Fall 2025 Catalog

FALL 2025 COMPLETE CATALOG PRE-K–GRADE 5

Content, Language, and Literacy Teaching

Content, Language, and Literacy Teaching

Contenido, lenguaje y literacidad

Enseñanza del lenguaje académico

Content, Language, and Literacy: Teaching for Academic Language™ builds academic language across English and Spanish for deep, transferable understanding.

See Pages 3-8 for complete details.

El poder de la lectura

El poder de la lectura™ is the Spanish language alternative to Build Literacy Learning™ , providing an explicit and systematic approach to foundational skills instruction.

Build Literacy Learning™ is a seven-stage program for explicit and systematic instruction to extend the foundational skills and knowledge of young readers.

El poder de la lectura

See Pages 9-14 for complete details.

See Pages 15-24 for complete details.

RESOURCE SELECTION GUIDE

DESPEGANDO HACIA LA LECTURA: FONÉTICA™ PAGE101 PAGE101 EL PODER DE LA LECTURA™ PAGE9 PAGE9 UN ENFOQUE DE LECTURA COMPARTIDA PAGE109 PAGE109

DESPEGANDO HACIA LA LECTURA® PAGE112 PAGE112 PAGE112 PAGE112 EXPLORAMUNDOS™ PAGE136 PAGE136

Content, Language, and Literacy: Teaching for Academic Language

Boost student achievement by focusing on academic language!

Designed for today’s diverse classrooms,  Content, Language, and Literacy integrates academic language development with grade-level content instruction. Grounded in research and built for flexibility, this standards-aligned resource supports multilingual learners and emergent bilinguals across a range of instructional models— including dual language, ESL, and integrated ELD.

Support for Biliteracy and Multilingual Learners

• Builds academic language across two languages for access to content.

• Aligned with the goals of dual language education, newcomer programs, and ELD frameworks.

• Addresses the needs of emergent bilinguals.

Whether you’re supporting newcomers, building biliteracy, or strengthening classroom discourse, Content, Language, and Literacy offers teacher-friendly tools, professional development support, and high-impact instruction for academic success.

With instruction for each title provided over a sequence of five days, Content, Language, and Literacy is strategically designed to support emerging bilinguals as they develop academic language. Focus is given to how language is used to engage with content. Providing linguistic support ensures that students can meet the academic language demands of the standards.

content-language-literacy.myokapi.com Visit our online store or find your rep at myokapi.com

Content, Language, and Literacy

Teaching for Academic Language

Ready-to-Use, Teacher-Friendly Design

Standards-based lessons and materials are practical, clear, and easy to implement.

Each ready-to-use lesson builds students’ academic language through meaningful talk, reading, and writing tasks in science and social studies. With a strong focus on oracy, culturally responsive teaching, and scaffolded support, the program ensures equitable access to content while developing vocabulary, sentence structure, and discourse skills.

Designed to support the teacher in engaging students in talking and writing while simultaneously learning about the content.

With English As the Target LanguageWith

Day 1

Comprehension and Vocabulary

Vista previa Hacer predicciones

Diga: Este libro es un texto informativo: reporte. Cuando miro este libro para pensar de qué se trata, miro el título, la portada y el índice. Luego miro los subtítulos, fotografías y gráficos. Haga estas acciones con los estudiantes. Activando el conocimiento previo Activar el conocimiento previo de los estudiantes a través de preguntas guía. Supervise, redirija, o aclare según sea necesario.

Pregunte: ¿Todos los animales adultos especies pueden producir crías? Las especies son grupos de animales que comparten las mismas características. Piensa en lo que sabes de los animales.

Pregunte: ¿Cómo cuidan a sus crías los animales que conoces? Registre las respuestas de los estudiantes en la pizarra.

Diga: La imágenes nos ayudan a entender la idea principal del texto.Observa las imágenes de la madre zarigüeya y la madre pelirojo en la página 4. Pregunte: ¿Qué tienen en común las imágenes de la madre zarigüeya y la madre pelirojo?

