Skip to main content

Star Weekly - Sunbury Macedon Ranges - 6th May 2025

Page 1


Mum’s bundle of new love

While many mothers will be receiving breakfast in bed or handmade cards this Mother’s Day, Rupinder Kaur Rekhi will be spending her Mother’s Day cradling the newest addition to her family– a little baby boy.

For Ms Rehki and her husband Gagandeep Singh Rekhi, the arrival of their son has been a heartwarming and emotional experience, bringing a mix of emotions and deep reflection.

“It’s mixed feelings when you go into labour of course,” Ms Rekhi said.

“But after that it’s all well – when we see the baby, it makes it all worth it.”

While Mother’s Day might be a little more low-key this year, there will still be room for celebration.

“Grandmother is here so maybe we will go out and have dinner to celebrate,” Ms Rekhi said.

For Mr Rehki, witnessing his wife’s labour gave him renewed appreciation for the strength of mothers everywhere.

“When I see my wife giving birth, I get even more respect for motherhood. I always have more respect for my mother and for my wife, for every mother in this world,” he said.

Mitchell holds McEwen

Rob Mitchell has retained the seat of McEwen.

Mr Mitchell has been the McEwen MP since 2010, and despite the seat being marginal at recent elections, he has managed to keep his seat.

Mr Mitchell holds 54.88 per cent of the two-candidate preferred votes, ahead of the Liberal candidate, Jason McClintock with 45.12 per cent, with a small swing towards the ALP. The seat of McEwen was called early

on election night, Saturday, May 3.

Mr Mitchell thanked his supporters on social media.

“To say we were humbled and grateful is an understatement,” Mr Mitchell said.

“We know the Liberal Party has invested a lot of money to try and take us down and we could never match them dollar for dollar but we knew we had the right message to people about the right things that are important to our community. “I’ve never ever taken this seat for granted never ever will so it was good to see the backing and the support from our community.

“They’ve (McEwen voters) given me the greatest honour of my life and to put their trust in me again, I will continue to do what I’ve always done to make sure I deliver on every promise I’ve made.”

Elsewhere, the seat of Bendigo, which takes in Kyneton, Malmsbury, Tylden, and Carlsruhe is currently too close to call.

Labor’s Lisa Chesters holds the first preference count lead, with 29,729 votes, while Nationals candidate Andrew Lethlean trails closely behind with 27,234 votes. On

the two-candidate preferred for the seat, Mr Lethlean holds a slight lead over Ms Chesters, with 52.98 per cent and 47.02 per cent respectively. The seat will come down to preferences.

In Hawke, Labor’s Sam Rae held on to the seat, attracting a small swing of votes. On the two-party preferred count, Mr Rae drew 57.64percentofvotes,withLiberalcandidate Simmone Cottom receiving 42.36 per cent. In a Facebook post, Mr Rae said he was “honoured to continue representing our wonderful community”.

toolsandevenmoresupport. Visitournewlookbranch NAB

Rupinder Kaur Rekhi and husband Gagandeep Singh Rehkhi with their 2-day-old son. (Damjan Janevski) 475083_06

Call to rethink triage system

A Romsey resident is calling for changes to how triple-0 calls are triaged after her elderly father was left waiting for an ambulance.

April Heywood called triple-0 about 10pm on Saturday, April 19, after her 91-year-old father, David Burns, had taken a fall.

She said she told the operator her father had fallen in an awkward position, couldn’t be moved, and had a heart condition.

Ms Heywood said she was told she would need to wait for an ambulance nurse/paramedic to call her back before an

ambulance could be booked.

After 20 minutes went without a call, Ms Heywood made a second call to triple-0 and received the same response.

“Five minutes later, I received the call and was asked similar questions as the triple-0 operator. Then she asked to speak to my dad, and asked him the same questions,” Ms Heywood said.

“She said she would book an ambulance which would not arrive for another hour.”

An ambulance finally arrived at 11.30pm.

“I am absolutely disgusted how a 91-year-old man has been treated by this system,” Ms

Heywood said. “I don’t blame the ambulance services themselves, as they’re just trying to do their job.

“Even though my dad is in care now, he could have had a heart attack. He could have died, and that sticks in the back of my mind.“

Ms Heywood believes her father’s case should have been addressed with more urgency.

“If someone is in dire straits like my father… the triple-0 operator who I spoke to should have, I believe , just immediately set an ambulance,” she said.

“I believe myself that no triple-0 officer has

the right to decide who gets an ambulance and who does not.”

A Triple Zero Victoria spokesperson confirmed that based on the details provided, Ms Heywood was referred to AV’s secondary triage team, which handles cases deemed to be of lower priority.

“Our triple-0 operators care deeply about the critical emergency service they provide the Victorian community,” the spokesperson said.

“The structured call-taking process, as agreed with AV, involves asking specific questions and responding to the information that callers provide.”

The Lions Club offers cuppas for great cause

Raising important funds for cancer support services and research, the Lions Club of Diggers Rest is hosting a Biggest Morning Tea this month.

Open to people of all ages and from Diggers Rest and beyond, the morning tea will provide sweet and savoury breakfast options, fresh coffee and tea, cold beverages at bar prices, and a chance to socialise with others while raising money for the Cancer Council.

Funds raised will go towards research and support initiatives for people diagnosed with cancer.

There will also be raffles and auctions, with prizes generously donated from several local businesses.

Lions Club of Diggers Rest president Kathy Skinnersaidtheeventwaswell-receivedamong attendees last year.

“People just enjoyed being able to meet other people from Diggers Rest and just be social,” Ms Skinner said.

“Last year was very successful. We were lucky, we received a lot of donations from local businesses and individuals as well.

“Weallknowsomeonewhohasbeentouched by cancer in one way or another, and you want to help, but there’s not a lot you can do – so this is a great outlet for that.”

The morning tea will run from 10am–noon on Saturday, May 17, at the Diggers Rest Bowling Club on Old Calder Highway.

Autumn falls in Mt Macedon

There’ssomethingmagicalabouttheMacedon Ranges during autumn. Tourists flock to the Ranges from around Victoria and interstate keen to take the beauty of the season.

Star Weekly photographer Damjan Janevski visited Mt Macedon last week to capture these pictures as the foliage begins to change colour.

Entry costs $25 per head, with other prices negotiable for children who would like to attend.
To register, RSVP by May 10 by contacting the organisation. Through last year’s Biggest Morning Tea, the
club raised $4373.00 for the Cancer Council. Contact: Bob, 0429 786 665 or lcdrcarols@ gmail.com
The Lions Club of Diggers Rest member Stephen Hynes, president Kathy Skinner and secretary Bob Cassar are preparing to host their Biggest Morning Tea. (Damjan Janevski) 474872_01

Woodend road limit speeds up

A Woodend road is in the spotlight as residents fight over proposed speed limits.

At the April Macedon Ranges council meeting, councillors voted on changes to the speed limit on Spencer Road, Woodend.

In 2024, council installed 50km/h speed limit signs along the road, after community requests.

Before this, there were no prior records of speed signage on the road.

Council engaged with the Department of Transport and Planning Portal which

determined a default speed of 50km/h.

Following repeated incidents of vandalism and removal of signs, council officers, in consultation with DTP, identified an error on the portal, with the correct speed for Spencer Road being 80km/h.

In light of this, council notified residents in January 2025 of its intention to formalise the speed to 80km/h with DTP.

In March, council received a community petition on behalf of 30 residents stating their demand to have the speed limit stay at 50km/h, asking to have the signage reinstalled by the end of the month.

Later that month, council received a letter signed by 21 individuals objecting the petition request, preferring the 80km/h limit.

During the April meeting, the recommendation introduced by council’s assetsandoperationsdirectorDominicTestoni was to proceed with seeking approval with DTP to have the limit changed to 80km/h, inform residents of said change, install new speed limit signs and continue to review other potential speed limit inconsistencies.

The recommendation would bring the road in line with the Victorian Speed Zoning Guidelines, which recommends an 80km/h

New market to launch in Sunbury

A new initiative in Sunbury is helping the community access fresh and affordable produce.

The Sunbury Community Harmony Food Co-op will be a weekly market, offering an alternative to major supermarkets by providing fresh, seasonal, low mileage produce including fruit, vegetables and eggs.

The market will be open to all residents, but will also operates a referral-only membership program offering additional discounts to individualsandfamilieswhoareexperiencing

financial hardship.

The initiative is a partnership between Goonawarra Neighbourhood House, Multicultural Resource Hub and Sunbury Aboriginal Corporation. It was also supported by start-up funding from the state government, and supported by health promotion staff at Sunbury and Cobaw Community Health.

Co-op coordinator Bianca Lyndon and her dedicated team of volunteers are excited to welcome the community to the co-op for the

launch on Saturday, May 10.

