What began in 2010as an effort to provide200 sandwiches forhungry schoolchildren has evolved intoathriving community initiative.This year,Mothers That Care,together with Glitter,theGemini Gym Ladies and localsupporters, distributed 1022 Soup Jars of Hope.Theinitiativehas growntoprovide food, clothing,blankets,and beanies to crèches,schools, safe havens,and charities acrossBlouberg,Melkbos, TableView,Milnerton, Parklands,and Joe Slovo.
Anew study fromthe University of the Western Cape (UWC) has found the question “whydoesn’t she justleave?” misunderstands the lived reality of women trapped in abusive relationships. Researchers say leaving is often not an easy choice but acalculation betweencompeting dangers.
The research,published in the Social Sciences journal, was conducted by UWC’s Centre for Interdisciplinary StudiesofChildren, Family and Society. It draws on the experiences of 262 mothers,grandmothers, adolescents and practitioners from four communities: Cape Town,Saldanha Bay, Fisantekraal and a university student cohort. Participants from diverse backgrounds described similar experiences, pointing to patterns that cut acrossrace,class and geography.
The team, led by Prof Nicolette Roman and co-authored by Dr Chante Johannes and Shenaaz Wareley, developed a framework theycall the “distorted process of care” —a way of understanding how relationships that should offerlove, protection and support can instead become instruments of control, danger and entrapment.
Thefirst of five interconnected themes identified by the researchersiswhat they describe as “distorted care”. In many of the relationships studied, the pattern began with genuine affection before gradually shifting towards abuse. Emotional attachment, the researchers found,often blindedwomen to early warningsigns. Jealousy and controlling behaviour were misread as proof of devotion rather than danger signals. As gender roles, intergenerational violence, and substance abuse took hold, the caring foundation of arelationshipwas eroded.
“Care under constraint” is the second theme. For many women, staying was not asign of passivity but astrategy for survival. Asignificantnumber depended on theirpartner for basic necessities food, shelter, school fees. For mothers especially, thecalculus was agonising: leaving could mean losing the family’s only income.The wellbeing of children was consistently prioritised over a woman’s own safety.
The third theme, “silence of care”, spoke to theisolationthatabuse breeds. Fear of judgement, deep shame,and repeated disappointmentsfrom the institutions meant to help left manywithdrawn and silent.Over time, many stopped seekinghelp altogether. Some women, however,did eventually reach apoint theresearcherscall “reclaiming care”. In thesecases, womenchose their own safety, drewstrengthfrom faith or community,
and worked to prevent their children from inheriting the cycle of violence.
ASYSTEMTHATFAILS
Thefifthand final theme, “structural failure”, places responsibilityonthe families, communities and institutions around women in crisis. Police, social services and government departments, the study found, often retraumatised women rather than protecting them. Crime, gangsterism and poverty in marginalised communities further narrowed the options for seeking help. Families wereoften too financially stretched to offer refuge.
Thedanger of leaving was not abstract for many. Women who tried to separate from theirpartners reported being followed, assaulted or fearing for their lives.The researchers argue, the decision to stay was often rational based on immediaterisk
Gender roles reinforced the cycle. Women bore the bulk of childcare and household responsibilities while abusive partners remained absent from family life. Children growing up in violent homes were found to be at greater risk of the cycle continuing. Substance abuse, the study noted, intensified both the frequency and severity of violence and fear
Theresearchers are unambiguous about what their findings mean for how genderbased violence is addressed in South Africa, where GBVremains anational crisis affecting women across every community and class. They argue that current approaches, which tend to focus on individual women and crisis responses, are structurally limited.
“For policy, the implications of this framework are uncomfortable but necessary,”the authors state.
“GBV cannot be addressed through individualised, crisis-response models alone. Interventions that focus solely on the individual, such as counselling, shelters and legal protection, without addressing the material and institutional conditions that make remaining in abusive situations appear rational, are likely to remain insufficient.”
Theresearchers are calling for a fundamental shift in how gender-based violence is understood and tackled in SouthAfrica. Rather than placing the burden on individual survivors to leave, the focus must shift to creating the conditions that make safetyareal possibility for everyone.
KAILINDANIELS
KAILIN.DANIELS@NOVUSMEDIA.CO.ZA
The proposed Table View Community Improvement District (TVCID) has moved into itsnext phase after an Urban Management Survey among property owners exceeded the legal response threshold required by the City of Cape Town.
The survey received 2948 responses from 12 800 unique propertyowners, achieving a response rate of 23.04% —above the required minimum of 20%.
The TVCID Steering Committee said the results represent a valid reflection of community sentiment and will guide the futurepriorities and budget planning of the proposed district.
Property owners wereasked to
identify theirbiggest concerns across five categories: safety, cleansing,infrastructure, sustainabilityand social responsibility.
Acrossall five categories, vagrancy andhomelessness emerged as themost significant concern.
Other issues raised included public safety andcrime,illegal dumping,littering, deteriorating parks andpublicspaces, insufficient street lighting, limited CCTV coverage anda lack of visible lawenforcement.
The Steering Committeesaid thesurvey results would directly influence the structure of the proposedCID’s services
The proposed TVCID covers
Table View and surrounding areas,includingTable View, Parklands Phase1Aand 1B, Waves Edge, the areasouth of Porterfield Road and Marine Circle.
Theproposeddistrictaims to focus on fourkey areas:improved public safety, enhanced cleansing services, environmental andurban maintenance,and social and economicdevelopment.
Planned safety measures include 24-hour patrol services, dedicatedCity Law Enforcement officers,expanded CCTV
coverageand increased control room monitoring.
The Steering Committee said cleansing initiatives would focus on litterhotspots, illegal dumping and maintaining public areas.
While the survey showed support for further investigation into establishing aCID, property owners also outlined conditions for their support
The Steering Committee said residents want measurable improvements, value for money, affordable additional rates, transparent governance and regular reporting.
“The Steering Committee acknowledges theseconditions and accepts them as the standard againstwhich the proposed CID must be measured,” it said.
The next phase will include
finalising adetailed budget proposal, forming property owner focus groups, hosting public information sessions and continuing engagement with residentsand stakeholders.
Aformal ballot will then take place, with at least 60% plus one of participating property owners required to vote in favour before an application can be submitted for approval.
Afinal budget has not yet been determined, with affordability remaining akey consideration.
TheSteering Committee said its goal is to ensure property owners have enough information to make an informed decision when the formal vote takes place. Residentswill receive further communication in the coming weeks.