Marco de oración

Ambas la madre (zarigüeya) y la madre (peliroja), tienen en común que están (cuidando) a sus crías.

View Comprehension skills

Focus on the comprehension skill of asking questions to gain information through a think-aloud with modeling and prompting.

Say: Think about these questions as we read to identify the details that support the main idea.

• How do animals produce and protect their young?

• What do the animal parents do that is the same?

• What do they do that is different?

Say: The introduction of a report gives us the book’s main idea.

Read aloud the Introduction on pages 4–5.

Dialogue Ask: What is the main idea in this introduction?

Partner A: The main idea is that all adult animal species (reproduce) and provide for their (young) in (different) ways.

Partner B: For example, some animals, such as (opossums) need to (care) for their young because they cannot look after themselves. But the young of other animals, such as (spiders) can feed and care for themselves.

Ask: Why do animals reproduce?

Partner A: Animal parents (produce) young animals so the species can (survive).

Partner B: Also, all animal species provide for their young, but in different ways.

Repaso

Discusión del vocabulario

Diga: Vamos a conversar acerca del vocabulario esencial y conectarlo al inglés.

Diga: Con tu pareja usa las palabras en el siguiente párrafo.

Language, and Literacy Unit 1 Day 1: Comprehension and Vocabulary Vocabulary Anchor Chart

Español English Español English reproducir reproduce crías young

especies species depredadores predators salir del cascarón hatch

Las (especies) de animales se (reproducen) de diferentes maneras. Por ejemplo, algunos animales como la (zarigüeya) se quedan con sus crías, quienes nacen indefensas, para alimentarlas y protegerlas de los (depredadores).

Otros animales como las arañas ponen huevos donde hay comida y no se quedan cuidando a sus crías después de que salen del (cascarón).

Written by Sandra Mercuri

Effective integration of content, language, and literacy instruction is crucial for ensuring that multilingual learners can access academic content.

With an approach that is tailored to meet their language proficiency levels and learning needs, Content, Language, and LiteracyTM engages your students in meaningful classroom activities and discussions. Well-designed and standards-based, Content, Language, and LiteracyTM provides the structured framework you need for delivering instruction that is both academically challenging and accessible to multilingual learners.

LanguageWith Spanish As the Target Language

3 Gramática

Preview

Use a teaching poster to show how personal pronouns are used in Spanish.

Say: In Spanish, pronouns replace nouns in a sentence so that nouns are not repeated.

These pronouns can be singular or plural. The third person singular (he/she/it) and all plural persons also have masculine and feminine genders. In Spanish, pronouns replace nouns in a sentence so that nouns are not repeated. With your partner, use a singular and a plural personal pronoun in complete sentences about the text you read.

Oso pardo En primavera, la madre y sus cachorros abandonan la guarida para buscar alimentos. Los oseznos siguen alimentándose con la leche de la madre, pero también aprenden a cazar por su cuenta. Los cachorros, u oseznos, permanecen dos años con su madre, y luego ella los ahuyenta.

Diga: El pronombre ella es el sujeto de la oración y se refiere a la osa parda. El pronombre los es parte del predicado y se refiere a los cachorros.

Diálogo

Pregunte: ¿A qué se refieren los pronombres ella y los?

Compañero/a A: El pronombre ella es el (sujeto) de la oración y se refiere a (la osa parda).

Compañero/a B: El pronombre los es parte del (predicado) de la oración y se refiere a (los tres oseznos).

Diga: Lean con su compañero la página 15 sobre los caballitos de mar.

Caballito de mar El caballito de mar hembra pone entre 250 y 400 huevos. Traslada los huevos en pequeñas tandas a la bolsa del macho. El macho los lleva en la bolsa de tres a seis semanas. Durante todo este tiempo, el macho no come.

Cuando las crías salen del cascarón, el macho las lleva en su bolsa durante diez días más hasta que miden aproximadamente un cuarto de pulgada.

Diálogo

Pregunte: ¿Cuál es la idea principal de esta introducción?

Compañero/a A: La idea principal es que los animales adultos de todas las especies (se reproducen) (cuidan) a sus crías de maneras (diferentes).