On Saturday, May 10, the market will be running alongside the launch, with plenty to doandsee,includingcookingdemonstrations run by Hume council, a coffee cart, sausage sizzle, live music, face painting and games for children.

The launch event will take place between 10.30am and 12.30pm at the Sunbury Aboriginal Corporation, 43 Macedon Street, Sunbury, with the market running every Saturday from 10.30am to 12.30pm.

limit for roads of this type, a report to council said.

The motion was moved by deputy mayor Kate Kendall and seconded by Cr Janet Pearce. Cr Jennifer Anderson said it was an anomaly that the 50km/h signs went up.

“Different roads have different treatments. They have different traffic management on it and we would still hope regardless of what speed is on our roads that people drive to the conditions,” she said.

“The officers have done the research, and really it should have been at 80km/h.”

The motion was carried unopposed.

Calling young water heroes

Greater Western Water’s (GWW) National Water Week poster competition is back for 2025, with entries now open to all pre-schools and primary schools across its service region.

For the 2025 competition, students are encouraged to create a poster reflecting this year’s theme Water Heroes: Save Every Drop.

GWW spokesperson Kessia Thomson said the competition was a great opportunity for students to show their creative side and how they care for the environment at the same time.

“We’re encouraging all local students to get creative and enter a poster to this year’s competition. You can draw, you can paint or use some other materials including digital technology to create an A3 or A4 sized poster,” Ms Thomson said. “Each year we are blown away not only by the talent and creativity of our local students, but also by their ideas for water saving and caring for our water resources.”

The poster competition is open to all primary schools and pre-schools across Victoria, with prizes up for grabs valued up to $100 for individuals and up to $500 for schools for each of the following categories: early learning / kindergarten, prep, year 1 and 2, year 3- 4 and year 5-6.

Local winners will be announced in October. First prize winners from GWW’s local competition will automatically be entered into the state competition, with winners announced during National Water Week (20-26 October).

To learn more about the categories, prizes and how to enter, visit National Water Week.

Lauren Tyrell, Sharmmi Parekh, Bianca Lyndon, Isabella Rosinsky and Beth Smith are preparing for the market launch. (Damjan Janevski) 474641_02
‘‘ When you are feeling broken, the way to healing is through helping others ’’
- Liz Skitch

Four walls and a caring lifeline

Thomastown Neighbourhood House manger Liz Skitch runs a community hub from a room inside the local library, offering connection, creativity, and crisis support. Tom Ingleton spoke with Liza about mental health, hidden trauma, and why neighbourhood houses are crucial - but under resourced - pillars of community care.

Tucked away in a quiet room inside the Thomastown Library, you’ll find what might just be the suburb’s most essential service – though most people don’t realise it until they walk through the door.

There’s mental health slogans, and then there are mental health saviours and the latter certainly applies to the Thomastown Neighbourhood House.

“We didn’t know you were here!” is the most common thing people say when they discover the neighbourhood house, manager Liz Skitch says.

But once they do, it doesn’t take long for the truth to land.

Across Victoria, mental health services are overwhelmed and recent studies highlight this epidemic is only getting worse.

According to the Australian Bureau of Statistics, one in five Australians will experience a mental illness this year, yet in outer-metro areas like Whittlesea, access to psychologists remains critically low– just 2.2 per 1000 people.

Liz is many things to the community –actress, comedian and an award-winning performer – one thing she is not though is a psychologist.

However, she is very often the first point of contact for individuals in distress at the neighbourhood house.

“You give me a reason to leave the house,” one regular told her.

Another: “Thanks to your playgroup, I now have friends all over the neighbourhood.”

In a time marked by skyrocketing loneliness, cost-of-living stress and the long tail of the Covid-19 pandemic, places like this – warm, inclusive, and quietly revolutionary – are holding communities together.

And they’re doing it under the radar, on shoestring budgets, and with a kind of fierce love that can’t be faked.

When someone walks in clearly struggling,

Liz doesn’t offer a script.

“I listen. Then if I can help – I do,” Liz says.

“The heart-breaking thing is that more often than not, the best we can do is provide a safe space and a phone number to a better resourced organisation.”

What Liz wishes for is modest but urgent: a social worker on-site, food vouchers to give, transport for those who are stranded and can’t access services.

“Wedoourbesttopartnerwithorganisations like Foodbank and Whittlesea Community Connections but this is not enough.”

In that one sentence is the quiet frustration of countless front-line workers across Victoria, whoareholdingspaceforotherswhileburning out themselves.

One moment that stayed with Liz this year happened in a surprise setting – the Death Cafè.

It’s one of Thomastown Neighbourhood House’s more unconventional offerings, a philosophy-based program that facilitates conversations about end of life.

“One of the women shared how she lost her daughter to leukaemia, many years ago,” Liz recalls. “I was struck by her resilience and her creativity. Despite her grief, she’s committed to her community. It reminded me you never know what someone’s carrying.”

It’s a lesson that echoes across the programs the centre runs – from playgroups and craft workshops to dance classes and legal aid visits.

The weight of people’s stories isn’t always visible. But it’s there.

Since the pandemic, GPS and psychologists have increasingly referred patients to neighbourhoodhousesforwhatsomecountries call “green scripts” which directs patients to attend places doing activities that boost social cohesion and wellbeing without ever feeling like clinical intervention.

“Social cohesion is at an all-time low. Loneliness is at an all-time high,” Liz says.

“Butwhena newparticipantjoins our group, wefocusontheirstrengths.Beforelong,wecan see confidence grow and friendships flourish, “When you are feeling broken, the way to healing is through helping others.”

It’s healing through connection – and often, through creativity.

One of Liz’s highlights each week is a Monday afternoon dance party called Lets Move for young adults with disabilities.

“It’s pure joy,” Liz says. “That’s how I keep going – friendship and creativity.”

But Liz didn’t enter this role at a gentle time. She became manager mid-pandemic, when all the programs were shut down and the focus turned to emergency food relief.

Suddenly, she was running a pantry out of the library foyer five days a week, with food linesstretchingtowardthenearbysportsfields.

“I felt out of my depth every day,” Liz admits. “It was like trying to fill a bottomless well.”

Theneedhasn’teased.Ifanything,it’sgrown.

Now, with the cost-of-living crisis biting harder, the support of partners like Foodbank Victoria–whichbringsitsmobilesupermarket to Thomastown on Wednesdays – has become essential.

But so too has the advocacy for more sustainable support.

When asked what she wants politicians and mental health services to understand, Liz doesn’t hesitate.

“Neighbourhood houses provide a sense of belonging and purpose – which is often the key to overcoming mental health challenges from depression and loneliness, to stress and anxiety,” Liz says. “We provide safe spaces for people. But across Victoria, most neighbourhood house managers are working full-time hours in part-time roles. Burn-out is common. It’s not sustainable.”

Liz believes every house should have at least two staff present at all times to ensure safety and adequately support the wide range of

services they provide.

And in Thomastown, there is a desperate need for a larger space.

“We’re grateful to the City of Whittlesea and the state government for the support we do have,” Liz adds.

“But demand is surging, and our capacity hasn’t grown with it.”

It’s a confronting question – what would happen if Thomastown Neighbourhood House didn’t exist?

“There are very few spaces people can go to for free without feeling pressure to spend money,” Liz says.

“Shopping centres have become the default for when we have free time these days.”

Liz is also a passionate advocate for public outdoor spaces, encouraging locals to kick a ball around at the oval, explore local parks or visit the new Whittlesea Gardens skate park.

In a community where many women are migrants, caregivers, or survivors of trauma – including family violence – the role of Thomastown Neighbourhood House is bigger than just activity programs.

“We see people rebuild confidence here,” Liz says. “We see healing. Sometimes people come in quiet and withdrawn and a few months later, they’re running art class.”

Asked if she ever worries about her own mental health and carrying the emotional toll of caring for others, Liz is candid: “Stress and anxiety – it’s a big one for me. But I try to remember to breathe“.

And perhaps that’s the greatest power of neighbourhood houses like this one, they don’t just help others find stability –they model what compassion looks like in action, and yet community organisations like Liz’s are chronically underfunded and under-recognised.

As Liz states in a simple yet poignant truth “Neighbourhood houses are more important than ever.”

Thomastown Neighbourhood House manager Liz Skitch. (Damjan Janevski) 475040_02

New kit helps with STI prevention

As a significant step in STI prevention for Australian women, the country’s first self-test kit for chlamydia and gonorrhoea is now available nationwide, offering greater privacy and fast results according to the company behind the break-through.

The first of its kind in Australia, the self-test kitdetectschlamydiaandgonorrhoeawithone swab sample, producing a positive or negative result for both infections in 15 minutes.

STIs affect almost one in six (16 per cent) Australians in their lifetime and over the last 10 years, cases have increased at an alarming rate in Australia, with rates of chlamydia and gonorrhoea increasing by 26 per cent and 157 per cent respectively.

