and strong sense of community, Peregian Springs continues to attract those seeking an easy coastal lifestyle. With every detail already completed to an exceptional standard, this is a turn-key residence of elegance, comfort and enduring family appeal.
Property Features
• Renovated designer home on a 738m² corner block
• Five bedrooms, four bathrooms, multiple living zones
• Large kitchen with butler’s pantry
• Luxurious master retreat with balcony and ensuite
• Seamless alfresco entertaining and in-ground pool
• Zoned ducted air-conditioning, electric blinds and fans
• Peaceful reserve backdrop with fully fenced grounds
• Close to shops, schools, beaches and Noosa
HOME FOCUS
UNBEATABLE BEACHSIDE VALUE
PEREGIAN Beach is one of the most desirable seaside suburbs in the Noosa Shire with picture perfect sandy beaches, turquois waters and a strong sense of community.
Homes here can be held for a lifetime and with less homes coming to market each year, this is your chance to own a slice of paradise.
The original beach house has been redesigned and reimagined with quality construction and workmanship from well renowned builder Jaicon Constructions.
Positioned high on the dune on a private slip road, the ocean and hinterland views from this home are absolutely spectacular, with views to be enjoyed from each room on the upper level. From magnificent sunrises over the ocean, dreamy hinterland sunsets from the expansive upper deck and taking in views of the National Park and capturing the layers of hinterland mountain ranges from Mount Ninderry to Mount Tinbeerwah. These stunning natural backdrops will play a part in everyday life, whether you are lounging in your living area or enjoying long lunches with friends and family on the deck.
The proximity and convenience of this location is hard to beat with the Peregian Beach Village, the foreshore park and the patrolled beach all within a few minutes walk from your doorstep. You will now be able to have a morning swim or surf, get your favourite takeaway coffee or pop into IGA for groceries, without picking up the car keys. Peregian Beach Village is extremely popular with its boutique shops, great choice of cafes and constantly evolving restaurant selection. Like the surrounding residential landscape, the Village is modernising with significant investment and an enriched community feel, which so many people find attractive and want to be a part of.
The convenience of this location also makes the home incredibly attractive for holiday guests, so if you are looking to generate a passive income, then the rare dual key layout of this home will allow you to enjoy your own home, whilst offering a separate self-contained apartment for guests. This layout will also be popular for those with extended family living under one roof, which is a growing trend in today’s market.
This home ticks a lot of boxes for those looking for the ultimate beachside lifestyle, so
HOME ESSENTIALS
be quick to book in a private inspection and be one step closer to owning a slice of Peregian Beach.
Address: 202 David Low Way, PEREGIAN BEACH Description: 4 bedrooms, 3 bathrooms, 3 garage Price: By Negotiation Inspect: Contact Agent
Contact: Jonathan Tomasini 0401 807 697, CENTURY21 CONOLLY HAY GROUP
Additional Information: Home extension plans available designed by ABODA Designs (if needed).
Proof of prior AirBNB income available for those looking to use the home for STA purposes (Short Term Accommodation).
A north-facing white sandy beach, with a clean riversystem, a connection to everything Hastings St has to offer and surrounded by national parks; property in Little Cove is naturally finite.With fewer than 200 residences and only a handful of stand-alone homes,finished products here are hard to find. From either entrance at 11 Little Cove Road,you can walk to the surf,explore the national park trails, or stroll along the boardwalk to Hastings Street's restaurants and boutiques.All within a few hundred metres ofyourown private oasis.
Number 11 Little Cove Road has been masterfully designed by Chris Clout and proudly built byDamian Davidson Builders. The home combines strong, market-led design with a relaxed coastal feel; the finished product has a similar level of privacy, position and peace as a high-end boutique hotel.
