Becauseformal funding is often scarce, theselife-saving recovery programmes are frequently paid for directly out of thepockets of the patrollersthemselves, Abdallah says. These same volunteers spend tireless hours on night patrols, utilisingtheir own personal funds for vehiclefueland sacrificing precious time with theirfamiliesuntil the early hours of themorningtokeep local streetssecure, he says.
These relentless efforts on the ground havedirectly resulted in numerous successfularrestsand convictions, though thebattle againstcrime remains complex, Abdallah says.
Following arecent spate of armed robberies, joint walking patrols have been establishedalong the Voortrekker Road corridor. Theinitiative, sparked by Goodwood PoliceStation commander Col Shawn van Wyk,brings together neighbourhood watchmembers and police officers on foot.Together, they walk the
corridor to engage directly with local spaza shops, encouraging shop ownersto close theirgates at 19:00 and completely cease trading by 21:00 for their own safety. We have already seen apositive and immediateimpact from the foot patrols along Voortrekker Road, with noticeably less loitering and areduction in incidents, says Abdallah.
With official provincial accreditation now securing theirlegal mandate, these four Goodwood neighbourhood watches including the Glenwood Neighbourhood Watch who attained theirrenewal during thisperiod, are urging more residents to step forward, join theirrespective watches, and actively participate in securing the community.
Residentscan call thechairpersons of the sectorsdirectly.
. Hoosain Abrahams (TownsendEstate) on 079237 8384;
ColShawn vanWyk,Goodwood Police Station commander,Hoosain Abrahams,chair of the TownsendEstate Neighbourhood Watch,and Adballah Sydney,chair of theGoodwood CommunityPolicing Forum.
Jas Visser,chair of the Glenwood Neighbourhood Watch.
SallyVenter,chair of the Goodwood Estate Neighbourhood Watch.
ColShawn vanWyk,Goodwood Police Station commander,Tohaa Davids,chair of the Richmond Estate Neighbourhood Watch,and Adballah Sydney,chair of theGoodwood CommunityPolicing Forum.
Vincent Lavagna,chair of the VascoEstateNeighbourhood Watch.
Polisiegeloof virgrootdwelmvonds
RICHARDROBERTS
RICHARD.ROBERTS@NOVUSMEDIA.CO.ZA
Die Bothasig-gemeenskapspolisiëringforum (GPF) het die inhegtenisneming van'n29-jarige man en beslaglegging op R10 miljoen se dwelms die afgelope week verwelkom. DieWes-Kaapse polisiese misdaadintelligensie-eenheid het Sondag 19 Julie by 'n woonstel in Sylviastraat in dieDeZicht-woonstelkompleks in Richwood toegeslaan, waar hulle optalle vuurwapens, dwelms en ammunisie beslag gelê het. Een verdagte is op die toneel in hegtenis geneem.
Die GPF het die polisie se misdaadintelligensie- en teenbendeeenheid geprysvir diewerk wat gedoen is en ook almal watbydie intelligensiegedrewe operasie betrokke was
SUKSES
"Die vonds van sewe onwettige vuurwapens, meer as 'n duisend patrone en dwelms met 'n straatwaarde van R10 miljoen, is 'n reuseprestasie.
"Hierdie soort operasies stel inwoners gerus dat intelligensie-gedrewe polisiëring vrugte afwerp. Hoewel een inhegtenisneming alleennie georganiseerde misdaaduitroeinie, demonstreerdit dat wetstoepassing misdadige netwerke ontwrigendat dit gevaarlike wapens uitons gemeenskappe verwyder," sê Mario Borchards, GPFvoorsitter.
Hy sê die gemeenskap se vertroue groei wanneer inwoners sigbare optrede, professionele ondersoeke en 'n suksesvolle uitkoms soos hierdieself gewaar. "Bendeverwante misdaad strek veel verder as net na dié wat daarby betrokke is. Dit raak families, ondernemings, en die breë gemeenskap. Ondernemings ly
asgevolg vandiefstal, intimidasie,en toenemende sekuriteitskostes, terwyl inwoners in vrees en onsekerheid leef Onwettigevuurwapens en dwelms spoor geweld aanwat na enige buurt kan oorvloei."
Borchards sê hoewel Bothasig oor die algemeen as 'n veilige gemeenskap geag word, is dit nie geïsoleer van georganiseerde misdaad oor Kaapstad heen nie. "Hierdie inhegtenisneming dien as ‘n herinnering dat misdadige netwerkehulself enigeplek kan vestigas gemeenskappe te gemaklik raak."
Hy sê die sukses deur die polisie beklemtoon die belangrikheid van intelligensiegedrewe polisiëring, maar voeg by datlangtermynsukses 'n vennootskap tussen die polisie en die gemeenskap verg.
VEILIGHEID
Borchards sê daarvoor benodig hul gemeenskap:
. Intelligensiegedrewe ondersoeke;
. Hoësigbaarheid-polisiëring en geteikende optredes;
. Goeie samewerking tussen die polisie, die Stad Kaapstad, buurtwagte, private sekerheidsmaatskappye en die GPF;
. Inwoners wat verdagte aktiwiteite aanmeld;
. Belegging in misdaadvoorkomingstegnologie soos kringtelevisie-kameras in geïdentifiseerde brandpuntgebiede.
Misdaadvoorkoming is almal se verantwoordelikheid, sê Borchards
"Die gemeenskapsebereidwilligheid om verdagte aktiwiteite aan te meld, verskaf dikwels die intelligensie wat tot hierdie soortsuksesvolle optredes lei."
"Die ondersoek is steeds aan die gang, so ek wil nie bespiegeloor sake voor die hof
MAN METDWELMS TER WAARDE VANR10 MILJOEN EN VUURWAPENS BETRAP
nie. Wat ek wel kan sê, is dat dié optrede die waarde van intelligensiegedrewe polisiëring, en die sterk vennootskap tussen wetstoepassers en die gemeenskap beklemtoon."
Die29-jarige verdagte word steeds aangehou. Hy het op 20 Julie in die hof verskyn en verskyn weer op Woensdag 29 Julie in die Goodwood-landdroshof vir 'n borgtogaansoek
"Ten slotte wens die GPF die polisie gelukmet die belangrike deurbraak. Ons moedig inwoners aan om bedag te wees,enomaan te houomverdagte gedrag aan te meld, en ook om gemeenskapsveiligheidsinisiatiewe te steun. Saam, deur sterk vennootskappe en aktiewe gemeenskapsdeelname, kan ons ons gemeenskapveiliger vir almal maak."