Chlamydia is the most reported communicable disease in Australia, with over 110,000 reported cases in 2023, but is often asymptomatic,leadingtoundiagnosedcasesas peopleremainreluctanttotestfortheinfection due to perceived stigma or lack of awareness. Gonorrhoeapresentswithpainordiscomfort in the throat, eyes, cervix and other areas but, similarly, it is often mistaken for other infections and remains undiagnosed.

Steven Quinlan, sales director at Touch Biotechnology which developed the self-test kit, says it gives “women immediate control overtheirsexualhealthinawaythattraditional clinical testing does not“.

“Touch Biotechnology’s STI self-test kit for chlamydia and gonorrhoea works similarly to the common rapid antigen tests, using a single

swab, buffer solution and test cassette to test for both infections in women, supporting early diagnosis and treatment,” he explained.

“Byenablingwomentoeasilytestthemselves when and where suits them, the self-test kit eliminates the anxiety associated with clinical settings and transforms the experience into a routine part of self-care.

“Knowing their STI status also helps women to communicate better with healthcare providers, access the right medication, and reduce the risk of antibiotic misuse, which can lead to drug resistance.

“Affordable and discreet self-test kits remove thebarriersthathavetraditionallykeptwomen from seeking care. When infections are caught early, swift action can be taken to prevent complications, such as infertility or chronic pelvic pain.

“In underserved communities, where access to healthcare can be limited, this type of testing is especially important. If adopted in healthcare centres, these kits could increase

IDAHOBIT IDAHOBIT

The facts:

What are chlamydia and gonorrhoea?

Chlamydia and gonorrhoea are both bacterial sexually transmitted infections (STIs) that affect both men and women. Chlamydia is caused by Chlamydia trachomatis. It often doesn’t show symptoms, especially in women, but can lead to serious health issues like infertility if untreated. It can be cured with antibiotics.¹ Gonorrhoea is caused by Neisseria gonorrhoeae. It can cause symptoms like painful urination and discharge, but many people don’t experience symptoms. Like chlamydia, it can be treated with antibiotics, though some strains are becoming resistant to treatment.²

What are the risks of untreated chlamydia and gonorrhoea? If left untreated, chlamydia and gonorrhoea can lead to serious health complications for both men and women. For women, untreated chlamydia and gonorrhoea can cause pelvic inflammatory disease (PID), which can lead to chronic pain, infertility, and an increased risk of ectopic pregnancy. These infections can also increase the risk of HIV transmission.³ Additionally,

testing capacity, reduce costs, and improve overall health outcomes for women and the community.”

The Chlamydia and Gonorrhoea Rapid Test (for female) is now available for purchase at pharmacies, distributors, and online

untreated STIs can contribute to the spread of the infection to others, as well as cause more severe health issues over time. Timely treatment with antibiotics is essential to avoid these risks.

What are the symptoms of chlamydia and gonorrhoea?

Many people, particularly women, may not experience any symptoms, which is why these infections can often go undiagnosed. For women with chlamydia, common symptoms include abnormal vaginal discharge, painful urination, and pain during sex. Some may also experience lower abdominal pain or bleeding between periods or after sex.¹ Gonorrhoea, like chlamydia, may not always present clear symptoms. In women, symptoms often include increased vaginal discharge, painful urination, pelvic or abdominal pain, and bleeding between periods or after sex.

Citations: 1. https://www.health.gov.au/ topics/sexual-health/about 2. https://nindss. health.gov.au/pbi-dashboard/ 3. https://sti. guidelines.org.au/sexually-transmissibleinfections/chlamydia/ 4. https://www. healthdirect.gov.au/gonorrhoea-the-clap

nationwide,tobecompleteddiscreetlyathome. Prior to this, the only option for women to test forgonorrhoeaandchlamydiawastocomplete an individual lab or PCR test. This invasive processcouldbecostlyandtakestoolong,with results typically taking one to three days.

Residents in Macedon Ranges shire’s east and south are being encouraged to share their recent flood-related experiences, to inform updated modelling and make our towns more resilient to future flood events.

The Port Phillip and Westernport catchment area centres around Melbourne but also covers about half of the Macedon Ranges including Gisborne, Macedon, Riddells Creek, Lancefield, Romsey and Darraweit Guim.

Council is collaborating with catchment area manager Melbourne Water, as it works to ensure up-to- date flood information is available.

This helps the state government, local councils, developers, businesses and the community understand how best to minimise the impact of flooding.

Macedon Ranges council assets and operations manager Dom Testoni said flood maps were used to update municipal planning scheme controls, to ensure planning and building decisions take flood

risk into consideration.

“Updatedmodellingcanhelpinformwhere our communities may benefit from upgrades tothedrainagesystem,forexample,orwhere other mitigation works might be needed,” he said.

“We know there have been many across the shire severely impacted by recent flood events and while we have captured some of this sentiment previously, this initiative provides a fresh opportunity for residents to provide invaluable first-hand insights that can help bolster updated modelling.”

Residents are encouraged to have their say by Wednesday, May 14, via council’s website, in-person at customer service centres or at a community engagement session on Tuesday, May 13 at Darraweit Guim Community Hall, 1481 Bolinda-Darraweit Road.

The Melbourne Water Flood Study complements other flood-related work being undertaken in the Macedon Ranges.

Details: yoursay.mrsc.vic.gov.au/ flood-planning

The aftermath of the October 2022 flood in Darraweit Guim. (Damjan Janevski) 303948_06

Macedon Tea Rooms to reopen

The Macedon Tea Rooms is set to be upgraded in a major refurbishment deal.

The Benito Family Pty Ltd has been awarded the new lease for the tea rooms, with plans to transformitintospectaculardiningexperience on top of a Mt Macedon.

The tea rooms has been closed since March after the previous operator’s lease ended.

The state government put the lease for the tea rooms out to tender in June last year, and in March this year, the tea rooms closed after the current lease expired.

Northern Metropolitan MP Wendy Lovell raised the issue in state parliament on March

18, questioning the delay.

Thisweek,MacedonMPMary-AnneThomas welcomed the new deal with the family-owned company.

“The Mount Macedon Tea Rooms are an incredible economic and tourism asset for this community and the wider region – this will attract even more visitors to our beautiful region,” she said.

The tea rooms, which sit inside the Macedon Regional Park, are a popular spot for the over 300,000 visitors who come to the park to hike the summit and visit the Memorial Cross.

Works will begin within the coming weeks, with the building due to reopen later this year.

The family plans to add outdoor seating to take in the scenic views, evening dining, and space for events and functions.

New VIEW Club launched in Kyneton

Kyneton is the latest spot to gain a VIEW Club.

VIEW (Voice, Interests, Education of Women) is a national women’s organisation which gives local women the chance to make friends while supporting the education of children and young people experiencing disadvantage.

The Kyneton club is also one of 54 VIEW Clubs throughout the state which support and work with The Smith Family charity.

The Smith Family provides long-term learning support for Australian children and young people in need, and so far Australian

VIEW Clubs have raised over $1.3 million for the charity.

The clubs collectively also sponsor over 1800 students on the Learning for Life program.

Outside of fundraising, members also volunteertheirtimethroughreadingwithlocal children, helping with homework at Smith Family Learning Clubs and mentor students.

Kyenton VIEW Club president-elect Susan Doyle said the club will attract a broad range of women.

“Each VIEW Club is unique and plans its monthly meetings and events to suit the

interestsandlifestyleofitscommunity-minded members,” she said.

“If you are looking for an opportunity to meet new friends and make connections while supporting Australian children’s education enabling them to create a better future for themselves, then VIEW is an ideal club for you.”

The Kyneton club meets every third Monday of the month at 10.30am for an 11am start.

The club meets at The Kyneton Hotel, 98-100 Mollison Street, Kyneton.

Details: view.org.au or 1800 805 366

While works take place, visitors can still enjoy a coffee at a mobile coffee van that will be available at the site.

Environment Minister Steve Dimopoulos called the historic park a “special place”. The tearooms opened to customers in 2000, replacing a building destroyed in the 1983 Ash Wednesday fires.

Alongside the tea rooms, the state government has invested $810,000 into upgrading the Mount Macedon Memorial Cross Reserve.

Details: parks.vic.gov.au/places-to-see/ sites/macedon-tea-rooms

Shade motion welcomed I was heartened to read your recent article, ‘Hot playgrounds, cold truths,’ reporting Hume City Council has carried a motion to investigate and improve the city’s approach to UV protection and shaded play spaces.

Australia has one of the highest skin cancer rates in the world, with more than 95 per cent of cases caused by UV exposure.

The good news is skin cancer is also largely preventable.

Personal sun protection such as wide brimmed hats, covering clothing, sunscreen and sunglasses is essential but only part of the solution.