The main living area faces north and east, capturing sea breezes,filtered light andyear-round sunshine. A sculptural stone fireplace anchors the space, while native timber and natural stone add warmth and connection to the environment. Outside, a covered alfresco terrace with an outdoor kitchen is an extension of the interiors, seamlesslyconnecting the space with stacker doors and retractable screens.The kitchen is designed for entertaining, with natural stone benchtops, integrated appliances, dual dishwashers,pyrolytic and combi ovens, Pitt gas burners, and a Zip Hydrotap, with a butler's pantryto continue the clean design and practical layout.
Oliver O'Reilly 0429 827 224
0422 719 041
15MalleeClose
Doonan
Bed 3 Bath 3 Car 2
Auction24Aprat10amOnsite
Land 1.51acre
View Sat9am,Weds4:30pm
HenryReynolds 0431001083
henry@hinternoosa.com.au
0754477000,30MapleStreet,Cooroy 0754491186,777EumundiNoosaRd,Doonan POBox244CooroyQLD4563 hinternoosa.com.au
CreeksideCharacterAcreage
•1.5acreusableacreage
•Charactertimberhome,builtearly1990s
•ScenicWrap-aroundverandah
•Rarenaturalcreekalongrearboundary
•Threebeds,masterwithensuite,WIR
•Largeunder-housegarage,workshop
•Renovationpotential,roomforpool
•MinutestoNoosa,Eumundi
MORE THAN 10 ACRES
OFFERED to the market for the first time in over 30 years, “Moorooka” is a rare and tightly held offering on Dath Henderson Road, Tinbeerwah. Widely regarded as one of the most significant landholdings to come to market in the area in years, this is an opportunity that speaks to those who understand just how seldom properties like this become available.
Set across more than 10 acres of level, highly usable land with established organic areas, there is an immediate sense of space, calm, and quiet here. It is the kind of setting that feels removed from the pace of everyday life, where the land opens up around you and the surroundings feel settled, established, and enduring, yet Noosa remains just minutes away.
The home is generous in scale and practical in design, offering five bedrooms, three bathrooms, a dedicated office, and multiple living areas. Well maintained and comfortable, it provides a welcoming base for family living, with a layout that has clearly supported many years of use and enjoyment.
Outdoors, the property unfolds into wide, open
HOME ESSENTIALS
acreage that invites a simpler way of living. Whether it is horses, hobby farming, or simply having the space to move and breathe, the land offers a freedom that is becoming increasingly rare. An inground resort style pool with cabana creates an easy outdoor entertaining area to gather, while established trees frame the property and add to its sense of privacy and permanence. Infrastructure is well established, with multiple sheds providing practical storage and workspace, along with a creek, and bore water supporting the land. Positioned in one of Noosa’s most sought-after hinterland locations, this is a property defined by its landholding, its setting, and the lifestyle it offers.
Address: 239 Dath Henderson Road, TINBEERWAH Inspect: Contact agent
Auction: 18 April at 12:00pm On site Description: 5 bedrooms, 3 bathrooms, 10 garage
Contact: Caroline Johnston 0409 953 311 and Sian Preston 0422 675 057, HINTERNOOSA
0754477000,30MapleStreet,CooroyQLD
Address 235BlackMountainRange
RoadBlackMountain
Bed 3 Bath 2 Car 2
Auction17thAprilat11amOnsite
Land 7.25ha
View Sat10-10:45,Wed12-12:30pm
•CharacterHomePlusCabin
•Privacy,setwellbackfromtheroad
•Spaciousandcharmingmid90’shome
•Twohugebedrooms,onebathinmainhome
•Cabinisonebedsitterwithbathroom
•Pumpondamconnectstotanknearshed
•PeacefulwithviewstoMtCooroora
JeanetteCatalano 0422923851
jeanette@hinternoosa.com.au
MarioCatalano 0400613879 mario@hinternoosa.com.au
Celebrating 25 Years
For 25 years, Noosa Country Style has celebrated the people, homes and lifestyle of the Noosa Hinterland - capturing what makes this region so special.