VONDS
Kapt.Frederickvan Wyk, provinsiale polisiewoordvoerder, sê die woonstel is glo as 'n bergplek gebruik. Hy sê altesame sewe ongelisenseerde 9mm-pistole en 17 magasyne,sowelas1030 verskillende kaliberpatroneen'nverskeidenheid soortedwelms, is gevindenbeslag daarop gelê
DieWes-Kaapsedepartement van polisieoorsig en gemeenskapsveiligheid het ook die polisie —spesifiek die misdaadintelligensie-eenheid en teenbende-eenheid —vir die beslaglegging geprys. Deur die sleutelbergplek te sluit, het wetstoepassingbeamptes plaaslike bendesindikate wat in die metro werksaam is, 'n knou toegedien. Die departement
spoor die polisie aan om hiermee voort te gaan, en meer geteikende, misdaadintelligensiegedrewe optredes oor hoërisiko gebiede in die provinsieheen uit te brei, sê Anroux Marais, minister van polisie-oorsig en gemeenskapsveiligheid. Marais het die polisie geloof vir hul waarneming, wat daartoe gelei het dat R10miljoen se gevaarlike dwelms, sewe onwettige vuurwapens en meer as 1000 patrone van die strateverwyder is. "Elke onwettige vuurwapen waarop beslag gelê word, is moontlik 'n lewe wat gered word, en dwelms wat vernietig word, verminder die greep wat bendes op ons gemeenskappe het. Die indrukwekkende klopjag demonstreer die krag van intelligensiegedrewe polisiëring. Ek moedig die polisie aan om voort te gaan met deurlopende, geteikende optredes wat misdadige netwerke ontwrig, bendes se vestings ontbind. Dit verseker dat diegene wat ons inwoners terroriseer,die volle mag van die reg in die gesigstaar."
Die 9mm-pistolewaarop daar beslag gelê is
KiteFestivalreturns tocolourthesky
Cape Town’s skies willonce again burst intocolour thisspring as the Cape Town International Kite Festival returns for its 32nd year, bringing together thousands of visitors to celebrate hope, resilience and mental health awareness.
The festival, hosted by Cape Mental Health, takes place on 24 and25October at Youngsfield Military BaseinOttery
Sincelaunching in 1994, it has grown into Africa’s oldest kite festival and one of South Africa’s leading mental health awareness events.
This year’s theme, #ColourTheSky, encourages communities to unite in supporting those living with mental health conditions while highlighting the importance of compassion, understanding and seeking help.
“We areexcited to host the 32nd Cape TownInternational Kite Festivalthis spring —atime of growth, renewal and colour,” said Prof Ingrid Daniels, CEO of Cape Mental Health.
“The kite festival provides us with an awesome opportunitytobrighten the sky withmessages of hope, stories ofresilience and to celebrate the courage and bravery of those who live with amentalhealth condition.”
Daniels added that the event also provides an opportunity to welcome international, national and localkite fliers while raising much-needed funds and awareness forCape Mental Health.
ASKYFILLEDWITHHOPE
For one weekend, giant kites flown by local and international enthusiasts will transformthe skyline into acolourful display designed to inspirehope and encourageconversations around mental wellbeing.
According to Daniels, the #ColourTheSky themereflectsboth the visual spectacle of the festival and its deeper message.
“#ColourTheSky perfectly captures the visual spectacle and emotional energy of the event. Bright colours naturally trigger feelings of joy, optimism,hopeand positivity despitedifficult and challenging times. Colour overrides darknessand gives hope in the face of adversity,” she said.
Winter carnivalbringsthe fun
MENTALHEALTH
AWARENESSEVENT IS ONE OF THE COUNTRY’S OLDEST KITE FESTIVALS
She explainedthat, much like kites soaring against strong winds, people living withmental health challenges demonstrate resilience every day.
MORETHANJUSTKITES
While spectacular kite displays remain the festival’s biggest attraction, visitors canalso enjoy live entertainment, interactive activities, food vendors andfamily-friendly fun throughoutthe weekend.
Every ticket purchased anddonation madehelps Cape MentalHealth continue providing essentialfree mentalhealth services tovulnerable communitiesacross the WesternCape Theorganisation hopes this year’s festivalwill continue its long-standing mission of reducing the stigma surroundingmentalillness while encouragingpeople to seek support when they need it
The Cape Town International Kite FestivaltakesplaceonSaturday24and Sunday 25OctoberatYoungsfield Military Base in Ottery. . Earlybirdtickets arenow availablethrough Quicket. Heart FM returnsasthe festival’s official radiopartner,helping spreadthe #ColourTheSkymessage across theWestern Cape
The FunlandSA Winter Carnival continues to bringcolourand excitement to Bellville, with thrill rides, family attractions, carnivalgames and food stalls entertainingvisitors. The annual event,whichisheldopposite DF Akamie on Frans Conradie Drive, runs until 10 August.Tarryn-Leigh Solomons went to take some snapshots.
TheJets ride proved to be afavouritewithfamilies looking fora little extraexcitement
Ryan and Samantha Martin,withKerry Harwonfrom Edgemead,took amoment to relaxwhilethe children were on therides
Joshua,Felicityand AaronGrassie,fromBoston,took abreak from the ridesfor afamilyphoto.
Nasiphi Ngcobo,Thina Mengcane,ThembiNohayi,Mamello Nohayi and Mikhulu Ngcobo,fromKhayelitsha, were allsmiles as theyenjoyedthe carnival.
Lincoln Adams,KellyLawrence,PaigeNeethling and CandiceAdamspausedfor aquick photobetween therides
Colourful kites willonceagain fillthe skiesabove Youngsfield MilitaryBaseinOtterywhen the Cape Town InternationalKiteFestival returns forits 32nd year in October
Giant kites from localand international kite flierswill transform Cape Town’sskiesintoa moving canvas of colour during the Cape Town International Kite Festival.
‘Scarface’kastygemeenskap I
Jamneck’s rapist,killer gets twolifesentences
DESIRÉERORKE
DESIREE.RORKE@TYGERBURGER.CO.ZA
The Western CapeHigh Courtlast Wednesdaysentenced the accused,a 49-year-old man from Kraaifontein, to life imprisonment for the rape ofDaniel Jamneck andlife imprisonment forhis murderon15June 2023.
He was further sentenced to 10 years’ imprisonment for the rape of aBrackenfell woman in 2005, and eight years imprisonment for the sexualassaultof Daniel.
Action Society welcomed the sentencing of the child predator responsible for the rape and murder of eight-year-old Daniel, saying justice has finally been servedfor alittle boy whose life was brutally stolen.
The organisation, however, says its workisfar from over and will continue to pursue accountability for the systemic failuresthat allowed adangerous repeat sexual offender to remainfree despite his violent criminal history.
The court also ordered that the accused be entered on theNational Register for SexOffenders, permanently prohibited himfrom working with children, prohibited him from possessing afirearm, and ruled that both MariaJamneck and therape survivor be entitledtomake representations to theParole Boardshould he ever become eligible for parole.
“Today’s proceedings weremarked by a powerful moment of solidarity as Daniel’s mother, Maria Jamneck, and the other rapesurvivor held hands in court asthey awaited sentence,” says Juanita du Preez, Action Society’s head of operations.
“Two women whose lives had been forever changed by thesameoffender stood together in supportofone another as
justice wasfinally delivered.”
‘ABSOLUTELIGHT’
Earlier in theweek, the court heard Maria’s victim impactstatement, in which she describedDaniel as “our absolute light”, acompassionate little boywho loved nature, dreamed of becoming a veterinarian, andadoredhis younger sister.
She also spoke of the devastating trauma that continues to affect her family every daysince Daniel’s murder.
“Today’ssentencebrings justicefor Daniel and recognises the immense suffering enduredbyMaria, andeveryone whoselives have been shattered by this monster,” says Du Preez, “Justice has finally been served. But we will continue ourfight to exposethe
failureswithin the criminal justice system that allowedthisaccused to remain free andcontinuehis crime spree, ultimately endinginDaniel’s death.”