Increasing access to quality shade in public spaces is a simple, evidence-based and effective step local governments like Hume can take to reduce UV exposure and protect our community.

On behalf of Cancer Council

Victoria’s SunSmart program, I’d like to commend all councillors supporting Hume City Council’s recent motion. Considering all local councils are currently identifying their climate and health priorities for the next four years, now’s a critical time to recognise the importance of UV protective shade. We encourage all councils to follow Hume’s lead and take this step.

More information about SunSmart’s recommendations for local councils is available at: sunsmart.com.au/ advice-for/local-government/municipalpublic-health-and-wellbeing-plans

The founding members of the new Kyneton VIEW Club. (Supplied)
The Macedon tea rooms. (Supplied)

As part of Victoria’s Big Build, we’re building the Metro Tunnel and its five new underground stations, with three stations now complete. Work is continuing on two stations, and we’re testing trains through the tunnel to make sure they operate smoothly and safely.

While we work, disruptions could affect your travel

Train disruptions: Buses replace trains in both directions

Sunbury Line 10 to 11 May 17 to 18 May 24 to 25 May 7 to 8 June

you

Arden Station

Discovering cardiac rehabilitation in the Macedon Ranges

Cardiac rehabilitation (cardiac rehab) plays a crucial role in helping individuals recover from heart-related events, such as heart attacks or surgeries, and in managing chronic heart conditions.

The Macedon Ranges Health (MRH) Cardiac Rehab program is designed to provide comprehensive support that empowers participants to lead healthier, more active lives while reducing the risk of future heart problems.

The program at MRH combines expert-led

exercise routines, personalised education, and ongoing support tailored to each individual’s needs. The focus is on fostering long-term lifestyle changes that not only enhance physical health but also improve overall well-being. Cardiac rehab helps to support individuals to lower their chances of hospital readmission and can also reduce their risk of death from heart conditions.

Cardiac Rehab at MRH typically begins during the transition to outpatient care, whether at home or within the community,

ensuring continuity in the rehabilitation process. MRH offers flexible options, including face-to-face sessions in a group setting or one-on-one appointments, based on the patient’s preference and comfort level.

A key component of the MRH program is the initial assessment with an exercise physiologist. This assessment ensures that each participant is ready to engage in group exercise sessions safely and effectively. The program is designed not just to restore heart

function but also to equip participants with the knowledge and skills to maintain a heart-healthy lifestyle.

For those seeking a structured and supportive environment to aid their recovery, the Heartsmart Cardiac Rehab Program at MRH is an excellent resource.

To learn more, call (03) 5428 0300 and ask for Louise Beer, the program coordinator. She can provide additional details and help you take the first step toward a healthier heart.

Choir ready to perform

The talent of the Ranges will be on show in Castlemaine this month, as The Gisborne Singers performs its first concert of 2025.

Set for Sunday, May 18, the concert program includes Purcell’s Come, Ye Sons of Art Away, and Vivaldi’s choral masterpiece Gloria in D Major – which is considered by many as one of sacred music’s most uplifting choral works.

Featuring renowned soloists Meryln Quaife and Kristen Leich, the choir will be accompaniedbytheMacedonRangesChamber Orchestra and conducted by Luke Severn.

Formed in 1980, The Gisborne Singers is a choral ensemble that has evolved over time and is currently focused on performing large-scale

classical works.

Funds raised by ticket sales at its concerts and events all go towards the choir’s further activities, for example, performing alongside professional singers and orchestral players.

The May 18 concert will begin at 2.30pm at the Castlemaine Town Hall, with tickets able to be purchased online and costing $55 for full pricing, $45 for concession – along with free entry for those aged under 12.

The Gisborne Singers are a community choir and new members are always welcome, with no auditions required and rehearsals on Wednesdays at the Gisborne Uniting Church.

Details: gisbornesingers.org.au

Briefs

Measles exposure sites

There is currently an increased risk of measles in the Macedon Ranges. There are four exposure sites in the Macedon Ranges, all from Saturday, April 19. They are: Holgate Brewhouse, Woodend, from 12.30pm to 1.20pm; Paysanne Cafe, Woodend, from noon to 1.55pm; Woolworths, Kyneton, from 3.30pm to 4.30pm; and Musk Lane Wine, Kyneton, from 4.30pm to 6.15pm. Chief health officer Dr Evelyn Wong recommends anyone who has attended an exposure site during the specified times should monitor for symptoms and seek medical care if symptoms develop for up to 18 days after the exposure, until Wednesday, May 7. Symptoms of measles include fever, cough, sore or red eyes, runny nose, and feeling generally unwell, followed by a red maculopapular rash.

Steam rally

The Annual Steam and Vintage Machinery Family Fun Day is on Sunday, May 18, from 9.30am-4pm. There will be children’s activities, live steam and vintage machinery on display, as well as the ever popular Tractor pull competition with entrants coming from across Victoria. It’s at the Gisborne Steam Park, Webb Crescent, New Gisborne. Entry is $15 for adults. Children can attend for free. Details: www.gisbornevmrs.com/#rally

FOR BREAKING NEWS, VISIT

Web: starweekly.com.au

Sunbury & Macedon Ranges Star Weekly @starweeklynews @star_weekly

A group of members from The Gisborne Singers. (Supplied)

PUZZLES

To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.

ACROSS

1 Also known as (1,1,1)

3 Sacrilegious (11)

9 Difficult to understand (7)

10 Captivate (7)

11 Somewhat (8)

12 Smear, often with oil (6)

14 Spawn, similar to caviar (3)

15 Without aim (11)

17 Restrictions (11)

19 For this, ad – (Lat) (3)

20 Cease (6)

21 Plastic unit containing audio or visual tape (8)

24 High-protein pulse (7)

25 Middle Eastern national (7)

26 Impediment (11)

27 Televisions (abbr) (3)

DOWN

1 Inherited from one’s family (9)

2 Whenever you like (7)

3 Stereotypically masculine (5)

4 Speed up (10)

5 Bars (4)

6 Designer of goods and structures (9)

7 Opening (7)

8 Separate metal from ore (5)

13 Crowning ceremony (10)

15 Metallic element (9)

16 People living together in communities (9)

18 Of the Freemasons (7)

19 Highest in temperature (7)

20 Rummage (5)

22 Wait on (5)

23 Operator (4)

can you list? The centre letter must be included and each letter may only be used once. No colloquial or foreign words. No capitalised nouns, apostrophes or plural nouns ending in “s”.

1 What was the first successful contact lens made of?

2 ‘Herbst’ is German for which season?

3 What astrological term is used to describe the apparent backwards movement of a planet through the sky?

4 The legal drama series The GoodFight starring Christine Baranski (pictured) is a spin-off of which show?

5 What is the name of Taylor Swift’s 2023–2024 concert tour?

6 In which decade were the first Grammys awarded?

7 In which ocean would you find The Bahamas?

8 JojoRabbit, Hunt for the Wilderpeople and Boy were all directed by which filmmaker?

9 What are homonyms?

10 True or false: chickens can recognise up to 100 faces?

COMMUNITY CALENDAR

WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Star Weekly Community Calendar, Corner Thomsons Road and Keilor Park Drive, Keilor Park, 3042, or email to westeditorial@starweekly.com.au by 9am Wednesday the week prior to publication

Sunbury Ladies Badminton Club

Sunbury Ladies Badminton Club invites women to be part of Sunbury Ladies Badminton Club and enjoy the benefits of physical activity combined with socialisation. Social games are held every Thursday morning, excluding public and school holidays, from 10am–12pm at the Eric Boardman Stadium in Wilsons Lane, Sunbury. You are also welcome to sign up to be part of a team, also playing each Thursday morning. Equipment and coaching is provided.

 sunburylbc@gmail.com

Friends of Woodlands Historic Park

Help preserve Woodlands Historic Park and learn about its history by joining the Friends of Woodlands Historic Park. The group consists of volunteers, working one day each month in the park, on projects including plant propagation and revegetation, weed removal, litter control and other activities. Some members may also work in the park on projects at other times. Becoming a member of the group is easy and free, and is open to like-minded people who want to take positive action to maintain our environment. You must be 18 or older and enjoy outdoor activities. The Friends group meets on the first Saturday of each month at the Parks Victoria depot off Somerton Rd, Greenvale.

 Bevan, 0468 469 514 or bevan@keepemail.com

Sunbury Art Society

The Sunbury Art Society meets every Friday and Saturday, from 10am- 3pm, at the Boilerhouse, Jacksons Hill, to paint or draw over a cuppa with other like minded people. New members welcome.

 Ken, 0407 062 568, or Yvonne, 0429 994 828

Art group

The Woodend Art Group holds classes and workshops in the studios in the Woodend railway station complex. It also has a social Tuesday where members and interested people can come along in the morning, have a coffee and paint together in a social environment.