TheCity of Cape Town has warnedmotorists not to fall for ascam in which fraudsters send SMS messages claiming road users have unpaid parking fees and must clickona link to settle thebalance.
According to the City’s Urban Mobility Directorate scammers sendmessages via SMSbut may also use other platforms such as email and WhatsApp. One of the common messagesreads ‘’Action required:Your parking fee
remains unpaid. Please settle the balance immediately...’’
PARKINGMARSHALLS
The City says the only way to pay foron-street parking is directly to the parkingmarshal at thetimeofparking. It does not send SMS, email or WhatsApp messages requestingpayment for parking fees
Motorists are advisednot to confusethese fraudulent messageswithlegitimate
notificationsabout outstanding traffic fines. TheCity does send reminders to motorists with outstanding fines registered in theirnames, whichcontain alinktoview fines at www. cityofctviewfines.co.za.
HOWTOVERIFY
Anyone with concerns aboutan outstanding parking fee should not respond to themessage or click on any links, butcontact theCity’s Transport Information
Centre on 0800 65 64 63 or transport.info@capetown.gov.za for assistance.
‘’Residents and visitors should remain vigilant and avoid clickingonlinksinunsolicited messages claiming that parking fees areoutstanding,’’ said Mayco member for Urban MobilityRob Quintas.
“If in doubt, contact the City directly through the Transport Information Centre for verification. The City does not
request payment for parking fees through SMS, email or WhatsApp messages.”
TheCitycharges parking fees for on-street parking bays in designated areas across Cape Town, particularly in central business districts and areas where demand for parking is high. According to the City this prevents any one motorist from occupying aspace for extended periods, ensuring fair access to parking for all road users.
Traffic around Table View and Killarney Gardens was severely disrupted on Monday 27 July after aMyCiTi bus caught alight at the MyCiTi bus station in Killarney. The bus station itself, close to the intersection with SilverstoneRoad, was alsoengulfed in flames, causing major infrastructure damage.
Ward councillor Suevan der Linde shared apicture of the burning buson her social media page, urging motorists to avoid the area. Traffic was disrupted on Koeberg, Potsdam and Blaauwbergroads. Trafficonthe nearbyGie Road wasalso affected.
Smoke was seen billowing kilometres away, while fire engines responding to the incident approached down GieRoad. The City’s urban mobility directorate said in astatement that an investigation into the cause of the fireisunderway. The bus has been destroyed and thereis extensive damage to the station thatwill remain closed untilfurther notice, the
directorate said. No injurieswerereported. The fire was reported shortly before 09:00. Fire services assisted in putting outthe fire, and traffic was diverted.
“I’ve been told thatthe bus driver heard an unusual sound when he arrivedat the station.The next moment, he noticed smoke comingfrom thefront of thebus. Thankfully, all the passengers andthe staff weresafely evacuated before it got worse,” saidRob Quintas, Maycomember forurbanmobility.
He saidtheywere notified thata protest happened further down PotsdamRoad afew minutes before the incident,and thatthere is an investigation underway todeterminethe cause of the fire,and whether there are anylinks to theprotest. The matter has also been reported to the
police,Quintassaid.
“This incident will have amajor impact on the commuters who make use of the Killarney station,” said Quintas.
DESIRÉERORKE
DESIREE.RORKE@TYGERBURGER.CO.ZA
The Western CapeHigh Courtlast Wednesdaysentenced the accused,a 49-year-old man from Kraaifontein, to life imprisonment for the rapeofDaniel Jamneckand life imprisonment for his murder on 15 June 2023.
He was further sentenced to 10 years’ imprisonment for the rape of aBrackenfell woman in 2005, and eight years imprisonment for the sexualassaultof Daniel.
Action Society welcomed the sentencing of the child predator responsible for the rape and murder of eight-year-old Daniel, saying justicehas finally been servedfor alittle boy whose life was brutally stolen.
The organisation, however, says its work is far from over and will continue to pursue accountabilityfor the systemic failures thatallowed adangerous repeat sexual offender to remain free despite his violentcriminal history
The court also ordered that the accused be enteredonthe National Register for Sex Offenders, permanently prohibited him from working withchildren, prohibited him from possessing afirearm, andruled that both Maria Jamneck and the rape survivor be entitled to make representations to the Parole Board should he everbecome eligible for parole.
“Today’s proceedings weremarked by a powerful moment of solidarity as Daniel’s mother, Maria Jamneck, andthe other rape survivor held hands in court asthey awaited sentence,” says Juanita du Preez, Action Society’s head of operations.
“Two women whose lives had been forever changed by the sameoffender
stoodtogetherinsupport of oneanother as justice was finally delivered.”
‘ABSOLUTELIGHT’
Earlier in the week, the court heard Maria’s victim impact statement, in which she describedDaniel as “our absolute light”, acompassionate little boywho loved nature,dreamedofbecominga veterinarian, and adored his younger sister.
She also spoke of thedevastating trauma that continues to affect her family every daysince Daniel’s murder.
“Today’ssentencebrings justicefor Daniel and recognises the immense suffering enduredbyMaria, andeveryone whoselives have been shattered by this monster,” says Du Preez,
“Justice hasfinally been served. But we will continueour fight to expose the failures within the criminal justice system thatallowed this accused to remain free andcontinue his crime spree, ultimately ending in Daniel’s death.”
“South Africansdeserve ajusticesystem thatidentifies dangerous repeat offenders, acts decisively and protects innocent lives before anotherfamily hastoendure this kind of unimaginable loss.”
JUSTICESERVEDBUTQUESTIONSREMAIN
Action Societyaccepted amandateto supportDaniel’s family after it emerged thatthe accusedhad previously been convicted of rape, later absconded from a court-ordered rehabilitation programme, andsubsequently faced another attempted rape chargethatwas withdrawn before Daniel wasraped andmurdered.
“The organisation will continue pursuing accountability for the institutional failures that allowed these warning signs to go
unaddressed. While today’s sentence closes onechapter in Daniel’scase, Action Society says thebroader fight for systemic accountabilityisonlybeginning,”says Du Preez.
On 15 June2023, during asleepover at his friend’s,Danielwas found dead in the bedofhis friend’s father, the accused, during theearly hours. The accused was takenintocustody soon after. The original murder charge was broadened to include rape and sexualassault once post-mortem results were concluded. Despiteprotesting hisinnocencethroughout theproceedings, theaccused facedoverwhelming evidence, including testimonyfrom his own son.