“SouthAfricans deserve ajustice system that identifiesdangerous repeat offenders, actsdecisively and protects innocent lives before another family hastoendure this kindofunimaginable loss.”
JUSTICESERVEDBUTQUESTIONSREMAIN
Action Society accepted amandate to support Daniel’sfamily after it emerged that the accused hadpreviously been convicted of rape, later absconded from a court-orderedrehabilitation programme, and subsequently facedanother attempted rape charge thatwas withdrawn before Daniel was raped andmurdered.
“The organisation will continue pursuing
accountability for the institutional failures that allowed thesewarning signs to go unaddressed. While today’s sentence closes one chapter in Daniel’scase, Action Societysays the broader fight for systemic accountability is only beginning,” says Du Preez.
On 15 June 2023, during asleepover at his friend’s, Daniel was found dead in the bed of his friend’s father, the accused, during the early hours. The accused was taken intocustody soon after. Theoriginal murder charge was broadened to include rape and sexual assault once post-mortem resultswere concluded. Despite protesting his innocence throughout the proceedings, the accused faced overwhelming evidence, including testimony from his own son.
ANOTHERRAPE
It later came to light that the convicted man had in 2007 entered into aplea agreement with the NPAregarding the 2005 sexual assault of Brackenfell woman, then 22. Thewoman told TygerBurger Daniel’stragic death could have been prevented, had her case not fallen through the cracks of the justice system 18 years ago.
She says she was intimidated into withdrawing the charges on condition the offence went on his record and he completed adiversion programme for sexual offenders. However, it later emerged at the bailhearing for Daniel’s murder that the accused had absconded from the programme.
Thecase has stirred profound grief far beyond the courtroom walls whereagroup called Justice for Daniel Jamneck formed who followed the proceedings, with one simple purpose, to ensure that his story is never forgotten.
DanielJamneck
‘Niggies’elf keerbenoem
Die Afrikaansetelevisiekanaal kykNET hetdie benoemingsin16kategorieë vir die 2026 Silwerskermtoekenningsvir Film enTelevisie bekendgemaak.
Dit sluit ’n nuwekategorie vir besteaanbieder in ’n dokumentêreprogram in.
Die TV-wenners, asook die bestespeelfilm en bestefilmakteurs, word op Saterdag 22 Augustus by dieglansrykeafsluitingvan die Silwerskermfees in die KaapstadseInternasionaleKonferensiesentrum (Kiks) aangekondig.
“Vanjaarsebenoemingsis’nvertoonvenstervir die briljantewerk in hierdie klein,wêreldklasbedryf. kykNET geemet beskeidenheiden groot respek erkenning aan die verbeeldingrykewêrelde wat opgetowerisdeur dromers, hardewerkersen skeppers, watnie net iets het om te sê nie, maar ookweet hoe om ’n storie te vertel.Hierdie stories is kultuurspesifiek en nooitgeneries nie.Dit voeg werkliksoveel betekenis totkykers se lewens by,” sê Waldimar Pelser,direkteur vir Premium-kanale by Multichoice.
NIGGIESLEI
Niggies,'nontstellende dramareeks gegrond op die ontvoeringenmoordvan twee niggies in Odendaalsrus in 1966,lei met 11 benoemings. In die kategorieë vir 'n telenovellaofsepie spog Suidooster met agten Skemergrond met sewe benoemings. DieKantoor en MagdaLouw oorheers die benoemingsvir komedie. Die drie benoemdes virbeste hoofspeler in 'n komedieis: Albert Pretorius (Flip, Die Kantoor), DesiréGardner (MagdaLouw)enHannes vanWyk (Erhardin MagdaLouw). VanWyk spog met nog twee benoemings— vir beste aanbiederin’nleefstylprogram(Kwêla)envir besteaanbieder in ’n gesels-ofaktualiteitsprogram (Hannes aan huis), terwyl Pretorius ook benoem is virbesteakteur in ’n drama vir sy rolasGustaff Fouché in Niggies
SILWERSKERMFEESMAAK
LATER WENNERSBEKEND
Shimmy Isaacs is benoem vir besteaktrisein’n telenovela of sepie vir haar rolasErikaPienaar in Skemergrond,sowelasvir bestebyspeler in‘n komedie as Lynettein MagdaLouw
ShimmyIsaacsisbenoem virbeste aktrisein’n telenovela of sepievir haar rolasErikaPienaar in Skemergrond, sowelasvir beste byspeler in 'n komedieasLynettein MagdaLouw Rian vanHeerden is twee keer benoem in diekategorie besteaanbiederin’ndokumentêreprogram vir Schuster en BrakpanChronicles, asook vir beste aanbieder in ’n vermaaklikheidsprogram (Wieword ’n miljoenêr).
Die toekenningsgeleentheidwordSondag23Augustusom 19:00 op kykNET uitgesaai.Die name van dieaanbieders en spesialekunstenaarswat gaan optree,sal laterbekend gemaak word .Besoek www.novanews/tygerburger.co.za.
Petronel en Lidi vier vrouwees
Petronel BaardenLidi de Waal bring 'n unieke en hartroerende produksie na die Die Boer-teaterse verhoog met Vrou, Vrouer,Vrouste op Saterdag 1 Augustis om 14:00 Maak regvir ’n kragtigeenkunstigekombinasie vanwoordkuns, musiek en lewenservaring. Die produksie balanseer humor met emosie enneem die gehoor op ’n reis vollag,trane,hoopenselfontdekking. Volgens De Waal is dit "’n snaakse, sad,hopelose, hoopvollewoord-, kuns- en musiekreis najou vredevolleself". Die tweevroue bied nie netvermaak nie, maar ook diep menslikeinsig. Komdeel in 'n vieringvan vrouwees, kreatiwiteit en menslikheid.
. Kaartjies kosR200 ('n glasie VanLoveren Mimosa is ingesluit). Bespreek by www.dieboer.com of by 021 9791911
Petronel Baard en Lidi de Waal vier vrouwees, kreatiwiteit en menslikheid in hul produksie Vrou, Vrouer,Vrouste
Intiem en alternatief, dis ‘Volken Fancy”
Die alternatieweAfrikaanse groep,Volk, onder leidingvan FrankFreeman,sangerenkitaarspeler, bied Volken Fancy aan by Die Boer-teaterrestaurant op Vrydag 31 Julie om 20:30.
Komgeniet 'n intiemeaandsaam met die groep watdie land aan diegons het met hul uniekeklank en uitkyk oor Afrikaanse kultuurenmusiek Ná dievrystelling vanhul debuutalbum, Na Twaalf,inOktober 2025,het Volk landswyd by feeste soos Mieliepop,Droomland,The PicnicClub en meeropgetree.Die volgende stop word in styl gemaak met musiek spesifiek verwerk virteaters en niefeeste of klubsnie."Trek jou safaripakaan en bring jou bokkie. Dis intiem.Dis fancy Volken fancy," nooi hulle.
. Kaartjieskos R200.Geenkinderso.14weens taalgebruik.Bespreek by www.dieboer.com of by 021979 1911.