 Colin Robinson, 0407 426 252

Shuttles and pickleballs

Macedon Ranges Badminton Club is inviting residents to come and play badminton, or pickleball, or both at Macedon Community Centre. Badminton is played on Tuesdays from 7.30pm and Thursdays at 9.30am. Pickleball is played on Mondays at 6.30pm, Wednesdays at 10.15am and on Tuesday from 10am at the Romsey Recreation Centre.

 David, 0419 589 425, or macedonrangesbadminton@gmail.com

Scottish country dancing

The Macedon Ranges Scottish Country Dancing Group meets every Thursday,1-3pm, at Buffalo Stadium, Woodend. The dancing involves social country dancing, and no special clothes needed, just soft flat shoes.

 Meg, 0409 166 783, or Linda, 0408 476 317

Amateur radio club

The Macedon Ranges Amateur Radio Club meets on the third Saturday of the month at the Woodend RSL Hall, 32 Anslow Street, Woodend, at 10am. If you are interested in amateur radio or already have a call sign, this could be for you.

 http://www.mrarc.org.au

Take off weight naturally

Struggling to lose weight? Struggling to get motivated? Want to try and do it in a friendly

This week’s photographer’s choice picture is of Werribeeks members Carmel Gerdsen, Debbie Conway and John Tulloch. (Ljubica Vrankovic) 475439_01

and less stressful atmosphere? Come and join TOWN (Take Off Weight Naturally) every Thursday at 9am at the Sunbury Neighbourhood House, 531 Elizabeth Drive, Sunbury.

 Rhonda, 0409 740 924

Community. Connect. Create. If you are needing support or looking for a social group to join, you can visit Community. Connect. Create, which is an online resource listing support and community groups in the Macedon Ranges. if you would like your group listed or would like to work to help this project grow please email: fiona@communityconnectcreate. com.au

 Communityconnectcreate.com.au

Kyneton Badminton Club

Kyneton Badminton Club is a welcoming, fun and social group that plays on Mondays, at 7pm at the Kyneton Toyota Sports and Aquatic Centre, Victoria Street. All skill levels are welcome.

 kynetonbc@gmail.com

Masonic Lodge

The Sunbury Macedon Ranges Masonic Lodge meets monthly on the second Wednesday of the month at 7pm, 73 Main Street, Romsey. New members welcome.

 Paul, 0479 127 476, or Rob, 0428 260 647

Sunbury Combined Probus Club

The Sunbury Combined Probus Club meets every fourth Thursday of the month at the Sunbury Bowling Club at 10am.

 Jo, 0410 834 272

Ladies probus

The Woodlands Ladies Probus Club of Sunbury meets on the fourth Monday of each month at the Sunbury Bowling Club at 9.45am.

 Leonie, 0401 764 182

Sunbury Ladies Probus Club

The Sunbury Ladies Probus Club meets at 9.30am on the fourth Wednesday of each month at the Sunbury Football Social Club rooms.

 Pat, 0433 789 754, or Sylvia, 0417 170 142

Probus Club Of Sunbury

Join the Probus Club of Sunbury on the first Wednesday of the month at the Sunbury Bowling club at 9.30am. It’s a friendly men’s group open to visitors and new members, with a number of great events held each month.

 Greg, 0417 593 035

Breast cancer support group

On the first and third Tuesday of the month

breast cancer survivors are invited to head along to the Gisborne Golf Club at 10.30am to take part in a breast cancer support group.

 Lesley, 0484 691 226

HarmoniX Vocal Company

All-male singing group happening on Thursday, 7-9.30pm, in Sunbury, with a mixed choir, DynamiX Vocal Company, rehearsing Tuesday, 7-9.30pm. Rehearse at Dulap Wilim Hub, Leichardt Street, Sunbury. No auditions required.

 harmonixvcinc@gmail.com

Rotary club

The Sunbury Rotary Club meets every Tuesday at the Ball Court Hotel, 60 Macedon Street, Sunbury, from 7pm.

 sunburyrotary@gmail.com

Village connect

Enjoy free coffee and cake while connecting with fellow Macedon Ranges residents 55 years old and older. Happening on Tuesdays and Thursday at cafes across the municipality.

 https://bit.ly/3AMUrxm, or 5422 0262

Arts and games night

Get creative at the Sunbury Youth Centre each Wednesday, from 3.30-5.30pm. The free program is for people aged 12 to 18 years old, at 51-53 Evans Street, Sunbury. VIEW Club

Sunbury-Macedon Ranges VIEW Club is a friendly women’s organisation and a valued part of The Smith Family. It meets on the third Friday of each month at 11am at Club Sunbury, Riddell Road, Sunbury. New members warmly welcome  Lee-anne, 0403 047 909

Sunbury Woodworkers Club

Join the Sunbury Woodworkers Club to learn woodturning. No experience or tools required. The club is a welcoming environment open to men and women who wish to learn. Meetings for new guests are held on the third Wednesday of every month at 7.30pm. Circular drive, Jackson’s Hill, Sunbury. Facebook: Sunbury Woodworkers Club.

 Anita, 0417 402 795

The Dress is more that it seams

‘The Dress’ might just epitomise the notion that things aren’t always what they seem –especially in Melbourne at the end of the 19th century.

While widow Hannah may live in a grand mansion and not want for anything, loneliness is an unspoken curse.

For her flamboyant tailor Bertin, the advent of department stores and retail therapy is a hit to the pocket and prominence alike.

Essence Theatre Productions chairperson Alaine Beek, who wrote the play, quite literally puts herself in Hannah’s shoes by playing the character herself.

“In those days when you were a widow, you

were often just given tenancy and you didn’t really own much,” Ms Beek said.

“We presume wealthy people had this happy, exciting life, but it wasn’t necessarily the case.

“Women had very limited power, and it could actually be quite boring.”

Hannah loves Bertin for the light he brings to her overcast life, but his escapades are something she desperately tries to evade.

The dynamic duo will embark on a tale of insistence and resistance when he tries to drag her along to a masquerade ball, where he will try and showcase his work.

On top of facing the loss of his livelihood, Bertin must also walk a fine line as a gay man

in a society that can be both ambivalent and persecutory.

“Bertin’s sexuality– it’s revered, but it’s never spoken about, but if he gets in the wrong circle he could be in trouble,” Ms Beek said.

The show will be staged at Werribee Park Mansion on Friday, May 9 at 8pm.

Tickets: https://www.essencetheatre. productions/the-dress-booking-page

Alaine Beek and Scott Middleton will depict the friendship of Hannah and Bertin in The Dress. (Supplied)

Artists share their creative journey

Altona’s Louis Goel Gallery has another exhibition that art lovers from the inner-west and beyond can enjoy.

Three Artists, One Journey features the work of Amanda Neville, Ilona Herreiner and and Juan Vasquez who are all based at the Altona Artisans ceramic studio at the Louis Joel Arts and Community (LJAC) centre.

Opened on April 26, the exhibition will run through until May 14 and features ceramics, mosaics, wood, and clay sculptures that explore the shared creative journey of three artists shaping raw materials into expressive forms.

Neville’s intricate mosaics piece together colour and texture, telling stories through fragments, while Vasquez’s ceramics celebrate the fluidity and strength of clay, capturing both tradition and innovation.

Herreiner’s sculptures, crafted from wood and clay, speak of transformation and organic movement.

Though working in different mediums, each artist shares a deep connection to process, material, and storytelling.

Their hands shape, carve, and construct, bridging past and present, form and emotion.

The exhibition allows patrons to experience

this dialogue, where art becomes a reflection of touch, time, and vision.

The Louis Joel Gallery is located within the LJACcentreandisopenfrom 9.30am-4.30pm Tuesday - Friday, and from 11am - 2pm on Saturday and Sunday. Three Artists, One Journey closes at 3pm on Thursday, May 14.

For more information: https://www.ljac. com.au/about-louis-joel-gallery/ Those wanting to learn from the three artists as well as viewing their work, can do so at a range of courses offered at the Altona Artisans ceramic studio.

Details: //www.ljac.com.au/altonaartisans/

An optimistic art exhibition for the times

Brimbank Gallery in Sunshine is proud to present Onward & Upward, a solo exhibition by acclaimed Australian artist Patrick Francis, running until May 30.

This vibrant and emotionally resonant exhibition showcases a compelling new body of work that continues Francis’ unique exploration of humanity, movement, and transformation through bold colour and expressive form.

Known for his distinct style of figurative abstraction and powerful visual storytelling, Patrick Francis brings an intuitive energy to his work, celebrating both individual identity and shared experience.

Onward & Upward is a reflection on perseverance, joy, and the pursuit of personal growth, all deeply embedded in his signature style—vivid, direct, and deeply human.