ANOTHERRAPE
It latercame to light that the convicted man had in 2007 entered into aplea agreementwith the NPAregarding the 2005 crime where the Brackenfell woman, then 22, wasdruggedand sexually assaulted.
A38-year-old mother of three told TygerBurger Daniel’s tragicdeath could havebeen prevented, hadher case not fallenthrough the cracksofthe justice system 18 years ago.
During an interview with the newspaper in 2023, the woman recounted being at a
gathering where the accused had bought her adrink
She recalled little of the evening beyond flashbacks of dizziness and leaning against awall outside before he offered to drive her home. After another friend was dropped off, she remembered nothing until waking the next morning on acouch in his aunt’shouse, her clothes dishevelled and no memory of the night before. Disoriented, she spent the day trying to piece events together beforeaconcerned friend persuaded her to go to the police. While she was at the police station, the accused arrived to hand himself over and confessed. He was arrested and released on bail the following Monday. Thecase dragged on for more than two years. In 2007, while pregnant with her first son, she was summoned by the prosecutor. The accused’s lawyer warned her the case would come down to “he says, she says” and that she would be ripped apartin court.
Intimidated, she agreed to withdraw the charges on condition the offence went on his record and he completed adiversion programme for sexual offenders. If he failed to complete the programme, the charges would be reinstated. However, this never happened without her knowledge. It later emerged at the bailhearing for Daniel’smurder that the accused had absconded from the programme after only four sessions.
Thecase has stirred profound grief far beyond the courtroom walls whereagroup called Justice for Daniel Jamneck formed who followed the proceedings, with one simple purpose, to ensure that his story is never forgotten.
RICHARDROBERTS
RICHARD.ROBERTS@NOVUSMEDIA.CO.ZA
Die Bothasig-gemeenskapspolisiëringforum (GPF) het die inhegtenisneming van'n29-jarige man en beslaglegging op R10 miljoen se dwelms die afgelope week verwelkom.
DieWes-Kaapse polisiese misdaadintelligensie-eenheid het Sondag 19 Julie by 'n woonstel in Sylviastraat in dieDeZicht-woonstelkompleks in Richwood toegeslaan, waar hulle optalle vuurwapens, dwelms en ammunisie beslag gelê het. Een verdagte is op die toneel in hegtenis geneem.
Die GPF het die polisie se misdaadintelligensie- en teenbendeeenheid geprysvir diewerk wat gedoen is en ook almal watbydie intelligensiegedrewe operasie betrokke was
SUKSES
"Die vonds van sewe onwettige vuurwapens, meer as 'n duisend patrone en dwelms met 'n straatwaarde van R10 miljoen, is 'n reuseprestasie.
"Hierdie soort operasies stel inwoners gerus dat intelligensie-gedrewe polisiëring vrugte afwerp. Hoewel een inhegtenisneming alleennie georganiseerde misdaaduitroeinie, demonstreerdit dat wetstoepassing misdadige netwerke ontwrigendat dit gevaarlike wapens uitons gemeenskappe verwyder," sê Mario Borchards, GPFvoorsitter.
Hy sê die gemeenskap se vertroue groei wanneer inwoners sigbare optrede, professionele ondersoeke en 'n suksesvolle uitkoms soos hierdieself gewaar.
"Bendeverwante misdaad strek veel verder as net na dié wat daarby betrokke is. Dit raak families, ondernemings, en die breë gemeenskap. Ondernemings ly
asgevolg vandiefstal, intimidasie,en toenemende sekuriteitskostes, terwyl inwoners in vrees en onsekerheid leef Onwettigevuurwapens en dwelms spoor geweld aanwat na enige buurt kan oorvloei."
Borchards sê hoewel Bothasig oor die algemeen as 'n veilige gemeenskap geag word, is dit nie geïsoleer van georganiseerde misdaad oor Kaapstad heen nie. "Hierdie inhegtenisneming dien as ‘n herinnering dat misdadige netwerkehulself enigeplek kan vestigas gemeenskappe te gemaklik raak."
Hy sê die sukses deur die polisie beklemtoon die belangrikheid van intelligensiegedrewe polisiëring, maar voeg by datlangtermynsukses 'n vennootskap tussen die polisie en die gemeenskap verg.
VEILIGHEID
Borchards sê daarvoor benodig hul gemeenskap:
. Intelligensiegedrewe ondersoeke;
. Hoësigbaarheid-polisiëring en geteikende optredes;
. Goeie samewerking tussen die polisie, die Stad Kaapstad, buurtwagte, private sekerheidsmaatskappye en die GPF;
. Inwoners wat verdagte aktiwiteite aanmeld;
. Belegging in misdaadvoorkomingstegnologie soos kringtelevisie-kameras in geïdentifiseerde brandpuntgebiede.
Misdaadvoorkoming is almal se verantwoordelikheid, sê Borchards "Die gemeenskapsebereidwilligheid om verdagte aktiwiteite aan te meld, verskaf dikwels die intelligensie wat tot hierdie soortsuksesvolle optredes lei."
"Die ondersoek is steeds aan die gang, so ek wil nie bespiegeloor sake voor die hof
nie. Wat ek wel kan sê, is dat dié optrede die waarde van intelligensiegedrewe polisiëring, en die sterk vennootskap tussen wetstoepassers en die gemeenskap beklemtoon."
Die29-jarige verdagte word steeds aangehou. Hy het op 20 Julie in die hof verskyn en verskyn weer op Woensdag 29 Julie in die Goodwood-landdroshof vir 'n borgtogaansoek
"Ten slotte wens die GPF die polisie gelukmet die belangrike deurbraak. Ons moedig inwoners aan om bedag te wees,enomaan te houomverdagte gedrag aan te meld, en ook om gemeenskapsveiligheidsinisiatiewe te steun. Saam, deur sterk vennootskappe en aktiewe gemeenskapsdeelname, kan ons ons gemeenskapveiliger vir almal maak."