As we mark this milestone, we also celebrate 36 years of Hinternoosa — a journey built on community, connection and a genuine love for hinterland living.
From changing markets to evolving lifestyles, one thing has never changed: a people-first approach and a passion for helping others find their place to call home.
Luxury, Privacy & Family Living
109 Watergum Drive, Pie Creek | $1,800,000 4 3 2 | 4,782m2
This striking home offers outstanding street appeal with its modern timber and rendered façade, high-end finishes and family-friendly design. Inside, you’ll find a spacious light-filled layout with high ceilings, feature windows, granite waterfall benchtops, gas fireplace, & a stylish butler’s pantry.
The dining area opens to a covered alfresco with built-in BBQ, ceiling fan and peaceful views over neighbouring farmland, creating the perfect space to relax or entertain. The master suite is privately positioned with scenic outlook, large walk-in robe and ensuite with double shower and full-sized bath. A second bedroom also features its own ensuite, ideal for guests or extended family, while all bedrooms include air conditioning, ceiling fans, built-in robes and quality carpet.
A separate media room, tucked behind stylish barn doors, provides the perfect space for movie nights or a dedicated gaming zone. Fully air conditioned, this versatile room offers comfort and privacy, making it an ideal retreat for both relaxation and entertainment.
Outside, the fully fenced and dog-proof yard offers room for children and pets, with a drivethrough shed providing rear yard access. Complete with four 5,000-gallon water tanks, this is a beautiful home that combines luxury, privacy and practical family living in a peaceful rural setting.
Features -
•4 double bedrooms with air con & fans
•2 ensuites
• 3 bathrooms
•Chefs galley kitchen
•Butlers pantry
•Marble fireplace
•Media/gaming room
•Office nook
•Shed & garage
•Architecturally designed
•Rear entertainment area with built in bbq & fan
•Rural views over neighbouring farm
•Privacy
HOME FOCUS
CAPTURING THE HEART WITH CHARM
WELCOME to 17 Duke Street, Sunshine Beach — a property that captures the heart as much as it commands attention.
Framed by a magnificent old mango tree at the entry, there’s an immediate sense of charm and nostalgia as you arrive. Set on a generous 611m² parcel with a lush, elevated outlook, this is a rare offering in one of Sunshine Beach’s most tightly held and sought-after streets.
Just a flat 550m (approx.) walk to the golden sands of patrolled Sunshine Beach, surf club, Noosa National Park trails and the vibrant village cafes, the location delivers the very best of beachside living - walkable, carefree and beautifully relaxed, with everything you love just moments from your door.
One of the earliest solid block homes in Sunshine Beach, this beach cottage is among the last of its kind on Duke Street, holding its history, character, and enduring strength from long-term family ownership.
Privately positioned and fully fenced, the home is ideally positioned on the block, offering exciting value-add potential and ample space for a pool at the front. A generous deck stretches the full width of the home, capturing cooling
HOME ESSENTIALS
sea breezes and a lovely north-easterly outlook across lush greener - perfect for unhurried mornings with coffee, long lunches with friends, and easy evenings filled with birdsong and saltkissed air.
Inside, warmth and character are immediately apparent, with a charming timber kitchen featuring original bamboo benchtops that complement the relaxed coastal aesthetic. Soaring raked ceilings create an impressive
sense of volume and light, while the loft-style bedrooms upstairs offer a peaceful, retreat-like feel. The bedrooms open onto a private rear deck nestled in the tree canopy, offering a peaceful outdoor retreat.
Whether you’re looking to restore a classic beach house, secure a prime investment, or develop on this medium-density zoned site, this is an opportunity not to be missed. Properties of this calibre, in central Sunshine Beach, are
increasingly rare and offer significant potential for value-add or redevelopment.
Imagine living moments from world-class surf breaks, scenic coastal walks stretching 15 kilometres, and sunsets that remind you daily why Sunshine Beach is one of Queensland’s most treasured coastal communities.