Compañero/a B: Por ejemplo: algunos animales como (las zarigüeyas) necesitan (cuidar) a sus crías porque ellas no pueden cuidarse solas. Pero las crías de otros animales, como (las arañas) se pueden alimentar y cuidarse solas.

Pregunte: ¿Por qué se reproducen los animales? Compañero/a A: Los padres del mundo animal (tienen) crías para que las especies puedan (sobrevivir). Compañero/a B: Además, todas las especies animales

For example, say: The brown bear is a mammal. She feeds her cubs with breast milk.

Ask: Who does the pronoun she refer to? The singular pronoun __________ refers to the

Say: The brown bear and the gray wolf are mammals. They feed their cubs with breast milk

Ask: Who does the plural pronoun ellas refer to? The plural pronoun __________ refers to __________ and

Vista

Revise los pronombres personales con ejemplos del texto o de acuerdo con el contenido del texto.

Diga: Cuando leamos la página 7 de este libro, busquen el pronombre ella y el pronombre los. Los pronombres se usan en lugar de una persona o cosa particular en una oración.

Luego, las lanza al mar.

Diálogo

Pregunte: ¿A qué se refieren los pronombres los y las?

Compañero/a A: El pronombre los es parte del (predicado) de la oración y se refiere a (los huevos).

Compañero/a B: El pronombre las es también parte del (predicado) de la oración y se refiere a (las crías del caballito de mar).

Review

Say: Let’s do some shared writing. Explain to your partner how personal pronouns are used in English.

(Personal pronouns) are used to (replace) nouns. For example, the pronoun (she) is used to replace the feminine noun (seahorse). The pronoun (they) is used

Español

Diga: Ahora vamos a escribir detalles de apoyo sobre lo que declaramos en la introducción.

Pregunte: ¿Cómo se reproducen los mamíferos cómo cuidan a sus crías? Los mamíferos pueden (dar a luz) a sus crías y (alimentarlas) con (leche). Además (cuidan) a sus crías y las (protegen) porque ellas (no se pueden cuidar solas). Por ejemplo, los osos pardos (hibernan) con sus oseznos durante el invierno. Otros (mamíferos), como las lobas, reciben ayuda de otros (lobos) de la (manada). Estos lobos (alimentan) a los cachorros (regurgitando) carne de su (estómago).

Pregunte: ¿Cómo se reproducen los peces de agua salada y cómo alimentan a sus crías?

Los peces de agua salada no dan a luz animales vivos, sino que (ponen) muchos (huevos) para garantizar que sobrevivan al menos algunas crías. El (caballito de mar) hembra traslada los (huevos) que pone a la (bolsa) del macho. El macho los (lleva) y (protege) hasta que salen del cascarón. Diez días después de salir del cascarón, el macho las (lanza) fuera de su (bolsa), y las crías deben (valerse) por (sí mismas). Diga: Ahora necesitamos escribir una conclusión. Todas las especies de animales (se reproducen) y (cuidan) sus (crías), pero lo hacen de maneras (diferentes). Por ejemplo, los mamíferos les dan (leche) a sus (crías), las (protegen) y les (enseñan). No obstante, las crías de los (peces de agua salada) pueden (cuidarse) o (valerse) por (sí mismas).

A: All animal species (reproduce).

crías y se (esfuerzan) para que sus (crías) tengan todas las posibilidades de (crecer) y de (reproducirse), como ellos. Así, sobreviven las (especies). No obstante, cada (especie) lo hace de (manera diferente)

content-language-literacy.myokapi.com Visit our online store or find your rep at myokapi.com

Content, Language, and Literacy

Built for Equity and Access

Each of the 12 Distinct Grab-and-Go Units Contains:

• 24 Student Books (12 copies of student texts in English and 12 copies in Spanish)

Research-Based and ClassroomTested!