Brenden vanRhynatDie Boer
Brendan vanRhynbringshis show Nowfor something completely different to Die Boer restaurant theatreonSaturday1August at 20:30and Sunday2 August at 14:00
Everyone’s favourite flight attendant, CathySpecific, is no stranger to Die Boer, but this time round it’s the“man-behind-the-mask” who’llbesprinkling hismagic anddelightingaudiences. This is acheeky but charming cabaret, presented by VanRhynand pianist, GarthTavares
Step into80minutes of heart,humour,and harmonywith afew unexpected detours along theway This up-close-and-personal musical journeyoffers ahand-pickedselection of gems,lovingly chosen fortheir sass,sophistication, wit andwarmth. It’s uncluttered, uncomplicated andcarefully curated to hitall therightnotes. Expect laughs, afew surprises, and awholelot of soul… with the occasional dramatic pause– foreffect, of course. . Tickets cost R300.Bookatwww.dieboer.com or on 021979 1911. Brendan vanRhyn
DAGBOEK /DIARY
. Schalk Bezuidenhout – HeyHey Divorcé runs from 28 Julyto2 August at TheBaxter. TicketsR250at Webtickets.
. Appel tree op Woensdag 29 Julie om 20:30by Heroes Live in Brackenfell, op.Kaartjies kosvan R220 totR260. Bespreekbywww.heroeslive.net
. Simphiwe Dana:The Symphonic Experience is at the Artscape OperaHouseonWednesday29Julyat 19:30. TicketsfromR200atWebtickets.
. JimmyNevis:Roses &Thorns –a live music and theatre experienceisatthe HomecomingCentre on Thursday 30 Julyat20:00. TicketsfromR350at Quicket.
. Divalicious Dames is at Artscape from 30 July to 1August at 20:00.Joindrag-mime artists Ramsay Davids and Martin Neethling on atripdownmemory
lane.TicketsR100 at Webtickets.
. TheStellenboschUniversityChamber Choir gala concert: Voices without Borders is on Friday31Julyat 19:00 in the Endler Hall,Stellenbosch. Ticketsfrom R90 to R210 at Webtickets.
. VanPletzen supportedbyYoNax is at Woodstock BreweryonFriday31July. Doors open 18:00.Tickets from R180 at Quicket
. Alfred Adriaan– PositiveStrokes is by dieHoërskoolCurroDurbanville se Kultura-fees op Saterdag 1Augustusom15:00 en 19:00.Kaartjies kosR220by Quicket
. Liewe Heksie en die Wals met Margit Meyer-Rödenbeck en Deon vanZyl is by dieHoërskoolCurro Durbanville se Kultura-fees op Saterdag 1Augustus om 10:00.Kaartjies kosR150 by Quicket
Volk bestaan uit
DillonMyburgh(tromme), Frank Freeman (sanger en kitaar)enMikaBurger (baskitaar).
Studyexplores questionof‘why womenstay’
Anew study from the University of the Western Cape (UWC) has found the question “why doesn’t she just leave?” misunderstands the lived reality of women trapped in abusive relationships.Researchers say leaving is often not aneasy choice but acalculation between competing dangers.
The research, published inthe Social Sciences journal, was conducted by UWC’s Centre for Interdisciplinary Studies of Children, Family and Society. It draws on the experiences of 262 mothers, grandmothers, adolescents and practitioners from four communities: Cape Town, Saldanha Bay, Fisantekraal and a university student cohort.Participants from diversebackgrounds described similar experiences, pointingtopatterns that ta class and hy
City warns of unpaid parkingfeesSMS scam
The City of Cape Town has warned motorists nottofall for ascam in which fraudsters send SMS messages claiming road users haveunpaid parking fees and mustclickona link to settle the balance.
HOWTOVERIFY
ABUSIVERELATIONSHIPS
ACALCULATION OF COMPETING DANGERS
however, did eventually reacha point the researchers call“reclaiming care”. In these cases, womenchose their own safety, drew strength from faith or community, andworkedtoprevent their children from inheriting the cycleofviolence.
ASYSTEMTHATFAILS
The finaltheme, “structuralfailure”, places responsibility on the families, communitiesand institutions. Police, socialservices andgovernment departments,the study found, often retraumatised womenrather than tecti th .Crime, gsteris nd
According to the City’s Urban Mobility Directoratescammers send messages via SMS butmay alsouse other platforms such as email andWhatsApp. One of the common messages reads ‘’Action required: Your parking feeremainsunpaid. Please settle thebalance immediately...’’
PARKINGMARSHALLS
The City says theonly way to pay for on-street parkingisdirectly to the parking marshalatthe timeofparking. It does not send SMS, emailorWhatsApp messages requesting payment for parking fees. Motorists are advised not to confuse thesefraudulent messageswithlegitimate notificationsabout outstanding traffic fines.The City does send reminders to motorists with outstanding fines registered in theirnames, whichcontain alink to viewfinesatwww.cityofctviewfines.co.za.
Anyone with concerns about an outstanding parking fee should not respond to the message or click on any links, but contact the City’s Transport Information Centre on 0800 65 64 63 or transport.info@capetown.gov.za for assistance.
‘’Residents and visitors should remain vigilant and avoid clicking on links in unsolicited messages claiming that parking fees are outstanding,’’ saidMayco member for Urban MobilityRob Quintas “If in doubt, contact the City directly through the Transport Information Centre for verification. The City does not request payment for parking fees through SMS, email or WhatsApp messages.”
TheCitycharges parking fees for onstreet parking bays in designated areas across Cape Town, particularly in central business districts and areas where demand for parking is high. According to the City thispreventsany one motorist from occupying aspace for extended periods, ensuring fair access for all road users.
Ticketsonsaleforgreatconcert
The milestones of the 25th anniversary of the non-profit organisation
HearUs andthe 40th anniversaryofthe firstcochlear implantation performed in South Africa are being celebrated with aconcert by the HeydeburgSymphony Orchestra in September in Stellenbosch. Tickets for this celebratory concert by HearUs, in association withthe Heydeburg Symphony Orchestra andDare4Life, are available on Quicket from Saturday 1August.
All funds raised will be in aid of HearUs, which was established by Daneel and Santievan der Walt and Fanie de Villiers as an initiative aligned withthe TygerbergHospital–Stellenbosch University Cochlear Implant Unit, and Dare4Life.
HearUs provides financial support to individuals with significant hearing loss from financially disadvantaged backgrounds, enabling them to obtain and maintain cochlear implants and realise their full potentialinthe world of hearing. Dare4Life is aholistic well-being movement supporting individuals facing illness and major life transitions.
FIRSTCOCHLEARIMPLANTATION
The first cochlear implantation performedinSouth Africa was carried out on 4November 1986 at Tygerberg Hospital by Dr Derrick Wagenfeld (ear, nose and throat surgeon), Lida
Müller (audiologist) andtheir StellenboschUniversity team.
On 29September 2023, Tygerberg Hospital celebrated its1000th cochlearimplant recipient,and to date more than 1020 patients have received cochlearimplantsthrough this programme. September is also officially recognised as the International Month for Deaf People in commemoration of the first world congress of the World Federation of the Deaf, held inSeptember 1951.