Contact our Sales Team to arrange your inspection and experience the magic of 17 Duke Street for yourself.
Address: 17 Duke Street, SUNSHINE BEACH Description: 2 bedrooms, 1 bathroom, 1 garage Price: Onsite Saturday 11th April 2pm Inspect: Contact Agent
Contact: Caitlyn McConnell 0417 637 697 & Tania Wood 0448 786 489, SUNSHINE BEACH REAL ESTATE
17DUKESTREET
SUNSHINEBEACH
A 2 B 1 C 1
AuctionthisSaturday-CharmingCottageonLeafyPrivateBlock
•611m²medium-densitylandincentralSunshineBeach
•Solidblockoriginalcottagewithrakedceilings
•Northeasterlyaspect,fullyfenced
•Loftbedroomswithreardeckinthetreecanopy
•Shortwalktovillage,cafes,surfclub&patrolledbeach
•Valueaddpotential,spaceforpool,orredevelop!
AUCTION
Sat11thApr 2pmonsite
INSPECT Fri 10Apr 12-12.45pm Sat11Apr 1.15-2pm
AGENT
CaitlynMcConnell M:0417637697
TaniaWood M:0448786489
SUNSHINEBEACHREALESTATE
3/33ELANDASTREET
SUNSHINEBEACH
A 2 B 2 C 1 E
ExclusiveCoastalLivingat‘TriesteonSunshine’
•Expansiveground oorapartment
•Openplanlivingwithnorth-eastfacingterrace
•Securebasementparkingfor1vehiclewithlargestorageroom
•Muchadmiredandwellmaintained‘Trieste’;securecomplex
•Sun-drenchedmagnesiumpool,lushgardens,liftaccess, securityintercom
•Centrallocation-minuteswalktovillage,surfclubandbeach
FORSALE
OffersOver $1.6m
INSPECT Sat11thApr 10-10.45am
AGENT
CaitlynMcConnell M:0417637697 TaniaWood M:0448786489
6/4RAYSTREET
SUNSHINEBEACH
A 2 B 1 C 1
E
Elevation,Views&Opportunity!
•Top- oorapartmentinasmallsix-unitcomplex
•OceanviewstoPointArkwright
•Communalpool,lowbodycorporatelevies
•Lock-upgaragepluslargesecurestorageroom
•Immaculateoriginalcondition–moveinstraightaway
•Excellentvalue-addpotentialforrenovationormodernisation
FORSALE
OffersOver $995,000
INSPECT Sat11thApr 11-11.45am
AGENT
CaitlynMcConnell M:0417637697
BoreenPoint
Saturday11thApril
1.15PM-1.45PM2MangoLane323BYNEGOTIATIONPrestigePropertyGroupNoosa0415558656
Cooroibah
Saturday11thApril
11.00AM-11.30AM24AmarooPlace442AuctionTomOffermannRealEstate0423972034
12.00PM-12.30PM346LakeCooroibahRoad432AuctionTomOffermannRealEstate0423972034
Tuesday14thApril
12.00PM-12.30PM346LakeCooroibahRoad432AuctionTomOffermannRealEstate0423972034
NoosaHeads
Friday10thApril
12.00PM-12.30PM9404/5MorwongDrive111AuctionTomOffermannRealEstate0412894542
1.00PM-1.30PM6106/5MorwongDrive332AuctionTomOffermannRealEstate0412894542
4.00PM-4.30PM33/5QuambyPlace221AuctionTomOffermannRealEstate0417600840
Saturday11thApril
9.00AM-9.30AM1LakeEdgeDrive32.52FORSALEPrestigePropertyGroupNoosa0415558656
9.00AM-9.30AM4/16SerenityClose322$4,150,000TomOffermannRealEstate0413044241
9.45AM-10.15AM2524/21LakeviewRise32.52BYNEGOTIATIONPrestigePropertyGroupNoosa0415558656
10.00AM-10.30AM10/30EdgarBennettAv332ContactAgentLagunaRealEstate0434236110
10.00AM-10.30AM154/61NoosaSpringsDr322$1.95MJoeLangleyRealEstate0419883499
10.00AM-10.30AM21SmokeBushDrive322$1,795,000TomOffermannRealEstate0423972034
10.30AM-11.00AM713/61NoosaSpringsDrive43.53$4.6-$4.7MPrestigePropertyGroupNoosa0415558656