• 2 Teacher Resource Books (Target Language English and Target Language Spanish)

Each of the twelve units:

• Ensures participation by giving students a voice

• Are grounded in translanguaging practices such as Preview-View-Review and Cross-Linguistic Connections to support students’ meaning-making using their full linguistic repertoire

• Provides scaffolded supports to help students access rigorous content

• Includes Curriculum Objectives covering a week’s worth of lessons.

Informational texts provide rich and engaging content, which in turn introduce readers to a wide range of academic language in context.

These carefully selected, thoroughly captivating student texts:

• Develop the language multilingual students need to thrive in content areas (science and social studies)

• Provide language supports for students to develop academic language at the vocabulary, sentence, and discourse level

• Anchor the lessons in language, literacy, and content state standards

• Provide students opportunities to access grade-level standards through talk, reading, and writing in meaningful tasks

• Promote higher-order thinking through language-rich activities

• Emphasize oracy through the language of explanation.

content-language-literacy.myokapi.com Visit our online store or find your rep at myokapi.com

Grab-and-Go Instruction!

Flexible for Multiple Program Models!

• Works across dual language, ESL pull-out, and integrated/designated ELD settings

• Adaptable for states like California, Texas, and beyond—where compliance, content, and language must align.

Meet the Authors!

Dr. Sandra Mercuri is a nationally and internationally recognized consultant in the areas of second language acquisition, dual-language education, and curriculum integration for biliteracy development.

Dr. Mercuri has over 30 years of experience teaching in K–12 schools and as a college professor in Argentina and the United States. She provides professional development for teachers, administrators, and parents on second language acquisition and bilingualism, dual-language education, translanguaging pedagogy, and ESL strategies.

Dr. Vivian Pratts is an experienced bilingual teacher, elementary principal, and bilingual/ESL PK–12 director. She has over 30 years of educational experience and is currently an educational consultant. Dr. Pratts provides professional development for parents, teachers, and administrators as well as coaching principals in the areas of leadership and second language acquisition. Her current research interests include translanguaging with emergent and experienced bilinguals, and how teachers can extend and support the linguistic repertoire of students.

Grade 3 Grade 3 Complete Set Includes:

•288 Student Texts (12 copies each of 12 titles in English, plus 12 copies each of those same 12 titles in Spanish)

•24 Teacher Resource Books (one for English as the target language and one for Spanish as the target language in each of the 12 grab-and-go kits)

El poder de la lectura™

El poder de la lecturaTM provides explicit and systematic instruction to extend the Spanish foundational skills and knowledge of young readers.

Discover the Difference!

• Lesson plans that are truly effective

• Equal mix of fiction and nonfiction student books

• Unparalleled writing component included in every lesson

The program includes seven curated collections of student books (Collections One through Three available now), each with a comprehensive Teacher Resource Book.

• Student texts are ideal for fluency practice and building content knowledge.

• The books are paired texts (one informational and one narrative). Each pair is supported by a Text Study Unit.

• Each collection of books is organized into topic sets.

Text Study Units build on students’ existing knowledge to create new knowledge networks and provide comprehensive teaching and learning activities related to the books. Unit lessons support fluency, comprehension, writing, and word building, and include avenues for making cross-linguistic connections. Students will be able to read, comprehend, build word knowledge, and write about the topic.

Also Available in English!

See page 15 for details

el-poder-de-la-lectura.myokapi.com

Visit our online store or find your rep at myokapi.com

Instruction

El poder de la lecturaTM is a structured Spanish literacy program built around a curated collection of student texts organized into topic sets.

Text Study Units build on students’ existing knowledge to create new knowledge networks and provide comprehensive teaching and learning activities related to the books. In the earliest stages, the units support decoding, fluency, comprehension, writing, and word building. Students will be able to read the books, understand what they read, build word knowledge, and write about the topic.

All instructions to the students are in Spanish.

Introducing the Paired Texts

Authentic texts that share the same topic; one is narrative and the other informational.

Phonological Awareness

Program emphasis on syllable types and syllable manipulation.

Phonics

Students review known letter–sound correspondences and continue to learn more challenging phonic code.

Content Knowledge

The more students know about a topic, the easier it is to make meaning when reading a text about that topic. Understanding the structure of a text also helps students read and comprehend it.