VONDS
Kapt.Frederickvan Wyk, provinsiale polisiewoordvoerder, sê die woonstel is glo as 'n bergplek gebruik. Hy sê altesame sewe ongelisenseerde 9mm-pistole en 17 magasyne,sowelas1030 verskillende kaliberpatroneen'nverskeidenheid soortedwelms, is gevindenbeslag daarop gelê
DieWes-Kaapsedepartement van polisieoorsig en gemeenskapsveiligheid het ook die polisie —spesifiek die misdaadintelligensie-eenheid en teenbende-eenheid —vir die beslaglegging geprys. Deur die sleutelbergplek te sluit, het wetstoepassingbeamptes plaaslike bendesindikate wat in die metro werksaam is, 'n knou toegedien. Die departement
spoor die polisie aan om hiermee voort te gaan, en meer geteikende, misdaadintelligensiegedrewe optredes oor hoërisiko gebiede in die provinsieheen uit te brei, sê Anroux Marais, minister van polisie-oorsig en gemeenskapsveiligheid. Marais het die polisie geloof vir hul waarneming, wat daartoe gelei het dat R10miljoen se gevaarlike dwelms, sewe onwettige vuurwapens en meer as 1000 patrone van die strateverwyder is. "Elke onwettige vuurwapen waarop beslag gelê word, is moontlik 'n lewe wat gered word, en dwelms wat vernietig word, verminder die greep wat bendes op ons gemeenskappe het. Die indrukwekkende klopjag demonstreer die krag van intelligensiegedrewe polisiëring. Ek moedig die polisie aan om voort te gaan met deurlopende, geteikende optredes wat misdadige netwerke ontwrig, bendes se vestings ontbind. Dit verseker dat diegene wat ons inwoners terroriseer,die volle mag van die reg in die gesigstaar."
South Africa’s economic debate is focused in the wrong place, says Deon van Zyl, chair of the Western Cape Property Development Forum.Writing in an op-edfollowing the conclusionof the forum’s annual conference, which drew record-breaking attendance in Cape Town recently,Van Zyl argues thatthe conversation needs to shift.
“We speak endlessly about national policy, cabinet reshuffles, the GNU, fiscal reformand presidential initiatives. But we overlook thesingle institution that ultimately determines whether investment happens, jobs are created and infrastructure is delivered. South Africa does not have anational growth problem; it has alocal government problem.”
Thisstatement reflects an uncomfortable reality, Van Zyl says.
He says every investment whether a factory, shopping centre, housing estate,
hospital, school or logisticshub, happens within amunicipality. Every square metre oflandfalls within amunicipalboundary, andevery planning approval, engineering service, electricityconnection, water supply and road ultimately depend on the effectiveness of local government. Before growthhappens in South Africa, he said, it happens in amunicipality.
He referstoNational Treasury’s recent decisiontowithhold R13,5 billion in equitable share allocations from 69 municipalities, sayingitshould be viewed as far morethanafinancial intervention.
“It is anacknowledgement that the country’s economic future cannot be separated from thehealth of its municipalities. More than onequarter of municipalities failed to meet acceptable financialstandards. That is notmerely an administrative failure; it represents a direct threat to investment confidenceand
economicgrowth.”
“When municipalities function well, they become platforms for investment. They shortenapproval times, maintain infrastructure,expand bulkservices and provide certainty to investors. When they fail, projects are delayed, costs escalate, businessesrelocateand communities lose opportunities. Investors rarely distinguish between local government failure and South Africa as an investment destination; they simply experiencerisk,” he says.
Van Zyl said the Constitution recognised thestrategic importance of municipalities by creating threespheres of government rather thanahierarchy.They were intended to be developmental institutions with meaningful responsibilityfor growing local economies.
“Yet over time, fiscal centralisation
has weakened that vision. Municipalities carry enormous delivery responsibilities while remaining heavily dependent on national transfers and increasingly constrained by central oversight. We should stop treating municipalities merely as service providers. They are economic institutions. Their primary purpose should be to create the conditions in which private investment, entrepreneurshipand infrastructure can flourish.”
This, he says, requires adifferent approach: “We should rebuild technical excellence by restoring strong engineering capacity, empowering professional planners and expecting municipal Chief Financial Officers to become strategic asset managers rather than simply compliance officers. We should reward municipalities that grow theireconomies, expand theirtax base and deliver infrastructure.”
KAILINDANIELS
KAILIN.DANIELS@NOVUSMEDIA.CO.ZA
More than 70 volunteers gathered at Lagoon Beach in Milnerton lastweek to help protect the coastline during acommunity cleanup that removed an incredible 413kgof litter from the shore.
The initiative, organised by Save a Fishie,brought together learners,parents andteachers fromCBC St John’s College, along with regular volunteers and new supporters who spent their Saturday morning making adifference.
Save aFishie founder Zoe Prinsloo said the amount of waste collected was a
heartbreaking reminderofthe ongoing challengefacinglocal beaches.
“Whatanincredible morning at our Lagoon Beach,Milnerton cleanup. We were joined by more than70amazing volunteers,including learners, parents andteachers from CBC St John’s College, along with our favourite regulars and some wonderful new faces,” said Prinsloo. She said every helping hand was needed,
with volunteers discovering large amounts of litterwashedupalong the beach.
Among theitems collected were clothing, bags, lollipop sticks, earbud sticks, straws, shoes,plastic bottles, atyre and even a 60kg piece of couch.
Prinsloo highlightedconcerns about thenumber of nappiesfound during the cleanup, saying brands such as Huggies, Pampers and Cherubs featured among the waste collected.
Shecalledoncompanies to become more involvedinsupporting environmental initiatives andbeach cleanups
Adding aspecial touch to the morning was Terry theTurtle, who joined volunteersand helped spread the message of protecting marine life andkeeping beaches clean.
The mascot was afavourite among younger participants, posing for photographsand encouraging children to learn more about theimportance of caring for theocean.
“Everycleanup makes adifference,” said Prinsloo. “Thank you to everyone whocontinues to showup, care for our environment,and inspire others to do the same.”
The cleanupwas supported by Plastics SA, whichprovided strong yellow collection bags, andaQuellé,which donated watertokeep volunteers hydrated.
One of the heaviest bags collected weighed an impressive 24kg, highlighting thescaleofthe pollution removed from thecoastline.
Prinsloo thanked all volunteers for
giving their time and helping create a cleaner, healthier environment for both people and marine life.
“Together, we removed an incredible 413kg of litter from our coastline,” she said, adding that she hoped the cleanup would inspire more residentstotake action and continue protecting beaches.
Severalweeksfromnow,I willnolongersee anyof the familiar facesofthe strangers I’vebecome used to traveling with on the bus.
Idon’t knowasingleone of their names but their quirksare so familiar to me now, theyfeel like friends —albeitfriends Iknowonlybysight
Introverts like me arenot good at making friends, unlikemymom, God rest her soul, who made adozen newfriends on everybus within minutes of boarding. I, however, prefer to observefromafar. So,I will miss seeing which snappy, colourfully patternedsuitone particular fellow commuter always dons.