Francis, a Melbourne-based artist, has exhibited widely across Australia and internationally. His work is held in major public and private collections, including the National Gallery of Victoria, Artbank, and the Art Gallery of New South Wales. Recognised not only for his artistic achievements but also his advocacy for artists with disabilities, Francis’ practice continues to redefine expectations and expand conversations around contemporary Australian art.

Brimbank Gallery invites the community to experience Onward & Upward, where each work resonates with energy, optimism, and a bold sense of momentum.

The gallery is located onthe first floor of the Brimbank Community & Civic Centre. It is open Monday to Friday, 9am to 5pm. Entry is free.

There are about 900 species of eucalypts in Australia, and an upcoming workshop at the Melton Botanic Garden will give you the opportunity to sketch and appreciate just some of these incredible trees.

Friends of Melton Botanic Garden and environmental psychology doctor

Kathleen Bagot are partnering to host a two-hour nature sketching and journaling workshop this month, providing sketching skills and an opportunity to practise mindfulness in an outdoor setting with like-minded nature enthusiasts.

The event coincides with Botanic Gardens Week.

The workshop starts with a guided nature-based mindfulness practice, followed by a warm up with some different sketching techniques and discussion of template options.

There will then be a discussion about eucalypts, and the session will end with a chance to share your thoughts and sketching pages with other attendees.

All supplies will be provided to participants new to nature sketching or journaling, and no experience or art skills are required.

Experienced sketchers are welcome to bring their own favourite journal and supplies, or use those provided.

Ms Bagot said the event is aimed at being accessible and inclusive to all who would like to attend.

“You don’t have to be an artist or a scientist to do nature journaling … it really is about slowing down [and] noticingwhat’sinnature,”MsBagotsaid.

She said that a previous workshop held on March 23 for National Eucalypt Day sold out.

Theworkshopwillbeheldfrom10am–noon on Sunday, May 25 at the Melton Botanic Garden.

Tickets can be purchased online. Details: events.humanitix.com/naturesketching-eucalypts-in-melton-botanicgarden-25-may

The work of artists Juan Vasquez, Ilona Herreiner, and Amanda Neville is on display in the Three Artists, One Journey exhibition at the Louis Joel Gallery in Altona until May 14. (Ljubica Vrankovic) 472730_01
Artist Patrick Francis and exhibition curator Richard Orjis. (Supplied)
Environmental psychology doctor Kathleen Bagot at the Melton Botanic Garden. (Damjan Janevski 475273_01

SPORTS QUIZ

1. Which team selected college quarterback Cam Ward with the first overall pick of the 2025 NFL draft?

2. Peter Bosustow played 65 games with which VFL club from 1981–83?

3. Australian basketballer Anneli Maley is contracted to which WNBA team?

4. Former English cricketer Andrew Flintoff was badly injured in 2022 filming which television program?

5. Which Premier League team did Liverpool defeat 5-1 to secure the 2024–25 title?

6. Which club now shares with Liverpool the record of twenty titles

In which two major US sports leagues did Deion Sanders play professionally?

The NSW women’s rugby league team until recently shared a nickname with which A-League soccer club?

What was that nickname?

10. What is the name of the high school football team Archie plays for in the television series Riverdale?

With several months still to go in the 2023–2024 season, who did Arne Slot take over from as coach of Liverpool?

12. What colour beard features on the Canberra Raiders’ viking logo?

13. Which team emerged victorious in this year's Anzac Day clash?

14. What rhyming nickname is used to refer to players removed from the field for temporary penalties in NRL?

15. Australians Isabella Nichols and Jack Robinson won which recent surfing event?

16. Simone Biles’ husband Jonathon Owens is a defensive back for which NFL team?

17. The distance world record for women’s shot put is how many metres?

18. And in what decade was that record set by Russian athlete Natalya Lisovskaya?

19. Co-owned by Ryan Reynolds, Wrexham FC just secured its third straight promotion after a 3-0 win over which other club?

20. Which NBA team is most associated with the colour purple?

21. The LA Kings and the Seattle Kraken are in which conference of the NHL?

22. Matthew Kennedy has played for how many AFL clubs?

23. And which clubs were they?

24. Thea Trinidad is the real name of which WWE wrestler?

25. Campbelltown Sports Stadium is the home ground of which A-League men’s team?

26. How many times have the Toronto Raptors won the NBA championship?

27. What is the name of the racing series in the movie Cars?

28. NFL team the Falcons play out of which city?

29. Will Skelton captains which Australian national team?

30. The IPL was founded in which year?

Ryan Reynolds
Simone Biles

Still keeping ahead of the game

It’s amazing how the Toyota Corolla has evolved over the years.

Back in the day it was basic, vanilla transport and that’s the way it stayed for years.

Then someone, somewhere flipped a switch and things began to change dramatically, starting with the 11th gen Corolla in 2012.

But it was just a warm up for the current model which arrived in early 2018, with its complex, unrepentant, multi-faceted design.

Sittinglowerthanbeforewithasteeplyraked windscreen, it presents a predatory nose, with a designthatisasgoodasanythingfromEurope.

The long and short of it is that the company has been able to transform the image of the car from staid and conservative into something much more sporty with younger buyer appeal - and Corolla remains the best-selling cars in the world.

Styling Corolla hatch starts from $30,630 for the AscentSport,$33,780fortheSX,$37,620forthe ZR - all with a 1.8-litre hybrid petrol-electric drivetrain and CVT automatic.

And, if the sporty ZR doesn’t float your boat, there’s also the high performance, all-wheel drive GR Corolla to consider.

But bring your money with you, because it’s a big hike in price: $67,990 in manual form or $70,490 with an automatic (before on-road costs). Two-tone paint adds $775 and is offered in combination with white, grey, red, silver and blue.

Our test vehicle, the ZR Hybrid hatch, is priced from $43,280 by the time you put it on the road in Sydney. The price varies a little depending on your address.

Finished in black over silver, the ZR looks stunning.

Standard kit includes 18-inch alloys, dual zone climate air and a combination of real and artificial suede trim, with heated sports seats up front with red accents and an eight-way, power-adjust driver seat with lumbar support.

There’s also a premium gear lever and steering wheel, smart entry and start, electric parking brake, adaptive cruise control, road sign recognition, auto lights and wipers, auto-dimming rear view mirror, front and rear parking sensors and rear privacy glass. In the lights department, it has auto high beam, bi-LED headlights, along with LED daytime, tail and front/rear fog lights.

ZR steps up to a full 12.3-inch digital instrument cluster along with windscreen head-up display.

Corolla comes with a five-year unlimited kilometre warranty.

Infotainment

Infotainment consists of an 8.0-inch touchscreen with premium JBL 8-speaker audio, plus Bluetooth, satellite navigation, AM/ FMandDAB+digitalradio,andwirelessApple CarPlay and wired Android Auto.

You also get 12 months of complimentary access with remote connect to Toyota Connect Services which automatically notifies emergency services in the event of an accident as well as provides remote access to the car.

There’s also a wireless charge pad, two USB-C ports and a 12 volt outlet in the front (but nothing for rear seat passengers).

Safety

Corolla has been awarded a full five stars for safety by ANCAP. It comes with a rear view camera, seven airbags including a driver knee airbag and autonomous emergency braking (City, Interurban & Vulnerable Road User) as well as lane keep assist (LKA) with lane departure warning (LDW).

An upgraded Toyota Safety Sense suite starts with the pre-collision safety system which adds motorcycle detection, intersection collision

avoidance support for crossing vehicles and left/right turn, emergency steering assist and acceleration suppression at low speeds.

Cameras and radar sensors have also been improved offering a wider range for detection of obstacles or vehicles.

Blind spot monitor has been added across thehatchrange,whilelanetraceassisthasbeen expanded to include the emergency driving stop system feature that has been designed to bring the vehicle to a gradual stop if it detects the driver is no longer making vehicle inputs.

The active cruise control system has also been enhanced and now offers four distance settings, the ability to detect other vehicles earlier, and the addition of deceleration assist when changing lanes.

But it misses out on auto reverse braking.

Isofix child restraint anchorage points are provided for the rear outboard seats.

Engines/transmissions

With the introduction of the upgraded fifth-generation hybrid powertrain, performance has been boosted with a 13kW increase in power to deliver a combined output of 103kW.

The upgraded hybrid teams a 1.8-litre petrol engine with a newly developed high-output motor generator, power control unit and downsized hybrid transaxle.

The front, axle-mounted drive motor has been enhanced by doubling the number of magnets per pole inside the rotor, while the newly developed lithium-ion battery reduces weight by 14 per cent while increasing both input and output power.

Thehybriddrivesthefrontwheelsexclusively via a continuously variable transmission (CVT).

Driving Corolla’s low stance and wind-cheating profile places the car quite close to the ground. As a result,itcanmakegettinginandoutdifficultat timesanditmeansdrivewaysandspeedhumps also need to be approached with caution, as the low front apron is prone to scraping.