Build Vocabulary

A broad, rich vocabulary is strongly linked to reading comprehension. Each Text Study Unit includes key words to explicitly teach to students.

Fluency

Support is given to students as they read the texts.

el-poder-de-la-lectura.myokapi.com

Visit our online store or find your rep at myokapi.com

Writing

Teachers are supported as they explicitly teach students how to write using content they have just read.

Comprehension

For reading comprehension to occur, students must be able to decode the words in the text and they must be able to understand what they are reading about.

Word Building

Encourage students to read and write new words with a focus on spelling rules, adding articles, creating diminutives, and contractions.

Cross-Linguistic Connections

Content-based language instruction connects language development with meaningful academic content. Students expand their vocabulary and enhance comprehension by connecting concepts across Spanish and English.

Text Study UnitsProgram

COLECCIÓN UNO includes:

1 Teacher Resource Book and 168 Student Texts (six copies each of 28 titles).

Text Study Units include Los Animales, Los hábitats, Las personas y los animales, and Lo que hace la gente.

COLECCIÓN DOS includes:

1 Teacher Resource Book and 156 Student Texts (six copies each of 26 titles).

Text Study Units include Los Animales, Las plantas, Las personas y los animales, El medioambiente, and Cómo vive la gente.

El poder de la lectura™ includes writing instruction using the content students have just read to build fluency and confidence. Explicit support is provided to assist the students.

COLECCIÓN TRES includes:

1 Teacher Resource Book and 216 Student Texts (six copies each of 36 titles).

Text Study Units include Los Animales, Los hábitats, Vivir con tecnología, Vivir en Nuestro mundo, and La salud y la condición física.

ASSESSMENT

Four assessment tools are provided for each collection and are available on-line for complimentary downloading. Ideal for placing students within an Intervention program, these assessments make it possible for you to measure your students’ foundational skills, comprehension, and fluency.

El poder de la lectura™

The Text Study Units in El poder de la lectura™ build on students’ existing knowledge to create new knowledge networks. The units consist of explicit teaching instruction and comprehensive learning activities related to the books. They offer opportunities for students to read the texts, comprehend what they read, write about the topic, and build word knowledge.

TEXT STUDY UNITS SUPPORT

• Decoding and word recognition

• Vocabulary

• Fluency

• Content knowledge and text structure

COLECCIÓN UNO

COLECCIÓN DOS

COLECCIÓN TRES

• Comprehension

• Writing

• Word building

• Cross-linguistic connections

el-poder-de-la-lectura.myokapi.com

Visit our online store or find your rep at myokapi.com

Engaging Paired Texts

Each Text Study Unit in the El poder de la lectura™ program is built around one pair of texts connected by the same key concepts and sharing selected content vocabulary. The paired texts (one informational and one narrative) are ideal for fluency practice and building content knowledge.

™

Build Literacy Learning™

Build Literacy Learning TM Build Literacy LearningTM provides explicit and systematic instruction to extend the foundational skills and knowledge of young readers.

Build Literacy LearningTM is a program of seven curated collections of student books, each with a comprehensive Teacher Resource Book.

• Student texts are ideal for fluency practice and building content knowledge.

• The books are paired texts (one informational and one narrative). Each pair is supported by a Text Study Unit.

• Each collection of books is organized into topic sets.

Text Study Units build on students’ existing knowledge to create new knowledge networks and provide comprehensive teaching and learning activities related to the books. Units for each of the collections support fluency, comprehension, writing, and word building. Students will be able to read the books, understand what they read, build word knowledge, and write about the topic.

Students further develop their literacy skills with engaging, conceptually-rich texts as they move through the upper stages.

Build Literacy LearningTM contains writing instruction using the content students have read about to build fluency and confidence. Teachers are supported to explicitly instruct students how to:

• write a sentence

• punctuate a sentence

• expand a sentence

• combine sentences using conjunctions.

build-literacy-learning.myokapi.com Visit our online store or find your rep at myokapi.com

Program Components

COLLECTION ONE includes:

1 Teacher Resource Book and 168 Student Texts (six copies each of 28 titles).

Text Study Units include Animals, Habitats, People and Animals, and What People Do.