Iwillmiss noticing howthe man with the bleach blondeafri bears an odd resemblancetothe shepherd in Shaun the Sheep
Iwillmiss the deeplypersonal and one-sided chatterbetween oneyoung woman —who doesn’t seem to realisethat not everyone in the bus is wearing headphones —and her friend.
As of 1September,I’llbetaking adifferentbus when our officesmove and earlythisweek,the biggest pang hit when the samoosa man boarded.I atemy warm, freshly-fried-at-the-taxi-rank samoosassadly, knowing therewouldn’t be anyonmynew commute becausethere’snoeating allowedonMyCiTibuses.
‘DON’TBESHYTOBUY. TOMORROWYOU’LLCRY BECAUSEYOUDIDN’TBUYFROM THERIGHTGUY.’
When MyCiTi rolled out morethana dozenyears ago, with strictlyenforcedrules, one of my colleague’s first questions was: "What about the people that sell thingsonthe bus?"
Regularpublic transport commutersknowthere are some staples that come with everycommute. Igrew up on trains whereanentire carriage wasdedicated to praiseand worship.Further down the tracks there wouldusually be another carriage wherea group played klawerjas everyday
Taxis have their ownform of entertainment.Last week when my carwas broken, Itooka taxi to some of my stories and wassurprised whenone elderlydriver, whom allthe passengers greeted by name,rocked a CD of old-school 90s club classics —a playlist Irecognisedsinceithad been in rotationsincethe last time regularlytook ataxitowork in 1998
Thetravelling-by-bus-quirksonthe other hand came with the informal vendors, who walkedfrombus to bus with abox of snacks, and clever rhyme "Don’t be shytobuy.Tomorrow you’ll crybecause youdidn’t buy from the right guy."
When MyCiTilaunched about adozenorsoyears ago, it gleamed anditflew,but it lacked the colourful character of traditional commutes
When the municipality startedtrumpeting itsdesire to take overthe rail system, Iclutched my cheapbeaded necklace in alarm. In my decadesofjournalism, Ihavenoticed one consistent trend:the Cape Town Municipality likestogentrify
Public transport is howmillions of the city’sworkers gettotheir jobs—but not by choice. Most wouldlove to work closertowheretheylive, but commuting long distances has become such anorm forthose whohad beencondemned to the outskirts of the citythat most don’t bataneye at sitting forfour hours on abus in trafficdailyorgetting up at 04:00 to catcha train at 05:00 to reach work by 09:00.
When the Citypromised easiercommutes with fancy buses and dedicatedlanes,mostpeoplerejoiced, but onlyafraction of regularcommuters couldafford it in theend. Thelast time Itook aMyCiTibus, about eightyears ago, it wasconsiderablymoreexpensive than Golden Arrow.I don’t knowhow it comparesnow but I’ll find out soon.
Yes, MyCiTicovers routes previouslyservedonlysporadically by taxis —ornot at all. Yes, it is convenient, quickand safe —but it also charges accordingly I’m not saying we don’t want or need safe and efficient public transport,but what we definitely don’t need is having those vital services out of ourreach due to their cost
If the Cityissuccessful in its bidtotakeoverthe metrotrains, will the cheapestmode oftransport be made unaffordable forthose who need it most?I sincerelyhope not -LAUREN O’CONNOR-MAY
OOIUITSIG: Besoeker va iebeek asteel verwonder haar aan die uitsig vanuit bewegende trein tusse uizenbergenSimonstad aapstad se mees ikoniese treinroete watplaaslike en internasionalebesoekers tenminsteeen keer in‘n leeftydmoet ervaar,volgens die leserwat hierdie foto ingestuur het
FOTO:MARIUSSNYDERS
Hierdie afgelope paar weke hetdie Kaap weer bloed op ons paaiegesien,enniemandlyk omgekrap nie.
'n Pa het verbrandtoe 'n taxi vanagter af in sy stilstaande motor vasgeryhet.'nVrouisdeur'nGolden Arrow-bus indie middestad doodgerytoe sy die straat wouoorsteek
Opdie R45 buiteFranschhoek het'nbakkie en 'n vragmotor regvan voor gebots, met tweemense dood en 30 beseerdes.
En Bottelaryweg, 'n padwat lankal as 'n dodelike padgebrandmerk is, hetnog 'n lewe geëis.
Ditisnie ongelukke nie; dit is mislukkings —mislukkingsvan verkeershandhawing, en ook basiese menslikeoordeel.
Hoeveel meergesinne moet rouvoor onsaanvaar dat daar 'n krisisheers?
Taxibestuurders ry oor rooi ligtesonder gevolge.
Voetgangers sterf weekliks
Spoedbeperkings is voorstelle,nie reëlsnie.Tog is daar netstilte vandie owerhede —geen padveiligheidsveldtogte, geen sigbareafdwing vanpadreëlsnie geen dringendheid nie
Die pa vanBlackheath hettweekinders agtergelaat Die vrou in die middestad wasiemandsema, iemand se dogter. Hulle wasoppad huis toe, ná werk, na die alledaagseplekkewaarheen onsalmal gaan sonder om te wonderofons salterugkeer Watons nodighet,isdaadwerklike aanspreeklikheid, bestuurders watweet dat roekeloosheid gevolgehet,en'nStadwat waarde heg aan elkelewe watopsypaaie verloor word
Hoeveel name moet nógopkruisies langsons paaie verskyn?
BESORGDE INWONER, Kraaifontein
Durbanville boer nou vinnigagteruit metsinkhok by
Jare gelede,toe onsnog jonkenmooi was, wasdinge baie andersinons dorp
Vandagisons netmooi, maar helaas,ons dorp is nie altydmeersomooi nie
Deur diejarehet Durbanville heelwatvan sy karakteringeboet weensdie ongebreidelde ontwikkelingen verdigting daarmee saam.
En toe, in die laat jaresewentig en vroeë tagtig ontstaan diebus-entaxistaanplek in die hartjie van diedorp met alles(lees: rommel en lawaai)wat daarmee gepaardgaan.Endie busseentaxi's raak by diedag meer
Helaas is die rangeerwerf onlangsomhein en lykdit nou nes'n skaapkamp in die Karoo.