InternationalWeek of the Deaf,
will add to thismemorable programme.
OUTSTANDINGLINE-UP
TheHeydeburg Symphony Orchestra, conducted thisyear by Leonard Heydenrych and Stuart Martin, will headline this special performance alongside an outstanding line-up of celebrated soloists, including Piet de Beer (violin), José Dias (piano), Lauren Dasappa (soprano), Mario Nell (organ), Thandolwethu Longo (tenor), Iman Bulbulia (piano), Etienne van der Walt (tenor) and Leonard Heydenrych (flute).
Theprogramme features beloved masterpieces from the classical repertoire, together with specially arranged crossover works by Richard Campbell.
LIFE-CHANGINGIMPACT
TICKETS WILL BE AVAILABLE FROM 1AUGUST
whichiscelebratedfrom 20 to 26 September, aims to promote social inclusion, advocatefor the rights of the deaf community, and celebrateSouth African Sign Language.
STRENGTHENMUSICALLITERACY
The Stellenbosch Youth Orchestra,revived for the inaugural HearUsConcert in
2023, is an orchestral training programme under the guidance of Reghardt Kühn and Stuart Martin
It offers secondary school learners the opportunity to participate in large-scale orchestral performance, strengthening theirmusical literacywhile providing invaluable vocational experience.
The orchestra will once again present the curtain-raiser performance for this celebratory event.Special guest performances by KateAllwood (piano), a cochlear implant recipient,
This year Mia le Roux, Miss SouthAfrica 2024, will be welcomed to the stage. Mia received acochlear implant at the age of one and embodies the life-changing impact of hearing restoration, says aspokesperson for HearUs.
Theconcert will be presented on Saturday 5September in the Endler Hall in Stellenbosch. To ensure accessibility, a temporary induction loop system will be available for the evening in Rows FtoQ . Guests who usehearing aidsor cochlear implantsare encouraged to look forthe internationalhearing assistancesymbol whenselecting their seats.
Severalweeksfromnow,I willnolongersee anyof the familiar facesofthe strangers I’vebecome used to traveling with on the bus.
Idon’t knowasingleone of their names but their quirksare so familiar to me now, theyfeel like friends —albeitfriends Iknowonlybysight
Introverts like me arenot good at making friends, unlikemymom, God rest her soul, who made adozen newfriends on everybus within minutes of boarding. I, however, prefer to observefromafar. So,I will miss seeing which snappy, colourfully patternedsuitone particular fellow commuter always dons.
Iwillmiss noticing howthe man with the bleach blondeafri bears an odd resemblancetothe shepherd in Shaun the Sheep
Iwillmiss the deeplypersonal and one-sided chatterbetween oneyoung woman —who doesn’t seem to realisethat not everyone in the bus is wearing headphones —and her friend.
As of 1September,I’llbetaking adifferentbus when our officesmove and earlythisweek,the biggest pang hit when the samoosa man boarded.I atemy warm, freshly-fried-at-the-taxi-rank samoosassadly, knowing therewouldn’t be anyonmynew commute becausethere’snoeating allowedonMyCiTibuses.
When MyCiTi rolled out morethana dozenyears ago, with strictlyenforcedrules, one of my colleague’s first questions was: "What about the people that sell thingsonthe bus?"
Regularpublic transport commutersknowthere are some staples that come with everycommute. Igrew up on trains whereanentire carriage wasdedicated to praiseand worship.Further down the tracks there wouldusually be another carriage wherea group played klawerjas everyday
Taxis have their ownform of entertainment.Last week when my carwas broken, Itooka taxi to some of my stories and wassurprised whenone elderlydriver, whom allthe passengers greeted by name,rocked a CD of old-school 90s club classics —a playlist Irecognisedsinceithad been in rotationsincethe last time regularlytook ataxitowork in 1998
Thetravelling-by-bus-quirksonthe other hand came with the informal vendors, who walkedfrombus to bus with abox of snacks, and clever rhyme "Don’t be shytobuy.Tomorrow you’ll crybecause youdidn’t buy from the right guy."
When MyCiTilaunched about adozenorsoyears ago, it gleamed anditflew,but it lacked the colourful character of traditional commutes
When the municipality startedtrumpeting itsdesire to take overthe rail system, Iclutched my cheapbeaded necklace in alarm. In my decadesofjournalism, Ihavenoticed one consistent trend:the Cape Town Municipality likestogentrify
Public transport is howmillions of the city’sworkers gettotheir jobs—but not by choice. Most wouldlove to work closertowheretheylive, but commuting long distances has become such anorm forthose whohad beencondemned to the outskirts of the citythat most don’t bataneye at sitting forfour hours on abus in trafficdailyorgetting up at 04:00 to catcha train at 05:00 to reach work by 09:00.
When the Citypromised easiercommutes with fancy buses and dedicatedlanes,mostpeoplerejoiced, but onlyafraction of regularcommuters couldafford it in theend. Thelast time Itook aMyCiTibus, about eightyears ago, it wasconsiderablymoreexpensive than Golden Arrow.I don’t knowhow it comparesnow but I’ll find out soon.
Yes, MyCiTicovers routes previouslyservedonlysporadically by taxis —ornot at all. Yes, it is convenient, quickand safe —but it also charges accordingly I’m not saying we don’t want or need safe and efficient public transport,but what we definitely don’t need is having those vital services out of ourreach due to their cost
If the Cityissuccessful in its bidtotakeoverthe metrotrains, will the cheapestmode oftransport be made unaffordable forthose who need it most?I sincerelyhope not -LAUREN O’CONNOR-MAY
LEWENSKIEKIE
OOIUITSIG: Besoeker va iebeek asteel verwonder haar aan die uitsig vanuit bewegende trein tusse uizenbergenSimonstad aapstad se mees ikoniese treinroete watplaaslike en internasionalebesoekers tenminsteeen keer in‘n leeftydmoet ervaar,volgens die leserwat hierdie foto ingestuur het
FOTO:MARIUSSNYDERS
BRIEWE|LETTERS
Motorongelukkenet waar jy kyk
Hierdie afgelope paar weke hetdie Kaap weer bloed op ons paaiegesien,enniemandlyk omgekrap nie.
'n Pa het verbrandtoe 'n taxi vanagter af in sy stilstaande motor vasgeryhet.'nVrouisdeur'nGolden Arrow-bus indie middestad doodgerytoe sy die straat wouoorsteek
Opdie R45 buiteFranschhoek het'nbakkie en 'n vragmotor regvan voor gebots, met tweemense dood en 30 beseerdes.
En Bottelaryweg, 'n padwat lankal as 'n dodelike padgebrandmerk is, hetnog 'n lewe geëis.
Ditisnie ongelukke nie; dit is mislukkings —mislukkingsvan verkeershandhawing, en ook basiese menslikeoordeel.
Hoeveel meergesinne moet rouvoor onsaanvaar dat daar 'n krisisheers?
Taxibestuurders ry oor rooi ligtesonder gevolge.