COLLECTION TWO includes:

1 Teacher Resource Book and 156 Student Texts (six copies each of 26 titles).

Text Study Units include Animals, Plants, People and Animals, The Environment, and How People Live.

COLLECTION THREE includes:

1 Teacher Resource Book and 216 Student Texts (six copies each of 36 titles).

ASSESSMENT

Text Study Units include Animals, Habitats, Living with Technology, Living in Our World, and Health and Fitness.

COLLECTION FOUR includes:

1 Teacher Resource Book and 288 Student Texts (six copies each of 48 titles).

Text Study Units include Living in Our World, People and Technology, Environments in Trouble, Health and Fitness, Animals, and Animal Features and Behaviors.

COLLECTION FIVE includes:

1 Teacher Resource Book and 324 Student Texts (six copies each of 54 titles).

Text Study Units include People and Animals, Looking After the Environment, Food and Water, Living in Our World, What People Do, and History and Culture.

COLLECTION SIX includes:

1 Teacher Resource Book and 216 Student Texts (six copies each of 36 titles).

Text Study Units include People and Animals, The Environment, How People Live, People and Places, and Health and Fitness.

COLLECTION SEVEN includes:

1 Teacher Resource Book and 216 Student Texts (six copies each of 36 titles).

Text Study Units include The Environment, Animals, Living in Our World, and People and Technology.

Four assessment tools are provided for each Collection and are available on-line for complimentary downloading. Ideal for placing students within an Intervention program, these assessments make it possible for you to measure your students’ decoding skills, comprehension, and fluency.

Collections

PHONIC CODE

• Common single letter-sound correspondences

COLLECTION

ONE (Early First Grade)

COLLECTION

TWO (Mid First Grade)

COLLECTION

THREE (Late First Grade/ Early Second)

COLLECTION

FOUR (Grade 2)

• Common consonant digraphs

• Common vowel sound correspondences

• Split vowel digraphs

• Vowel digraphs

• Uncommon consonant digraphs

• Some uncommon letter-sound correspondences

• R-controlled vowel sounds

• Further uncommon vowel and consonant letter-sound correspondences

• Further uncommon letter-sound correspondences

• Consonant digraphs where one sound is not pronounced (silent letter graphemes)

• Consonant digraphs that represent more than one sound

• Multisyllabic words

Limited range of high-utility words

Increase in the amount of high-utility words

Further high-utility words added

MORPHEMES

• Morphemes s, ing, and ed that don’t change the spelling of the base word

• Some contractions

• A wider variety of morphemes added to base words

• More contractions

COLLECTION

FIVE (Grade 3)

COLLECTION

SIX (Grade 4)

• Multisyllabic words with uncommon letter-sound correspondences

• Different vowel team representations for long vowels

• Letter–sound correspondences that represent two or more sounds

Large range of high-utility words

• Morphemes where the spelling of the base word changes

• Further variety of morphemes added to base words

• Morphemes added to more complex base words

• Words with multiple morphemes

• Homophones

• Compound words

• Using a hyphen when describing a noun

• Changing tense

• Using an apostrophe for possession

• Comparatives and superlatives

High-utility words related to topics

High-utility homophones

• Changing words from verbs to adverbs/ nouns

• Spelling rules when adding suffixes

• Compound words

• Homophones

• Adding a prefix/suffix to change the meaning of a word

• Word origins and meanings

• Uncommon phonic code

• Multisyllabic words with prefixes and/or suffixes, compound words

COLLECTION

SEVEN (Grade 5)

• Uncommon phonic code

• Uncommon graphemes

• Explaining how the meaning of words change when adding prefixes/suffixes to academic language from the book

• Changing adjectives into abstract nouns

• Changing nouns into adjectives

• Changing verbs into adverbs/nouns

• Word origins and meanings

• Change when adding prefixes/suffixes to academic language from the book

• Explaining spelling rules when adding suffixes

• Changing adjectives into adverbs

build-literacy-learning.myokapi.com Visit our online store or find your rep at myokapi.com

1617

Build Literacy

Instruction

Learning Build Literacy LearningTM is a structured literacy program built around a curated collection of student texts organized into topic sets.