En raai wat? Netverlede week komeen of ander karakterenbou vir hom'nsinkhok teen die heining waar hy nou heerlik gratis vryenverniet kanwoon
Sommer 'n prima ligging, soueksê, so lekker naby
diewinkels,die kerk,skole en als. Onmiddellikroep dit herinneringsopaan die armoedigetentplaas watindie inperkingstyd rondom 2021 op die veld voor die Anglikaanse kerk ontstaan het. En hoemoeilik dit wasomdit te (laat) verwyder Niks minder nieas'nhofbevelwas daarvoor nodig. Nouwonder ek net, gaan onsbinnekort ook 'n blikkiesdorp in die hartjie vandie dorp hê as nóg mensesinkhokkies teen die taxistaanplek se heining komoprig?
Volgensmyinformanthet wetstoepassers welmet 'n vloot voertuie opgeruk om die mensehokkie en al te probeer verwyder.Maar helaas,teen Maandagwas dit steeds daar
As onsasinwoners niewaak oordie karaktervan ons dorp nie, gaan niemandanders dit doen nie Ons hetregtig nie'nDunoon in onsdorp nodig nie! ANTI-BLIK, Goedemoed
Queuing at collectionpoints, bucket baths, gardens turned to dust,and the collectiveanxietyofacitystaring intothe abyssofanemptytap.Wevowed neverto letithappen again
And yet, hereweare,watching the PacificOcean warm, with climatescientists warning of apotential Super El Niñobuilding forlatethis year
Yes, the experts arequick to point outthatElNiño’s grip on the WesternCape’s winter rainfallisweaker than its hold on the summerrainfall regions of the country. Ourdams sit at acomfortable79%.
But comfort is adangerous companion. The same scientists who urge cautionalsoacknowledge uncertainty, anduncertainty, when it comestowater security, is notaluxury Cape Town canafford. DayZerowas notcausedbyasingle drywinter.It wasthe culmination of years of complacency, ignored warningsand sluggish infrastructureinvestment
We congratulatedourselves on dodging the bullet in 2018,pattedeachother on the back forcutting consumption, andthen quietlyslipped back intoold habits.
Swimming poolswererefilled. Lawns were replanted. Carwashes resumed. Thebrief, beautiful discipline of acityunder siegewas forgottenasquickly as it was born.
An El Niñoneed notdeliver aknockoutblowtoour watersupply. It need only deliver awarmer,drier summerthanexpected, combined with higher evaporation ratesand the inevitablesurge in demandthatcomes with heat
We need to rememberwhatwelearned the hard way. Everydropsaved todayisa drop availabletomorrow. Theshowertimer,the bucketinthe sink, the grey wateronthe garden, andtheseare notrelics of acrisis past.Theyare the habits of acitythatknows what it stands to lose
CONCERNED RESIDENT,Durbanville
Balancing aPhD in pharmaceutical sciences withcompetitive chess is no smallfeat, but try doing so and winning adivision in anational chess championship.
University of the WesternCape (UWC) PhDstudent, 25-year-old Harrison Abrahams from Parow, succeeded in achieving exactly that.Harrison captured theSouth African Open Chess Championships IntermediateSection, hosted from 27 June to 5July2026, scoring an impressive eight points from nine rounds.
The Intermediate Section wasfiercely contested, with thetop five finishers separated by razor-thin margins Abrahamssecured first place outright, while his four competitors, Kopa Lesetedi, Andile Siyali, Christian Maxwell, and Karl Freeks, rounded out the second through fifth spots after atense tiebreak.
For Abrahams, the victory is atestament to his ability to balancetwo demanding worlds. While he is knownasaformidable chessplayer who competes regularly, he is also deep into his PhD studies in pharmaceutical sciences, focusing on nanomedicine and tuberculosis treatment. Reflecting on his tournament success, Abrahams described his mindset as calm yet focused.
“I had astrategy, but Ialsoreminded myself to enjoy the game. That balance made all the difference. My mindset was simply to play good chess and ensureI was well-rested and focused. Idid nottry goingfor tricks and played solidly and Ihonestly did not expect to win. Ikept that fantasy of winning out ofmymind completely, and focused on one game ata time. And it all worked out,” he said. “In chess, you calculate different possibilities andevaluatecriticallywhat the right plan is. That analytical and criticalthinking is readily transferable to doinga PhD. Ihave
to question my thoughtprocesses and research toensure they are robust enough to help treat tuberculosis.”
Curiosity is another factor in Abrahams’s success: “Chess and nanomedicine both explore new avenues to solve the problems at hand, andbeing open to new ideas is key to nanomedicine andchess ”
When askedabouthis routine, Abrahams saidchess is away to recharge.But stopping at the campusoutdoor chess boards is never atemptation for him. He much prefers his break from the intensity of research, playingonline, mostly as a brief 10-minute distraction andconnecting withothers through chess tournaments
“I started my chess journey when Iwas aboutseven years old. My uncle played againstmeand beat me.Hetaughtme the basics andIremember losing almost every gameatfirst, but Iwas hooked. That inspired me to improve my chess skills until Icould beat him,” he joked. “Later, Iplayed casually in primary andhigh school,and I, strangely enough, stopped playing chess during the pandemic and restarteditwhenI returned to UWC for mymaster’sdegree in 2024, this time taking it very seriously.”
And justlike that, the result becomes crystal clear: asingle move can transform theentire game.Patience, foresight, and adaptabilityare the keys that unlock a decisive checkmate.
aUniversity of theWestern Cape (UWC) study has foundthatmanySouth Africans decide what to put on their dinner table basedonaffordability, household needsand what is available rather than nutritional value.
The study examined food choices in Worcesterinthe WesternCape, Stutterheim in the Eastern Cape and EsikhawiniinKwaZulu-Natal.
HEALTHMATTERS,BUTOFTENCOMESSECOND
The study, published in the South African Journal of Clinical Nutrition, involvedalmost 70 adults. Many participants were unemployed or depended on social grants.
Researchers,including UWC dietetics and nutrition lecturer Dr Nazeeia Sayedand department head Prof Rina Swart, found that participants generally understood the benefitsofhealthy eating. However,health wasseldom thedeciding factor when food was bought.
Peopleweighed health considerations againstprice, convenience, transport costs and thedistancetoshops.
One participantdescribed the realityof householdbudgeting: “Inour household we do not just buy food. Rather, we check thepriceofeach food itemfirst to see how much it costs.”
Household members alsoplayed amajor role in food decisions. Participants often chosemealsthatwould satisfy children, partnersand otherrelatives, while ensuringeveryonehad enough to eat.
Healthyalternativeswere sometimes overlooked if they were considered too expensive,unfamiliar or unlikely to appeal to the whole family.