11.00AM-11.30AM515/61NoosaSpringsDrive442$6,250,000TomOffermannRealEstate0418714653
11.00AM-11.30AM314/61NoosaSpringsDr332$2.8mJoeLangleyRealEstate0419883499
11.00AM-11.30AM27HoneyMyrtleRd422$2,450,000LagunaRealEstate0434236110
11.15AM-11.45AM135/61NoosaSpringsDrive332.5$2.75-$2.8MPrestigePropertyGroupNoosa0415558656
11.30AM-12.00PM25SleepyHollowDr531$2.2MillionRichardson&WrenchNoosa54474499
12.00PM-12.30PM2SmokeBushDrive434BYNEGOTIATIONPrestigePropertyGroupNoosa0415558656
12.30PM-1.00PM33/5QuambyPlace221AuctionTomOffermannRealEstate0417600840
2.00PM-2.30PM12BelfaPl542BuyerInterest$2,695,000NoosaEstateAgents0407147521
Noosaville
Friday10thApril
4.00PM-4.30PM4AttenuattaPl434OffersOver$2,795,000ConsideredLagunaRealEstate0419332973
5.30PM-6.30PM4AttenuattaPl434OffersOver$2,795,000ConsideredLagunaRealEstate0419332973
OPENHOMES
Noosaville
Saturday11thApril
10.00AM-10.30AM2/43BluefinCourt322InterestFrom$1,800,000NoosaEstateAgents0407147521
10.00AM-10.30AM15RedgumCt422$2,195,000Richardson&WrenchNoosa54474499
10.00AM-10.30AM63/28MunnaCrescent211$1,195,000TomOffermannRealEstate0418980247
10.00AM-10.30AM3/235GympieTerrace321$2,425,000TomOffermannRealEstate0412894542
10.00AM-10.30AM3302/57HoffmanDr211OffersAbove$930,000NoosaEstateAgents0418332247
10.30AM-11.00AM16AsperaPlace432$3.85MillionRichardson&WrenchNoosa54474499
10.30AM-11.00AM4AttenuattaPl434OffersOver$2,795,000ConsideredLagunaRealEstate0419332973
11.00AM-11.30AM36/5QuambyPlace221AuctionLagunaRealEstate0421283951
11.00AM-11.30AM7HazelwoodCourt332$1.85MillionRichardson&WrenchNoosa54474499
11.00AM-12.00PM7CorinthiaCourt322P.O.A.BaseRealtors0412206563
11.00AM-11.30AM13WandooCourt522$1,690,000TomOffermannRealEstate0412894542
11.00AM-11.30AM3/229GympieTce32+1+$4,150,000LagunaRealEstate0407379893
12.00PM-12.30PM3/8PortsideCourt32+1+AuctionLagunaRealEstate0407379893
12.00PM-12.30PM25RoseAshCrescent322O/O$1,800,000ConsideredLagunaRealEstate0434236110
1.00PM-1.30PM1/9LakeWeybaDr322BuyerInterest$1,695,000NoosaEstateAgents0407147521
Wednesday15thApril
11.00AM-11.30AM36/5QuambyPlace221AuctionLagunaRealEstate0434236110
11.00AM-11.30AM3/229GympieTce32+1+$4,150,000LagunaRealEstate0407379893
12.00PM-12.30PM3/8PortsideCourt32+1+AuctionLagunaRealEstate0407379893
1.00PM-1.30PM4AttenuattaPl434OffersOver$2,795,000ConsideredLagunaRealEstate0419332973
PeregianBeach
Saturday11thApril
1.00PM-1.30PM21KestrelCrescent444AuctionTomOffermannRealEstate0413319879
SunriseBeach
Saturday11thApril
11.30AM-12.00PM50TingiraCrescent442AuctionTomOffermannRealEstate0413044241
SunshineBeach
Thursday9thApril
11.00AM-11.45AM7/1RossStreet211$1.29mSunshineBeachRealEstate0448786489
Friday10thApril
12.00PM-12.45PM17DukeStreet211AuctionSunshineBeachRealEstate0417637697
Saturday11thApril
10.00AM-10.45AM3/33ElandaStreet221OffersOver$1.6mSunshineBeachRealEstate0417637697
10.00AM-10.30AM21CrankStreet432ContactAgentTomOffermannRealEstate0437447804