Voetgangers sterf weekliks
Spoedbeperkings is voorstelle,nie reëlsnie.Tog is daar netstilte vandie owerhede —geen padveiligheidsveldtogte, geen sigbareafdwing vanpadreëlsnie geen dringendheid nie
Die pa vanBlackheath hettweekinders agtergelaat Die vrou in die middestad wasiemandsema, iemand se dogter. Hulle wasoppad huis toe, ná werk, na die alledaagseplekkewaarheen onsalmal gaan sonder om te wonderofons salterugkeer
Watons nodighet,isdaadwerklike aanspreeklikheid, bestuurders watweet dat roekeloosheid gevolgehet,en'nStadwat waarde heg aan elkelewe watopsypaaie verloor word
Hoeveel name moet nógopkruisies langsons paaie verskyn?
BESORGDE INWONER, Kraaifontein
Durbanville boer nou vinnigagteruit metsinkhok by taxi-staanplek
Jare gelede,toe onsnog jonkenmooi was, wasdinge baie andersinons dorp
Vandagisons netmooi, maar helaas,ons dorp is nie altydmeersomooi nie
Deur diejarehet Durbanville heelwatvan sy karakteringeboet weensdie ongebreidelde ontwikkelingen verdigting daarmee saam.
En toe, in die laat jaresewentig en vroeë tagtig ontstaan diebus-entaxistaanplek in die hartjie van diedorp met alles(lees: rommel en lawaai)wat daarmee gepaardgaan.Endie busseentaxi's raak by diedag meer
Helaas is die rangeerwerf onlangsomhein en lykdit nou nes'n skaapkamp in die Karoo.
En raai wat? Netverlede week komeen of ander karakterenbou vir hom'nsinkhok teen die heining waar hy nou heerlik gratis vryenverniet kanwoon
Sommer 'n prima ligging, soueksê, so lekker naby
watpla
diewinkels,die kerk,skole en als.
Onmiddellikroep dit herinneringsopaan die armoedigetentplaas watindie inperkingstyd rondom 2021 op die veld voor die Anglikaanse kerk ontstaan het. En hoemoeilik dit wasomdit te (laat) verwyder Niks minder nieas'nhofbevelwas daarvoor nodig. Nouwonder ek net, gaan onsbinnekort ook 'n blikkiesdorp in die hartjie vandie dorp hê as nóg mensesinkhokkies teen die taxistaanplek se heining komoprig?
Volgensmyinformanthet wetstoepassers welmet 'n vloot voertuie opgeruk om die mensehokkie en al te probeer verwyder.Maar helaas,teen Maandagwas dit steeds daar
As onsasinwoners niewaak oordie karaktervan ons dorp nie, gaan niemandanders dit doen nie Ons hetregtig nie'nDunoon in onsdorp nodig nie! ANTI-BLIK, Goedemoed
Thememories of DayZero stillhaunt us
Queuing at collectionpoints, bucket baths, gardens turned to dust,and the collectiveanxietyofacitystaring intothe abyssofanemptytap.Wevowed neverto letithappen again
And yet, hereweare,watching the PacificOcean warm, with climatescientists warning of apotential Super El Niñobuilding forlatethis year
Yes, the experts arequick to point outthatElNiño’s grip on the WesternCape’s winter rainfallisweaker than its hold on the summerrainfall regions of the country. Ourdams sit at acomfortable79%.
But comfort is adangerous companion. The same scientists who urge cautionalsoacknowledge uncertainty, anduncertainty, when it comestowater security, is notaluxury Cape Town canafford.
DayZerowas notcausedbyasingle drywinter.It wasthe culmination of years of complacency, ignored warningsand sluggish infrastructureinvestment
We congratulatedourselves on dodging the bullet in 2018,pattedeachother on the back forcutting consumption, andthen quietlyslipped back intoold habits.
Swimming poolswererefilled. Lawns were replanted. Carwashes resumed. Thebrief, beautiful discipline of acityunder siegewas forgottenasquickly as it was born.
An El Niñoneed notdeliver aknockoutblowtoour watersupply. It need only deliver awarmer,drier summerthanexpected, combined with higher evaporation ratesand the inevitablesurge in demandthatcomes with heat
We need to rememberwhatwelearned the hard way. Everydropsaved todayisa drop availabletomorrow. Theshowertimer,the bucketinthe sink, the grey wateronthe garden, andtheseare notrelics of acrisis past.Theyare the habits of acitythatknows what it stands to lose
CONCERNED RESIDENT,Durbanville
Pharmacystudent winschesstourney
Balancing aPhD in pharmaceutical sciences withcompetitive chess is no smallfeat, but try doing so and winning adivision in anational chess championship.
University of the WesternCape (UWC) PhDstudent, 25-year-old Harrison Abrahams from Parow, succeeded in achieving exactly that.Harrison captured theSouth African Open Chess Championships IntermediateSection, hosted from 27 June to 5July2026, scoring an impressive eight points from nine rounds.
The Intermediate Section wasfiercely contested, with thetop five finishers separated by razor-thin margins Abrahamssecured first place outright, while his four competitors, Kopa Lesetedi, Andile Siyali, Christian Maxwell, and Karl Freeks, rounded out the second through fifth spots after atense tiebreak.
For Abrahams, the victory is atestament to his ability to balancetwo demanding worlds. While he is knownasaformidable chessplayer who competes regularly, he is also deep into his PhD studies in pharmaceutical sciences, focusing on nanomedicine and tuberculosis treatment. Reflecting on his tournament success, Abrahams described his mindset as calm yet focused.
“I had astrategy, but Ialsoreminded myself to enjoy the game. That balance made all the difference. My mindset was simply to play good chess and ensureI was well-rested and focused. Idid nottry goingfor tricks and played solidly and Ihonestly did not expect to win. Ikept that fantasy of winning out ofmymind completely, and focused on one game ata time. And it all worked out,” he said. “In chess, you calculate different possibilities andevaluatecriticallywhat the right plan is. That analytical and criticalthinking is readily transferable to doinga PhD. Ihave
UWC: Affordabilityshapes SA people’s food choices
CHAMPION SHARES HIS STRATEGY FOREXCELLING IN BOTH ACADEMICS AND CHESS
to question my thoughtprocesses and research toensure they are robust enough to help treat tuberculosis.”
CURIOUSITYFACTOR
Curiosity is another factor in Abrahams’s success: “Chess and nanomedicine both explore new avenues to solve the problems at hand, andbeing open to new ideas is key to nanomedicine andchess ”
When askedabouthis routine, Abrahams saidchess is away to recharge.But stopping at the campusoutdoor chess boards is never atemptation for him. He much prefers his break from the intensity of research, playingonline, mostly as a brief 10-minute distraction andconnecting withothers through chess tournaments
“I started my chess journey when Iwas aboutseven years old. My uncle played againstmeand beat me.Hetaughtme the basics andIremember losing almost every gameatfirst, but Iwas hooked. That inspired me to improve my chess skills until Icould beat him,” he joked. “Later, Iplayed casually in primary andhigh school,and I, strangely enough, stopped playing chess during the pandemic and restarteditwhenI returned to UWC for mymaster’sdegree in 2024, this time taking it very seriously.”
And justlike that, the result becomes crystal clear: asingle move can transform theentire game.Patience, foresight, and adaptabilityare the keys that unlock a decisive checkmate.
aUniversity of theWestern Cape (UWC) study has foundthatmanySouth Africans decide what to put on their dinner table basedonaffordability, household needsand what is available rather than nutritional value.