Participantsidentified whole grains, fruit,vegetables, legumes, lean protein and minimally processed foodsashealthy. Friedfoods,sugary drinks, fast food, refinedcarbohydrates andproductshigh in fat andsalt were generally viewed as unhealthy.
Some healthyoptions, including leafy vegetables, legumes andchicken liver, were avoidedbecause people were unsure how to prepare them in an appealing way.
Promotions andadvertising also affected purchasing decisions. Price-conscious consumers said they relied on specials and comparedprices weekly or monthly, dependingontheir income.
“We watchthe specials, we live on specials,”one participant said. “We compareitmonthly or weekly, depending on what our income is.”
Cookingathome was viewed as cheaper than buyingready-made meals. Shops closetohome or work were also preferred because they reduced transport expenses.
Snacksand treats,including yoghurt, were often regardedasluxuries.
Participants said they would rather spend money on essentials such as flour. Products with alonger shelf life werealso more attractive than foods that spoiled quickly.
Local spaza shops were valued for their proximity and convenience. Some also allowed customers to buy on credit.
However, participants raised concerns about the freshness and expiry dates of some products sold at thesestores
Theresearchers cautioned that the findings may not apply to all South African communities, but noted the study offered important insight intohow people in urban areas made food choices under financial pressure. They recommended closer cooperation among government, retailers, the food industry and other stakeholders to improve access to healthier food. Healthier products should be promoted more actively, while marketing of unhealthy options should be reduced. They added that retail changes should formpart of wider public-health efforts to create a healthier food environment.
Jong kunstenaars het 'n kans omhul tekening in 'n splinternuwe Liewe Heksieboek te sien.
Sedert Verna Vels se eerste Liewe Heksie-storiein1961 op radiouitgesaai is en die boeke kort daarnain 1965 gepubliseer is, beklee hierdieonskuldige, onhekserige heksie ’n stewige plek indie hartevan Suid-Afrikaanse kinders Vandag is Liewe Heksiesteeds die bekendstekinderboekkarakter in Afrikaans en Vels se storiesvermaak duisende bewonderaars al vir 65 jaar. Heksie se bekoring lê waarskynlik daarin dat kinders(én grootmense) hulle so maklik met haar kan vereenselwig. Wanneer sy ’n woord nie ken nie, wanneer sy iets belangriks vergeet, wanneer sy haar punthoed skaam oor haar oë trek, of teen wilendank tóg iets moeiliksregkry, deel die kind in ons in Heksie se vreugde of mislukking.
Nou kry jong kunstenaars die geleentheid om self deel vanhierdie besondersenalatenskap te word
Ter vieringvan Liewe Heksie se 65ste bestaansjaar én die publikasie van ’n splinternuwe boek, Liewe Heksie en die Rotbende,later vanjaar nooi Jonathan Ball-uitgewers kinders uit om hul eie illustrasies van Liewe Heksie en haar beste maat, Matewis die kat, te teken. Die weninskrywings sal as kunswerkein die nuwe boek wat in Oktober vanjaar verskyn, gepubliseer word.
'NNUWEAVONTUUR
LieweHeksie en die Rotbende is die eerste nuwe LieweHeksie-boek in dekadesenis gegrond op die dramaproduksie watVels vir die Universiteit van Pretoria geskryf het. In hierdie opwindende avontuur bedink die nare Geelheks vanGifappeltjielanden ’n bende skelm, hongerrotte ’n plan om die kosbare Silwer Roos te steel. Maar daarisook ’n vlieënde piering watmolesmaak en ’n "hond-skoen"wat vir KerrieenBorrie wil byt. Boonop ontaardkoning Rosekrans se spesiale
verjaardagvieringinchaos
Liewe Heksie en haar vriende word uiteindelik meegesleur in ’n dolle jaagtog om Blommelandtered. Metsplinternuwe illustrasies en 'n storie wat die geliefde wêreld van Blommeland opnuut laat leef,wil die boek Vels se kreatiewe nalatenskap vier en nuwe jong lesers lok.
Dieorganiseerders is op soek na kleurvolle,kreatiewe en verbeeldingryke tekeninge van Liewe HeksieenMatewis. Vier gelukkigewenners se kunswerke sal in Liewe Heksie en die Rotbende gepubliseerword.
Soos Verna Vels kinders oor dekades aangemoedig hetomhul verbeelding te gebruik, word 'n nuwe generasie genooi om hulekeninge van Blommeland te skep. Diekompetisie is oop vir kinders tussen vyf en 12 jaar oud. Kinders moet 'n oorspronklike, handgetekende prent van Liewe Heksie en Matewisop'n wit A4-bladsy maak.Enigeteken- of inkleurmedium(potlood, kleurpotlode,
kryte, verf of viltpenne) mag gebruik word. Daar moet geen woorde of skryfwerk op die tekening wees nie. 'n Ouer of voog moet saam met die inskrywing die volgende besonderhede in e-pos verskaf: Die kind se naam en ouderdom, ouer/voog se naam, kontaknommer,e-posadres en woonplek. . Skandeerdie tekening en hegdit as 'n PDF-dokument aan diee-posenstuurdit na marketing@jonathanball.co.za. Die sluitingsdatumisMaandag 10 Augustus
Liewe Heksie is steeds die bekendste kinderboekkarakter in Afrikaans en VernaVels se stories vermaak duisende bewonderaarsalvir 65 jaar
Mott adds thatwaiting for cuts that may be months away is rarely the win buyers imagine.
“The right home at an affordable repayment beats aperfect interest rate on ahome you missed,” he says.
For sellers, on theother hand, a steady rate environment works in theirfavour, because buyers who can plan are buyers whocommit The fundamentals still apply: price realistically andpresent theproperty well, andastable market does the rest.
The rental market has been one of the steadiercorners of property through the rate swings, and JacquiSavage,national rentalsmanager for thegroup, expects that to continue.
“Higher borrowingcosts tend to keepsome would-be buyers renting for longer, andthat supports demand,” she says.
“We’veseenrentalsstayresilient, particularly in well-connected areas where people want to live and work.”
That resiliencecomeswith a caveat.Affordabilityisunder pressure for tenants too, and Savage says careful vetting matters more than ever.
“Demand is healthy, but so is theneed for diligence,”she notes. “Thorough screening protects both thelandlord andthe tenant, and it’s thesingle best wayto avoid problems down the line.”