10.30AM-11.00AM9FergusonStreet321AuctionTomOffermannRealEstate0475804467
11.00AM-11.45AM6/4RayStreet211OffersOver$995,000SunshineBeachRealEstate0417637697
OPENHOMES
Tewantin
Friday10thApril
4.00PM-4.30PM14AdaStreet324$2,250,000LagunaRealEstate0438026300
Saturday11thApril
9.30AM-10.00AM40ReadStreet532O/O$1,650,000ConsideredLagunaRealEstate0411774699
10.00AM-10.30AM27HiltonTce43+2$2,500,000LagunaRealEstate0407379893
10.00AM-10.30AM12palmgrove323O/O$1,250,000LagunaRealEstate0411328488
11.00AM-11.30AM14AdaStreet324$2,250,000LagunaRealEstate0438026300
11.00AM-11.30AM58HiltonTerrace432InterestEarly$3,000,000RangeNoosaEstateAgents0407147521
12.00PM-12.30PM28CooroibahCr422$1,850,000-$1,900,000LagunaRealEstate0411328488
12.00PM-12.30PM13HomesteadDr322BuyerInterest$1,600,000NoosaEstateAgents0407147521
Wednesday15thApril
10.00AM-10.30AM27HiltonTce43+2$2,500,000LagunaRealEstate0407379893
11.00AM-11.30AM14AdaStreet324$2,250,000LagunaRealEstate0438026300
Tinbeerwah
Saturday11thApril
10.00AM-11.00AM3SmithsRoad322AuctionLagunaRealEstate0428711163
AuctionDiary
BlackMountain
Friday17thApril
11.00AM-11.30AM235BlackMountainRangeRoad213AuctionHinternoosa0422923851 Cooroibah
Saturday18thApril
2.00PM-2.30PM24AmarooPlace442AuctionTomOffermannRealEstate0423972034
Friday8thMay
11.00AM-11.30AM346LakeCooroibahRoad432AuctionTomOffermannRealEstate0423972034 Eumundi
Saturday11thApril
11.00AM-11.30AM171-187SunriseRd421AuctionNoosaEstateAgents0418332247
Wednesday15thApril
11.00AM-11.30AM171-187SunriseRd421AuctionNoosaEstateAgents0418332247 NoosaHeads
Saturday11thApril
1.00PM-1.30PM33/5QuambyPlace221AuctionTomOffermannRealEstate0417600840
Friday17thApril
1.00PM-1.30PM3/31KatharinaStreet211AuctionMcLurePropertyGroup0400084975 Friday24thApril
12.00PM-12.30PM9404/5MorwongDrive111AuctionTomOffermannRealEstate0412894542 Saturday2ndMay
11.00AM-11.30AM6106/5MorwongDrive332AuctionTomOffermannRealEstate0412894542 Noosaville
Saturday18thApril
10.00AM-10.30AM36/5QuambyPlace221AuctionOnSiteLagunaRealEstate0434236110
Friday15thMay
5.00PM-5.30PM39DolphinCrescent322AuctionCentury21ConollyHayGroup0429827224 NoosaWaters
Saturday11thApril
5.00PM-5.30PM5ThePromontory443AUCTIONReed&Co.EstateAgents0409446955 PeregianBeach
Saturday18thApril
10.00AM-10.30AM21KestrelCrescent444AuctionTomOffermannRealEstate0413319879 SunriseBeach
Saturday11thApril
12.00PM-12.30PM50TingiraCrescent442AuctionTomOffermannRealEstate0413044241 SunshineBeach
Saturday11thApril
11.00AM-11.30AM9FergusonStreet321AuctionTomOffermannRealEstate0475804467
1.15PM-2.00PM17DukeStreet211AuctionSunshineBeachRealEstate0417637697 Tewantin
Friday24thApril
11.00AM-11.30AM63GolfCourseDrive324AuctionTomOffermannRealEstate0410603519
Tinbeerwah
Saturday18thApril
11.00AM-11.30AM3SmithsRoad322AuctionLagunaRealEstate0428711163
12.00PM-12.30PM239DathHendersonRoad5310AuctionHinternoosa0409953311