Sports seats with bolstered sides add to the difficulty. The sloping rear roof line also makes entry to the back seat more difficult than it probably should be and you might find it a little cramped once you’re in.

The boot gains some extra space, with a puncture kit instead of a spare tyre to make room for the hybrid battery pack.

Of note Corolla’s cousin the Lexus UX scores a larger 2.0-litre engine as the basis for its hybrid that produces a combined 146kW.

Putting the transmission of the hybrid in Power mode delivers more satisfying throttle response, with a turn of speed thanks to the boost from the electric motor. But make sure you don’t pull the transmission lever back all the way or you’ll find yourself in B instead of D, which is regenerative braking mode.

Traffic sign monitor recognises physical speed signs only.

It doesn’t recognise electronic speed signs, nor does it differentiate between standard signs, timed school zones or bus and truck advisory speed - so until it encounters a real speed sign it could be telling you fibs.

Steering is sharp and the hatch corners flat and hard, but the ride is overly harsh and the cabincanbecomequitenoisydependingonthe surface.

Toyota does not permit operation of the satellite navigation system while the car is in motion.

It’s super annoying, but you have to be in park with the handbrake activated. And that means pulling over and spending precious minutes on the task.

Sluggish response from the touchscreen makes the task that much more difficult. You can bang in the name of a street only to look up and discover it failed to recognise the first letter and that means starting over.

Of course, you could try appealing to the car’s voice activation system, but that’s an even more frustrating experience.

At the end of the day the hybrid is all about economy and this is where the Corolla excels. Rated at 4.0L/100km, we were getting 5.2L after almost 400km of mixed driving.

Summing up

You can’t really go wrong with the Corolla ZR hybrid hatch, but it commands a steeper price these days at more than $43K on the road.

There’s no longer a petrol model to distract buyers, but the hybrid powertrain provides immediate, accessible, no frills fuel savings to the average motorist, with no need for user intervention.

Beware the low ride height however which makes entry and exit more difficult than you might think.

You can’t really go wrong with the Corolla ZR hybrid hatch. (Pictures: Supplied)

Competition heats up in the sun

There was plenty of sporting action around the grounds and courts on Saturday. StarWeeklyphotographer

out shooting the skills on display in the autumn sunshine.

Williamstown’s Tom Downie. 475540_01
Keilor Park’s Caitlyn Crameri. 475729_09
Spotswood’s Lachlan Heriot and Yarraville Seddon’s Wil Baker. 475545_14
Werribee Centrals’ Michael Culliver. 475479_01
Werribee Centrals’ Olivia Edwards. 475482_23
Keilor Park’s Isabella Arvanitis and Burnside Heights’ Krissy Trang. 475729_13
Yarraville Seddon’s Corey Hitchcock. 475545_02
Werribee Centrals’ Kai Gomes Pattiyage and Inverleigh’s Jarvis Miles. 475479_08
Williamstown’s Justin Plapp. 475540_22
Williamstown’s Toby Triffett. 475540_09
Werribee Centrals’ Ellie Tubbs. 475482_09
Ljubica Vrankovic was

Lions happy with start to season after two wins

The Sunbury Lions have gotten off a strong start to the Ballarat Football League season as it looks to bank early wins.

With a six week period in the middle of the season with four games away and a bye, the Lions are keen to make the most of their matches at home.

After losing to Darley in its first match, the Lions have won their next two matches to be ahead of the ledger early on.

“We’re really happy with the start to the season,” coach Matt White said before the weekend’s match with Ballarat. “We could have got the job done against Darley to start the year.

“Darley at Darley is always hard. At home we’ve been great against Redan and North Ballarat on the weekend.

“Hopefully we can tame the old nemesis in Ballarat and make it 3-1.”

White said getting wins on the board early in the season was something they had focused on

before heading away from Clarke Oval in the middle of the year.

The Lions form in the past two matches have impressed White, particularly the first half against North Ballarat in round three.

“We were 10.1 at half time,” he said. “The guys were slotting goals from 50 and then from 40 metres out in the rain.

“We’ve been happy with how the boys have come out. It was nice to get off to a good start.”

White said he had been thrilled with their off season recruits and how they had fitted into the line up.

He said the combination of Daniel Johnston joining Jake Sutton up forward was working well.

“We’ve had a spread of goalkickers in the forward line and the mids have been kicking goals,” he said.

“DJ is yet to hit a big bag yet but it’s to do with how we have designed it. Him and Jake are opening up the forward line and allowing

the middle through to kick goals.

“Myles [Gollant] has been really good at centre half back. We’re not sure how his old club let him go.

“By luck his sister plays netball for us and he started to look at us.”

TheLionsthoughhavelostCodyBramblefor season after tearing his ACL.

White said they would look to get Bramble back around the group as soon as they can.

“He did a lot of work in the off season,” he said. “He trained with three different VFL [Victorian Football League] clubs and got on the Bulldogs list.

“He was primed for a big year. He was brilliant against Darley and had 14 or 15 disposals at half time against Redan.

“He was in some good form.”

The Lions were back in action on Saturday against Ballarat, after deadline.

Game 250 up for Wilson

Jaimee-lee Wilson’s mum wanted her to retire from football after she hyperextended her knee in her first game.

That was 250 games ago, as on Saturday, Wilson ran out for game 250 for her beloved Sunbury Lions as they faced off against East Sunbury in the Essendon District Football League women’s division 2 competition.

“Reaching 250 games honestly feels surreal,” Wilson said before the game.

“I never set out chasing numbers — I just love the game, the people, and the moments we share on and off the field.

“I’m incredibly grateful to still be out there, contributing, learning and being part of something bigger than myself.

“Every game has taught me something, whether in victory or defeat.”

When Wilson started she was just going to fill in for a game, at the request of her long time best friend Alana Bell.

She is still playing 250 games later.

“I definitely didn’t plan on playing this long. I just kept showing up because I loved it — the game, the people, the laughs, the tough days, all of it.

“I’m so glad I said yes to that one fill-in game all those years ago.”

Wilson said it’s the people that keep her coming back every year.

She said the laughs, the banter, the team dinners and the midweek trainings when you’re tired but leave feeling lighter.

“It’s not about the wins or the stats, it’s about the connection,” she said. “This team’s been my secondfamilyforsolong.Andlet’sbehonest— I’m also here for the sneaky rubdowns.

“Plus, I’ve been filling in for 250 games now — might as well keep the streak alive.”

Wilson said there were so many highlights in her career and it’s never just been about the big wins, it’s the little moments and her teammates that mean most.

“The come-from-behind victories, the team songs sung completely off-key, the muddy games,” said Wilson who quickly runs to the rooms after much disliked muddy games so she doesn’t get dumped into the mud.

“That said, winning back-to-back premierships in 2009 and 2010, then another flag in 2015 — they’re hard to beat. Playing my first final on my birthday in 2009 and actually winning it.”

As well as playing Wilson has also been involved in coaching at the Lions, both senior and junior sides.

She said whether it’s been with the seniors or juniors,ithasgivenherawholenewperspective on the game.

“It’s incredibly rewarding watching players grow in confidence, find their voice, and start to believe in themselves — especially the

younger ones. “I’ve helped even one player feel more at home in footy, then that’s something I’m really proud of.”

Wilsonhasnoplanstoretireandsaysshestill loves getting out there. With the Lions looking to form a women’s masters side next season, it’s set to continue her career even longer, even if her mum doesn’t like it.

“I always say I’ll keep playing as long as the body holds up — and as long as they’ll keep having me,” she said.

“I still love it — the people, the energy, the feeling of being part of something bigger than yourself.SoI’llkeepshowingupuntiltheboots walk off on their own ... or someone hides them from me.

“Maybe I’ll retire when mum finally gives me her blessing — but I wouldn’t hold your breath!”

Off field, Wilson also makes banners which she stresses about and loses sleep over but will never run through them.

Wilson was quick to thank her teammates and family who have been part of the journey.

The Bombers remain focused

It has been a strong start for Riddell in the Riddell District Netball League across the board.

The Bombers have just lost two of 15 games in the opening three rounds of the netball competition as they aim to build on last season.

Coach Emily Ktona said everything was going to plan early on.

“I’ve been super happy with the five teamsandhowwehavestarted,”shesaid. “We’re coming off a strong off season.

“Oneofourmainfocuseswasretention and we do that really well and kept lots of the same girls.

“There weren’t too many changes to the A-grade side. In the other sides we’ve had some players retire and some long term injuries.”

Bec Cowell is the big addition for the Bombers.

Ktona said they were looking for a high volume shooter and Colwell fills that perfectly, having scored more than 40 goals in her past two games.

“She knows the club already and knows some of the combos. She’s played with the Closes for a long time.

“There’s different midcourters feeding the ball to her and it’s come together the last couple of weeks.

“She fits in seamlessly and we are so happy.”