Text Study Units build on students’ existing knowledge to create new knowledge networks and provide comprehensive teaching and learning activities related to the books. The units support fluency, comprehension, writing, and word building. Students will be able to read the books, understand what they read, build word knowledge, and write about the topic.

Paired Texts

Authentic texts that share the same topic; one is narrative and the other informational.

Introduce the paired texts

Say: These two books are about flamingos Flamingos is an informational text and Ruby in the Middle is a narrative text. The informational text is a report on what flamingos look like and what they do. The narrative text is a story about a flamingo called Ruby who never wants to be on the edge of the f lock

Flamingos

Phonological Awareness

Knowledge of syllables and how letters map to sounds underpins reading and writing development.

Phonics

Students review known letter–sound correspondences and continue to learn more challenging phonic code.

Content Knowledge

The more students know about a topic, the easier it is to make meaning when reading a text about that topic. Understanding the structure of a text also helps students read and comprehend it.

Say: Today we are reading this informational book called Flamingos. Before we do, we will practice our decoding skills and learn some new words to help us read the book.

Decoding and word recognition

Phonological awareness

Syllables

Say: The word flamingo has three syllables fla–min–go Now say flamingo without the first two syllables. Repeat with the word amazing Phoneme manipulation

Have students repeat a word after you. Ask them to change a sound and then say the new word. word changesound newword beak /k/ to /t/ beat lake /a–/ to /–/ like

★ Phonics

Review

Review the letters dge making the /j/ sound. Write the word edge on the whiteboard. Have students say the sounds they hear in edge: /e/ /j/. Say: The letters dge make the /j/ sound in the word edge List other words with this letter–sound correspondence. For example, bridge, hedge, and ledge. Have students write a word with the letters dge making the /j/ sound.

Teach

Teach words in the book with letter–sound correspondences that students may not have learned. build: the letters ui making the /i/ sound young: the letters ou making the /u/ sound

★ High-utility words

Review high-utility words such as because, could, and want using sound–letter charts.

★ Vocabulary

Teach the meaning of words that might be new to students in the context of how they are used in the text.

scoop (p. 8) To lift something up and out of something, like soup out of a saucepan

Example I used the spoon to scoop out a big serving of ice cream.

sift (p. 9) To separate things from a group by letting the smaller things fall out

Example I had to sift the flour so that there were no lumps in the cake mixture.

Text summary

Show the front cover of Flamingos. Say: Flamingos reports on what flamingos look like, what they eat, and how they raise their young.

Content knowledge

Build students’ content knowledge.

Say: A flamingo is a type of bird. Flamingos live on lakes. They get their food from the lake and build nests for their chicks in the mud on the edge of the lake. Flamingos have long legs, long necks, big beaks, and pink feathers.

Ask: What would you like to find out about flamingos?

Encourage students to share their ideas.

Text structure

Explain the text structure of the book.

Say: This book is an information report. The information is organized into three chapters.

Point out other features of the book such as the contents page, chapter headings and subheadings, introduction and conclusion, and index. Explain the purpose of each.

28 ★ See pages 9–12 for a detailed instructional sequence for each of these activities.

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

1819 Order today! 866.652.7436 or fax 800.481.5499

Build Vocabulary

A broad, rich vocabulary is strongly linked to reading comprehension. Each Text Study Unit includes key words to explicitly teach to students.

Fluency

Support is given to students as they read the texts.

Writing

Teachers are supported as they explicitly teach students how to write using content they have just read.

Fluency

Say: I am going to read aloud fluently. I will pause when I come to a period. Read aloud the introduction.

Have students read Chapter 1 independently. Support students where necessary. Check students’ understanding before they read the remainder of the book.

Students could then record themselves reading a chapter from the book using an audio-recording device. Have them listen back to the recording and think about how fluent and smooth their reading sounds. Say: As you read, pause when you come to a period.