LOOKINGAHEAD
With July settled, attention turnstowhether the bank can begin easingagain before the year is out —a question that rests largely on fueland global conditions. Mott’s view is that the nextdecisionshouldn’tdominate anyone’s thinking.
“A single rate decision is rarely thethingthatmakes or breaks a property move,” he says. “What matters is buyingwithin your means,inthe right place, for the right reasons.Get thoseright and you can weather whatever the bankdecides —this month or any other.”
It’s asteadying note on whichto enter thesecondhalf of theyear
The new short-termletting by-law proposed by the City of Cape Town will affect many property investors who have acquiredhomes and apartments specifically to let them out via Airbnb and other booking platforms —but they should think twice before deciding to sell theseproperties.
That’s the wordfrom Adel and Charl Louw, principals of the Chas Everitt Atlantic Seaboard and City Bowl office, who note that from 1July next year, owners of any property that is let on ashort-termbasis for more than 50% of the total annual room nights available can expect to paycommercial rather than residential property rates.
However, rather than making ahasty decision to sell these properties,they say, investors should know that thereisa compelling opportunity now to pivottowards long-term rentals, whichisasector currently experiencing significant undersupply in Cape Town.
“Thereisachronic shortage of long-term rental stock across themetro, particularly in central areas and along the Atlantic Seaboard,” they note. “Demand is exceptionally strong, vacancy rates are extremely low, and wellpriced,well-located properties are being let very quickly.”
The latest statistics show that while rentals in the Western Cape grew by almost 7% in 2025 to average between R11000 and R12 000 per month, thosein central Cape Town range from R13 000 to R15000 per month for one-bedroom units and start at around R19000 for twobedroom apartments, with prime properties in sought-afterareas often achieving significantly higherfigures.
“In addition, vacancy rates aregenerally well below 2%, underscoring the strengthof tenant demand, and rental properties in Cape Town also have good capital growth potential. Property values in the city rose by an average of 9% in 2025, and rental supply continues to lagdemand despite ongoing new development.”
In this context, the Louws say, switching to long-term
Rateschangeexpected forrentals.
letting could provide investors with stable, predictable income streams while still benefiting from strong capital growth —and avoiding the potential increase in operating costs associated with commercial rates.
But akey consideration for landlords who make the change, they caution, is securing reliable, financially stable tenants who will honour theirlease agreements and keep the property in good condition. “This is where working with aprofessional agency becomes critical, and at Chas Everitt, our specialised rental management division conducts thorough vetting, credit checks and ongoing management to protect landlords’ assets and ensure consistent returns.”
Thenew by-law has been proposed as part of the city’s move to enforce existing policy more consistently and ensure fairness across the accommodation sector, where hotels, guesthouses and B&Bs already pay commercial rates. Under the proposed framework, properties will be classified as commercial if they are not primary residences and are used wholly for short-term letting, or if they are available for short-term letting for more than 50% of their total annual room nights. And while the city has emphasised that it continues to support tourism and does not intend to restrict shorttermletting, the Louws believe the policy shift will naturally rebalance portions of the market.
“Short-term letting will remain aviable and important part of Cape Town’stourism economy, but for many investors, especially thoseoperating at scale, the numbers may increasingly favour long-term rentals, and given the current supply-demand dynamics, that will be avery attractive position to be in.”
AANDAG ALMAL kontant vir enige huis-houdelikegoed klere, skoene, beddegoed, gordyne, speelgoed, oudhede, juweliersware -goud, breekgoed, potte, elektroniese ware. MEUBELS yskaste, beddens, Sitkamerstelle, tv's. (en baie meer) Johan 074474 4275
Ek koop kombuisware, linne, ornamente, speelgoed,juweliersware, ou tydse goed. Anita0829638877
Secondhand furniture and appliances working or not wanted. Cash offer. 084 440 8140
EK KOOP BOEKE en langspeelplate. 0826708987
ACASH DEAL ON ALL GOODS CLEANING OUT? MOVING?
Cash paidfor all your unwanted good quality ladies, mens, kids clothing.Shoes,linen, bric'nbracetc Christelle 084 408 1437
EG REFRIGERATORS &Appliances Repairs Fridges, freezers, washingmachines, stoves, dishwashes, microwaves,tumble dryers. We do insuranceclaims. We do allkindsof makes of appliances. Cardfacilityavailable Marco 068 039 8341
ALLAPPLIANCES REPAIREDONSITE
We repair appliances Fridges,stoves, washing machineswith guarantee andregas fromR180. Cathy/ Francois 079 838 1851 Allareas
prys,
LAUBSCHER KASTE Kwaliteit! Gratis kwotasies 083270 4739
VIBRACRETE EXTENTIONS B/bars& Gates. 24 HOURS 083 5421097
L&HMaintenance Vir alle verfwerk, kleinbou projekte,daklekke, lê van houtvloere, loodgieters-werk, opsitvan droëmuur konstruksies & knottypineplafonne.Opsit JOJO tenk
NolensRemoval, home &flats 021903 3013 /073 1286236
ALL PAVING. Excel ref. Ph 076 124 4713
MR PAVING
EKSTRAGELD! Benodig 50 Avon Agente Ontvang gratisgeskenk vir 3maande Tel. 082933 3986
REKENKUNDIGE BEAMPTE–DURBANVILLE LaundryDry Cleaning 4U in Durbanvillebenodig 'n Rekenkundige Beampte (vir 'n halwe dag)
After weeks of intense football at Strandfontein SportsGround during the group stages of the Bayviewu-16 Youth CupTournament, hundreds of soccer lovers gathered at AthloneStadium on Saturday 25 July for the finals of the competition.
La Masia EliteFootball Club (FC)from Johannesburg wonthe Platinum Final category after defeating United FC 2-0, whileD6Mitchells Plain defeated Rising Stars by 5-4 on penalties in the Gold Final. Ulana Academy thumped Seaside Academy 4-0 in the Silver Final, with Sunningdale City taking Bronze Final after overcoming Malibu United 2-0.
BRONZE
Runners up: Malibu United FC 0
Winners: SunningdaleFC2
SILVER
Runners up: Seaside spurs 0
Winners: Ulana Academy4
GOLD
Runners up: Rising Stars 0(Pen 4)
Winners: D6 mitchells plain 0(pen 5)
D6 Mitchells Plain wononpenalties
WAGIETCUP
Runners up: BayviewFC0
Winners: Imtieyaaz Wagiet invitationalteam1
PLATIMUN
Runners up: Untied FC 0
Winners :LAMasia EliteFC2