While Colwell has added some experience to the shooting end, the Bombers have blooded one of their next generation.

“I feel lucky to have shared the field with every one of them,“ she said. “Each of them taught me something — about footy, about resilience, about team — and they’ve all helped shape the player and person I am.

“I’d like to thank my amazing family. You’ve beentherefromdayone—throughtheinjuries, thewins,thelosses,themuddylaundryandthe last-minute banner panics.

“You’ve sat through freezing games, cheered when you had no idea what was happening, and somehow never told me to hang up the boots, except mum.”

Wilson would have liked for the milestone to go under the radar, but long time teammate Krystie Dudley has made sure she got her moment in the spotlight.

TherewereplentyofcelebrationsonSaturday.

“I’m usually happy flying under the radar, so havingthespotlightonmefeelsalittlestrange,” Wilson said.

“I feel incredibly lucky to be part of a group that backs each other in and makes these moments special.”

Tilly Allen, who is just 14, has made her A-grade debut. Ktona has coached Allen elsewhere, while Allen’s mum, Eliza Allen, has coached Ktona.

“WithSahara[Ball]outforthenational championships we needed someone to step up,” Ktona said. “She has done such an awesome job. She’s learning so much from the older girls.

“It’snicetorewardalocaljuniorplayer. We were down against Macedon and we put her on and she was important in the turnaround.”

After having four of their five teams in grand finals last season and A-grade just following short in the grand final, Ktona is hoping they can step it up further.

“The aim is to go one better in A-grade,” she said.

“We want to build on what we did last year.

“We want to take home all the grades.”

The Bombers were set to face Kyneton on Saturday after deadline.

Daniel Johnston. (Ljubica Vrankovic) 474081_08
Jaimee-lee Wilson. (Pictures: Supplied)

Bulldogs find a way to get the win over Hawks

Gisborne showed plenty of resolve to sneak home against Eaglehawk in the Bendigo Football League on Saturday.

After a five point win against Strathfieldsaye the previous week, the Bulldogs were again made to fight hard, this time against the Hawks.

With composure late in the final quarter, the Bulldogs were able to come away with a 13.6 (84)-12.10 (2) win.

Bulldogs skipper Jack Reaper said they were relieved to get the win.

“It was really nice to head up there and face Eaglehawk on their home ground,” he said.

“We were able to manage the minutes and produced the result in the end.”

Reapersaiditwasabackandforthgamewith bothsideshavingtheirtimetoshineinthesun.

He said it was a really competitive game with the Hawks having some big bodies.

The Bulldogs kicked the first couple of goals in the last quarter to open up a bit of a lead, before the two sides went goal for goal later in the quarter.

Reaper said early in the season they’ve had to play hard final quarter football, which will be important later in the season.

“We had our chance against South Bendigo and were five goals down and had to chase them,” he said.

“Thistimetheyweretheoneschasingandwe wereabletoputguysbehindtheball.That’stwo games we have won under two goals.

“It’s good to get the result and move to 3-1.”

Matthew Merrett, Pat McKenna and Shane Clough were named the Bulldogs best.

McKenna and Clough both returned to the side, from injury and Victorian Football League respectively.

Reaper said the pair make a huge difference

to the squad. He said it was pleasing to see Jacob Floreani come into the side on the wing and play a good role after starting the season in the reserves.

The Bulldogs face Castlemaine this Saturday before a break the following week.

Reaper said they were hoping to enter the week off with a 4-1 record, happy with where it was sitting so far.

“We know that Eaglehawk and South Bendigo are better teams than last season,” he said.

“We have two tough games to come and we have a few players go away in the middle of the year.

“We face Castlemaine at home. It would be nice to beat them and have a good win at home and be 4-1 at the bye.”

In netball, Gisborne beat Eaglehawk, 48-32. Tara

A shooting masterclass

Shooting 94 goals in a game was all in a day’s work for Sunbury Lions star Rebecca Hicks on Saturday in the Ballarat Netball League.

The star shooter put up a massive 94 goals as her side beat Ballarat 96-26 in one of the best shooting performances ever seen in the league.

Hicks had 98 shots for the game, missing just four, as she averaged more than a one and half goals a minute.

“It wasn’t my plan,” said a sore Hicks the following day. “I just show up every Saturday and all I want to do is just shoot to the best of my ability.

“To hit 94, I don’t think anyone has ever done that in a game. Pretty proud moment for myself and I think for the club as well.”

Hicks said she had no idea she was getting close to that 100 goal mark until the Lions footballers on the side started screaming at her about getting 100 goals.

Hicks’ previous best in the league was 84 goals when she was playing for Darley in 2023. She also scored 82 goals in a game that same season.

The performance came despite a back niggle and having played the night before.

“We’ve got a few players out with injury and some are away on holidays, so I’ve had to step in and play on Friday,” Hicks said.

“I shot atrociously on Friday, I didn’t play well. I knew on Saturday I had to back it up.”

Hicks said to score 96 goals as a team for the game was a massive result in itself.

The reigning premiers are undefeated after four rounds.

“We don’t expect to score that much,” she said. “We did have fill-ins, we had a B-grade goaler playing alongside myself.

“We then had to put Simmy [Simona Di Filippo] into goals to give her a break. I think for us, we just needed to win that game to keep ticking along.

“For me, I just had a good ball supply from our defenders and our middies. For us to score that much was to the credit of them.”

Chelsea Amor put up two goals from five attempts, while Di Filippo missed her three shots.

Hicks said Amor is an awesome goaler who listens, making it easy for Hicks to adapt to her.

“I don’t ask a lot of my goal attacks, just get the ball to me as fast as you can,” she said. “I’ll do the rest.”

For Hicks, much of her week is consumed by netball.

As well as playing for the Sunbury Lions, she coaches and plays at Glen Orden in the

Western Netball League.

She’s taken on playing when she can for Woodend-Hesket in the Riddell District Netball League, while playing in the state’s top competition, the Victorian Netball League with the Western Warriors.

Hicks said she had always wanted to play VNL and something that she had thought about the past few years.

“I have a family, I have three kids and it makes it hard to juggle,” she said. “They’re all playing netball as well.

“For me, it’s about having a good support system and my partner and our families to help out with the kids.

“That’s the only way it’s been made possible. If I didn’t have that support system, I wouldn’t be able to play as much netball and give VNL a good crack, I’m blessed to have that system behind me.”

Hicks said having the chance to match it with the best netballerS in the state in the VNL was a good challenge that she loved.

“The difference between VNL and footy-netball was so big,” she said. “The level of netball you play is unreal.

“It’s a bit of a reality check. Yes, I’m good at football-netball leagues but playing VNL has been a humbling experience.”

Sports shorts

VNL

The Western Warriors paid for lacking some polish against the Boroondara Express in the Victorian Netball League on Monday night. Coming off two straight wins, the Warriors never looked likely as they lost 61-43. Most of the damage was done in the second quarter, which the Warriors lost 17-8.

Ballarat NL

The Sunbury Lions had a day out against Ballarat in the Ballarat Netball League on Saturday afternoon. Undefeated, the Lions put out a dominant 96-26 win, shooting more than 20 goals in each quarter. Shooter Rebecca Hicks put up a massive 94 goals with just four misses in one of the biggest shooting totals the league has seen. The Lions are the only team to win its opening four matches.

EDFL

The Sunbury Kangaroos made it two wins in a row, as Rupertswood and East Sunbury both suffered losses in the Essendon District Football League division 2 competition. The Kangaroos led all day against the Northern Saints and were able to hold off a third quarter comeback to win 16.14 (110)-14.11 (95). Rupertswood suffered its first loss of the season, losing to Westmeadows as East Sunbury was thrashed by Glenroy. In the women’s division 2 competition, the Sunbury Lions beat East Sunbury, which as mutually parted ways with its coach, and the Kangaroos lost to Roxburgh Park.

Big V

It was a tough night for the Sunbury Jets in the Big V women’s championship on Saturday. The Jets were on the road against the Sherbrooke Suns and managed to get back into the game in the third quarter after a slow start. The comeback caught up with them as the Suns finished strongly to claim an 87-67 win. Emmonnie Henderson top scored with 18 points. The Jets sit in seventh spot.

Murray Pat McKenna returned to the side. (Ljubica Vrankovic) 420265_04
Rebecca Hicks. (Ljubica Vrankovic) 413382_15

Spoiling Mum on Mother’s Day

Custom Manufacturing is our Specialty. Many Designs, many beautiful Warwick fabric colour choices.

Huge Range of Mattresses, Bases, Bedheads, Bedframes, Blanket Boxes, Toppers, Pillows, Electric Blankets, Wool & Mink Blankets, Manchester, and “All things Bedding” on Display, and in Stock. Long Laybys are welcome.

Turn static files into dynamic content formats.

Create a flipbook