Breathtaking10-acre(approx)lakefrontestateinatightly heldpocketnearNoosa.Astrikingnear-newhomestead withpoolsideentertainingsitsattheheartoftheproperty, framedbynatureandabsoluteprivacy.Twobeautifully appointedself-containedresidencesaddflexibilityand incomepotential,whilestables,agym/studio,and expansivelevelgroundsdelivertheultimatelifestyle escape.DirectaccesstoLakeWeybacompletesthis rare o ering - secluded, scenic, and just minutes to the coast.
EXQUISITE PROPERTY REPRESENTING VALUE
JUST moments from the Noosa River and within easy walking distance of cafes, restaurants and local lifestyle amenities, this beautifully crafted residence delivers an exceptional blend of luxury, comfort and lowmaintenance living.
Positioned on a spacious yet easy-care allotment, the home has been thoughtfully designed with generous proportions and premium finishes throughout. The owners are committed to achieving a result and welcome genuine offers, presenting an outstanding opportunity to secure a new designer home in this highly sought-after Noosa location.
Inside, the home immediately impresses with burnished concrete flooring, soaring ceilings and an abundance of natural light. Warm Blackbutt timber floors and striking Brazilian natural stone surfaces create a sophisticated coastal aesthetic.
At the heart of the home, the stunning designer kitchen features integrated fridge and dishwasher, double ovens, induction cooktop, soft-close cabinetry and exquisite Brazilian natural stone benchtops and splashback – ideal for both everyday living and entertaining.
The flexible layout offers four generous bedrooms, including two elegant master suites with walk-in robes and private ensuites, complemented by a stylish main bathroom and convenient powder room.
HOME ESSENTIALS
Outside, a private resort-style setting awaits with a sparkling pool, landscaped gardens and a raised gazebo complete with BBQ and wine fridge – perfect for relaxed entertaining.
A superb opportunity to secure a quality-built home and enjoy the very best of the Noosa lifestyle.
KEY FEATURES:
• Prime Noosa Location – Moments from the Noosa River, cafes and restaurants
• 10 Minutes to Hastings Street and Main Beach
• Close to Public Transport for easy connectivity
• Near Local Library, schools, Noosa Marina, Golf Club, Sporting Facilities, Tewantin Village
• Designer Kitchen – Integrated appliances, double ovens, Brazilian natural stone benchtops
• Light-Filled Open Living with high ceilings and quality finishes
• Four Spacious Bedrooms including two luxurious ensuited master suites
• Resort-Style Pool and Landscaped Gardens, outdoor shower
• Entertainer’s Gazebo with BBQ, wine fridge
• Low-Maintenance Living with solar, ducted air-conditioning and secure gates
Address: 27 Hilton Terrace, TEWANTIN Description: 4 bedrooms, 3.5 bathrooms, 2 garage Price: $2,500,000 Inspect:
Contact: Melanie Butcher, 0407 379 893, LAGUNA REAL ESTATE
TIMELESS QUEENSLANDER WITH VIEWS
THIS classic Queenslander blends character with modern living in a flexible, well-designed layout.