The study examined food choices in Worcesterinthe WesternCape, Stutterheim in the Eastern Cape and EsikhawiniinKwaZulu-Natal.
HEALTHMATTERS,BUTOFTENCOMESSECOND
The study, published in the South African Journal of Clinical Nutrition, involvedalmost 70 adults. Many participants were unemployed or depended on social grants.
Researchers,including UWC dietetics and nutrition lecturer Dr Nazeeia Sayedand department head Prof Rina Swart, found that participants generally understood the benefitsofhealthy eating. However,health wasseldom thedeciding factor when food was bought.
Peopleweighed health considerations againstprice, convenience, transport costs and thedistancetoshops.
One participantdescribed the realityof householdbudgeting: “Inour household we do not just buy food. Rather, we check thepriceofeach food itemfirst to see how much it costs.”
FAMILYPREFERENCESANDSPECIALS
Household members alsoplayed amajor role in food decisions. Participants often chosemealsthatwould satisfy children, partnersand otherrelatives, while ensuringeveryonehad enough to eat.
Healthyalternativeswere sometimes overlooked if they were considered too expensive,unfamiliar or unlikely to appeal to the whole family.
Participantsidentified whole grains, fruit,vegetables, legumes, lean protein and minimally processed foodsashealthy. Friedfoods,sugary drinks, fast food, refinedcarbohydrates andproductshigh in fat andsalt were generally viewed as unhealthy.
Some healthyoptions, including leafy vegetables, legumes andchicken liver, were avoidedbecause people were unsure how to prepare them in an appealing way.
Promotions andadvertising also affected purchasing decisions. Price-conscious consumers said they relied on specials and comparedprices weekly or monthly, dependingontheir income.
“We watchthe specials, we live on specials,”one participant said. “We compareitmonthly or weekly, depending on what our income is.”
Cookingathome was viewed as cheaper than buyingready-made meals. Shops closetohome or work were also preferred because they reduced transport expenses.
Snacksand treats,including yoghurt, were often regardedasluxuries.
Participants said they would rather spend money on essentials such as flour. Products with alonger shelf life werealso more attractive than foods that spoiled quickly.
CONVENIENCEANDCONCERNSATSPAZASHOPS
Local spaza shops were valued for their proximity and convenience. Some also allowed customers to buy on credit.
However, participants raised concerns about the freshness and expiry dates of some products sold at thesestores
Theresearchers cautioned that the findings may not apply to all South African communities, but noted the study offered important insight intohow people in urban areas made food choices under financial pressure. They recommended closer cooperation among government, retailers, the food industry and other stakeholders to improve access to healthier food. Healthier products should be promoted more actively, while marketing of unhealthy options should be reduced. They added that retail changes should formpart of wider public-health efforts to create a healthier food environment.
Tekeningevan kinders gesoekvir nuwe Liewe Heksie-boek
Jong kunstenaars het 'n kans omhul tekening in 'n splinternuwe Liewe Heksieboek te sien.
Sedert Verna Vels se eerste Liewe Heksie-storiein1961 op radiouitgesaai is en die boeke kort daarnain 1965 gepubliseer is, beklee hierdieonskuldige, onhekserige heksie ’n stewige plek indie hartevan Suid-Afrikaanse kinders Vandag is Liewe Heksiesteeds die bekendstekinderboekkarakter in Afrikaans en Vels se storiesvermaak duisende bewonderaars al vir 65 jaar. Heksie se bekoring lê waarskynlik daarin dat kinders(én grootmense) hulle so maklik met haar kan vereenselwig. Wanneer sy ’n woord nie ken nie, wanneer sy iets belangriks vergeet, wanneer sy haar punthoed skaam oor haar oë trek, of teen wilendank tóg iets moeiliksregkry, deel die kind in ons in Heksie se vreugde of mislukking.
Nou kry jong kunstenaars die geleentheid om self deel vanhierdie besondersenalatenskap te word
Ter vieringvan Liewe Heksie se 65ste bestaansjaar én die publikasie van ’n splinternuwe boek, Liewe Heksie en die Rotbende,later vanjaar nooi Jonathan Ball-uitgewers kinders uit om hul eie illustrasies van Liewe Heksie en haar beste maat, Matewis die kat, te teken. Die weninskrywings sal as kunswerkein die nuwe boek wat in Oktober vanjaar verskyn, gepubliseer word.
'NNUWEAVONTUUR
LieweHeksie en die Rotbende is die eerste nuwe LieweHeksie-boek in dekadesenis gegrond op die dramaproduksie watVels vir die Universiteit van Pretoria geskryf het. In hierdie opwindende avontuur bedink die nare Geelheks vanGifappeltjielanden ’n bende skelm, hongerrotte ’n plan om die kosbare Silwer Roos te steel. Maar daarisook ’n vlieënde piering watmolesmaak en ’n "hond-skoen"wat vir KerrieenBorrie wil byt. Boonop ontaardkoning Rosekrans se spesiale
verjaardagvieringinchaos
Liewe Heksie en haar vriende word uiteindelik meegesleur in ’n dolle jaagtog om Blommelandtered. Metsplinternuwe illustrasies en 'n storie wat die geliefde wêreld van Blommeland opnuut laat leef,wil die boek Vels se kreatiewe nalatenskap vier en nuwe jong lesers lok.
Dieorganiseerders is op soek na kleurvolle,kreatiewe en verbeeldingryke tekeninge van Liewe HeksieenMatewis. Vier gelukkigewenners se kunswerke sal in Liewe Heksie en die Rotbende gepubliseerword.
Soos Verna Vels kinders oor dekades aangemoedig hetomhul verbeelding te gebruik, word 'n nuwe generasie genooi om hulekeninge van Blommeland te skep. Diekompetisie is oop vir kinders tussen vyf en 12 jaar oud. Kinders moet 'n oorspronklike, handgetekende prent van Liewe Heksie en Matewisop'n wit A4-bladsy maak.Enigeteken- of inkleurmedium(potlood, kleurpotlode,
kryte, verf of viltpenne) mag gebruik word. Daar moet geen woorde of skryfwerk op die tekening wees nie. 'n Ouer of voog moet saam met die inskrywing die volgende besonderhede in e-pos verskaf: Die kind se naam en ouderdom, ouer/voog se naam, kontaknommer,e-posadres en woonplek. . Skandeerdie tekening en hegdit as 'n PDF-dokument aan diee-posenstuurdit na marketing@jonathanball.co.za. Die sluitingsdatumisMaandag 10 Augustus
Liewe Heksie is steeds die bekendste kinderboekkarakter in Afrikaans en VernaVels se stories vermaak duisende bewonderaarsalvir 65 jaar
Harrison Abrahams (middle) is balancing studiestowardsa PhD with winning chess tournaments
Lead author of thestudy Dr Nazeeia Sayed
Ratespathdown remainsonpause
Fdablerepaymentbeatsa nard Kondowe
Mott adds thatwaiting for cuts that may be months away is rarely the win buyers imagine.
“The right home at an affordable repayment beats aperfect interest rate on ahome you missed,” he says.