Upstairs offers two bedrooms plus a generous office, with an ensuite to the main and a separate guest bathroom. The lounge and dining areas retain traditional charm, while the modern kitchen with gas cooktop and dishwasher flows to a spacious casual living zone and out to a large covered deck, capturing northern light, hinterland views and coastal glimpses to the east.
Downstairs adds valuable extra space, including a sitting room, guest bedroom, hobby room and a home gym area on the lower deck.
The high-set design provides excellent storage, workshop space, two car accommodation and hardstand for a caravan or boat or additional motor vehicle. There is also a 3kW solar system with inverter, rainwater tank and a bore.
HOME ESSENTIALS
Wide, covered verandas wrap the home, creating easy indoor-outdoor living and capturing cooling breezes and elevated views towards Peregian. Airconditioning provides year round comfort.
Set on a private, landscaped 4,268m² block, just minutes from Noosa, this is a quality Queenslander offering space, character and a relaxed hinterland lifestyle.
Features:
• Three bedrooms plus office, ensuite and guest bathroom
• Modern kitchen with 6-burner gas cooktop and dishwasher
• North-facing covered deck with views
• Original character features throughout
• 3kW solar system with inverter to adapt to battery backup
• Rainwater tank and bore water
Originally built in 1895 in Auchenflower and relocated to Tinbeerwah, the home has been thoughtfully restored, showcasing fretwork, VJ walls, polished hardwood floors, high ceilings, leadlight features and wrought iron balustrading.
• Workshop, storage and flexible under-house space
• Two spaces carport plus hardstand for caravan/boat, additional vehicles parking
Address: 3 Smiths Road, TINBEERWAH Description: 3 bedrooms, 2 bathrooms, 2 garage Auction: On Site Saturday 18th April at 11am Inspect: Saturday 10.00am-11.00am
Contact: Warren Evans: 0428 711 163, LAGUNA REAL ESTATE
2
•Primenorth-facing2-bed,2-bathapartmentwithstunningriverviews •Noosa’slargestprivatebeach-directaccess–perfectforfamilies •Renovatedresortpoolareawithheatedlappool,kids’poolandspa •Sauna,gym,pickleballcourt,guestlounge,BBQs,setintropicalgardens •PrivatejettywithdirectNoosaRiveraccessforboa ngandkayaking •FlatstrolltoHas ngsStreet,MainBeachandNoosaNa onalPark •Sameownerforalmost30years– ghtlyheld,iconic,holidayloca on •Excellenton-sitemanagementandstronginvestmentpoten al
AnitaNichols 0434236110
3 A 2.5 B 2 C D C tiv tingN R v rV w 3/229Gympie TeRRaCe,NoosaVille
CraigTaylor 0421283951
•Northfacingterrace,sweepingviewsoftheriverandpromenade •Prizedelevatoraccesstoexpansiveonelevelapartment •2PacdesignerkitchenwithBoschappliancesforelegantentertaining •Studynook,spa,powderroom,laundry,secureparkingplusstorage •Stunningcourtyardwitha12.5mlappool,gazebo,BBQs •Soundratedthickglassslidingdoors;C-Buswiring,vacuumsystem •Secondstoanarrayofcafes,dining,bou ques,watersports •Yourchoicetolivein,enjoyyourownholidaysorletasapermanent rental FORSALE
$4,150,000 VIEW Sat&Wed11-11.30am
m n Butch r 0407379893 mel@lagunarealestate.com.au