For sellers, on theother hand, a steady rate environment works in theirfavour, because buyers who can plan are buyers whocommit The fundamentals still apply: price realistically andpresent theproperty well, andastable market does the rest.
The rental market has been one of the steadiercorners of property through the rate swings, and JacquiSavage,national rentalsmanager for thegroup, expects that to continue.
“Higher borrowingcosts tend to keepsome would-be buyers renting for longer, andthat supports demand,” she says.
“We’veseenrentalsstayresilient, particularly in well-connected areas where people want to live and work.”
That resiliencecomeswith a caveat.Affordabilityisunder pressure for tenants too, and Savage says careful vetting matters more than ever.
“Demand is healthy, but so is theneed for diligence,”she notes. “Thorough screening protects both thelandlord andthe tenant, and it’s thesingle best wayto avoid problems down the line.”
LOOKINGAHEAD
With July settled, attention turnstowhether the bank can begin easingagain before the year is out —a question that rests largely on fueland global conditions. Mott’s view is that the nextdecisionshouldn’tdominate anyone’s thinking.
“A single rate decision is rarely thethingthatmakes or breaks a property move,” he says. “What matters is buyingwithin your means,inthe right place, for the right reasons.Get thoseright and you can weather whatever the bankdecides —this month or any other.”
It’s asteadying note on whichto enter thesecondhalf of theyear
By-lawchanges may affect Airbnb letters
The new short-termletting by-law proposed by the City of Cape Town will affect many property investors who have acquiredhomes and apartments specifically to let them out via Airbnb and other booking platforms —but they should think twice before deciding to sell theseproperties.
That’s the wordfrom Adel and Charl Louw, principals of the Chas Everitt Atlantic Seaboard and City Bowl office, who note that from 1July next year, owners of any property that is let on ashort-termbasis for more than 50% of the total annual room nights available can expect to paycommercial rather than residential property rates.
However, rather than making ahasty decision to sell these properties,they say, investors should know that thereisa compelling opportunity now to pivottowards long-term rentals, whichisasector currently experiencing significant undersupply in Cape Town.
“Thereisachronic shortage of long-term rental stock across themetro, particularly in central areas and along the Atlantic Seaboard,” they note. “Demand is exceptionally strong, vacancy rates are extremely low, and wellpriced,well-located properties are being let very quickly.”
STRONGRENTALMARKET FUNDAMENTALS
The latest statistics show that while rentals in the Western Cape grew by almost 7% in 2025 to average between R11000 and R12 000 per month, thosein central Cape Town range from R13 000 to R15000 per month for one-bedroom units and start at around R19000 for twobedroom apartments, with prime properties in sought-afterareas often achieving significantly higherfigures.
“In addition, vacancy rates aregenerally well below 2%, underscoring the strengthof tenant demand, and rental properties in Cape Town also have good capital growth potential. Property values in the city rose by an average of 9% in 2025, and rental supply continues to lagdemand despite ongoing new development.”
In this context, the Louws say, switching to long-term
Rateschangeexpected forrentals.
letting could provide investors with stable, predictable income streams while still benefiting from strong capital growth —and avoiding the potential increase in operating costs associated with commercial rates.
PROFESSIONALMANAGEMENTISKEY
But akey consideration for landlords who make the change, they caution, is securing reliable, financially stable tenants who will honour theirlease agreements and keep the property in good condition. “This is where working with aprofessional agency becomes critical, and at Chas Everitt, our specialised rental management division conducts thorough vetting, credit checks and ongoing management to protect landlords’ assets and ensure consistent returns.”
Thenew by-law has been proposed as part of the city’s move to enforce existing policy more consistently and ensure fairness across the accommodation sector, where hotels, guesthouses and B&Bs already pay commercial rates. Under the proposed framework, properties will be classified as commercial if they are not primary residences and are used wholly for short-term letting, or if they are available for short-term letting for more than 50% of their total annual room nights. And while the city has emphasised that it continues to support tourism and does not intend to restrict shorttermletting, the Louws believe the policy shift will naturally rebalance portions of the market.
“Short-term letting will remain aviable and important part of Cape Town’stourism economy, but for many investors, especially thoseoperating at scale, the numbers may increasingly favour long-term rentals, and given the current supply-demand dynamics, that will be avery attractive position to be in.”
TheSouth African ReserveBank held the repo rate at 7%
Pawnand drive + Other loans. W/App "Hi" to 082 359 2546
AANDAG ALMAL kontant vir enige huis-houdelikegoed klere, skoene, beddegoed, gordyne, speelgoed, oudhede, juweliersware -goud, breekgoed, potte, elektroniese ware. MEUBELS yskaste, beddens, Sitkamerstelle, tv's. (en baie meer) Johan 074474 4275
Ek koop kombuisware, linne, ornamente, speelgoed,juweliersware, ou tydse goed. Anita0829638877
Secondhand furniture and appliances working or not wanted. Cash offer. 084 440 8140
EK KOOP BOEKE en langspeelplate. 0826708987
ACASH DEAL ON ALL GOODS CLEANING OUT? MOVING?
Cash paidfor all your unwanted good quality ladies, mens, kids clothing.Shoes,linen, bric'nbracetc Christelle 084 408 1437
EG REFRIGERATORS &Appliances Repairs Fridges, freezers, washingmachines, stoves, dishwashes, microwaves,tumble dryers. We do insuranceclaims. We do allkindsof makes of appliances. Cardfacilityavailable Marco 068 039 8341
L&HMaintenance Vir alle verfwerk, kleinbou projekte,daklekke, lê van houtvloere, loodgieters-werk, opsitvan droëmuur konstruksies & knottypineplafonne.Opsit JOJO tenk
NolensRemoval, home &flats 021903 3013 /073 1286236
LaundryDry Cleaning 4U in Durbanvillebenodig 'n Rekenkundige Beampte (vir 'n halwe dag)
Ladslightupstadium
After weeks of intense football at Strandfontein SportsGround during the group stages of the Bayviewu-16 Youth CupTournament, hundreds of soccer lovers gathered at AthloneStadium on Saturday 25 July for the finals of the competition.
La Masia EliteFootball Club (FC)from Johannesburg wonthe Platinum Final category after defeating United FC 2-0, whileD6Mitchells Plain defeated Rising Stars by 5-4 on penalties in the Gold Final. Ulana Academy thumped Seaside Academy 4-0 in the Silver Final, with Sunningdale City taking Bronze Final after overcoming Malibu United 2-0.
RESULTS
BRONZE
Runners up: Malibu United FC 0
Winners: SunningdaleFC2
SILVER
Runners up: Seaside spurs 0
Winners: Ulana Academy4
GOLD
Runners up: Rising Stars 0(Pen 4)
Winners: D6 mitchells plain 0(pen 5)
D6 Mitchells Plain wononpenalties
WAGIETCUP
Runners up: BayviewFC0
Winners: Imtieyaaz Wagiet invitationalteam1
PLATIMUN
Runners up: Untied FC 0
Winners :LAMasia EliteFC2
ACTIONPACKED FINALS
Lyle Jantjies of La Masia EliteFC(Gauteng) puts atackle in on SidneySchoeman of United FC during theBayviewFCunder16youthcup played at theAthlone stadium on Saturday25July.TheGauteng team wonthe platinum final 2-0.