Comprehension

Talk about the text

Use the following questions to check students’ understanding of what they have read.

What sort of water does a flamingo drink? How many eggs does a flamingo lay at a time? (Literal)

Why is it good for flamingos to live in a group? (Inferential)

How would the author have found out the information needed to write this book? (Critical)

Summarize

Say: I am going to think about what I now know about flamingos. I know what they look like. They have long legs, long necks, webbed feet, and a beak like a scoop.

Record these facts on the whiteboard.

Ask: What other facts did we learn by reading this report?

Discuss and record students’ ideas to summarize the main facts in the book.

Students can talk with a partner about what they learned about flamingos and then complete the Graphic organizer: Main facts.

See page 106 for the Graphic organizer: Main facts.

Writing

Writing a simple sentence

Write a simple sentence on the whiteboard. Flamingos drink fresh water.

Say: A sentence needs a subject and a predicate. The subject tells us what or who the sentence is about. The predicate tells us what the thing or person does.

Circle the word Flamingos in the sentence. Say: This sentence is about flamingos. The word Flamingos is the subject of the sentence.

Underline the words drink fresh water. Say: The words drinkfreshwater tell us what happens. They are the predicate. Write another simple sentence on the whiteboard. Flamingos fly with their large, strong wings.

Have students talk with a partner about what is the subject and predicate. Students share their ideas. Discuss and think aloud as you circle the subject (Flamingos) and underline the predicate (fly with their large, strong wings).

Have students write a sentence using the pattern of the modeled sentences: subject–predicate. For example, Flamingos scoop food from the water. Flamingos walk in the mud. Flamingos lay one egg. Students can share their sentences in small groups.

Word building

Word ladder

Have students create a word ladder by writing a word, then changing one letter in the word to create a new word. Provide clues for students to make each new word.

Say: Write the word nest. Change one letter in nest to make a word that means something you do when you’re tired. Students write the word rest

Ask students to change one letter in this word to create a new word. Say: Change one letter in rest to make a word that means nothing else is better. Students write the word best

Say: Change one letter in best to make a word that means a set of questions to find out a person’s knowledge. Students write the word test

Comprehension

For reading comprehension to occur, students must be able to decode the words in the text and they must be able to understand what they are reading about.

Word Building

Encourage students to read and write new words and learn how spelling rules, making compound words, and adding suffixes or prefixes change the meaning of words.

High-Utility Words

High-utility words are useful for students to know for reading and writing, yet students are not able to decode them because they have irregular spellings. These words need to be explicitly taught.

build-literacy-learning.myokapi.com

1819

Text Study Units to Build Knowledge Networks!

The Text Study Units in Build Literacy LearningTM build on students’ existing knowledge to create new knowledge networks. The units consist of explicit teaching instruction and comprehensive learning activities related to the books.

• Word recognition

• Vocabulary

• Content knowledge and text structure

• Fluency

• Comprehension

• Writing

• Word building.

Each Text Study Unit in the Build Literacy LearningTM program is built around one pair of texts connected by the same concepts and selected content vocabulary. The paired texts (one informational and one narrative) are ideal for decoding and fluency practice, and building content knowledge.

build-literacy-learning.myokapi.com Visit our online store or find your rep at myokapi.com

Packages and Pricing

(six

• 144 Student Texts (six copies each of 24 titles)

72 Perspectives Texts (six copies each of 12 titles)

• 1 Teacher Resource Book

• 144 Student Texts (six copies each of 24 titles)

• 72 Perspectives Texts (six copies each of 12 titles)

• 7 Teacher Resource Books

• 1332 Student Texts (six copies each of 222 titles)

• 252 Perspectives Texts (six copies each of 42 titles)

English-Language Resources for Grades Pre-K & Up

Our stellar lineup of literacy programs has at their core a solid base in literacy research, adherence to best teaching practice, and the ease-of-implementation that will have your classrooms experiencing real and lasting achievement!

For Phonics

Flying Start to Literacy: PHONICS™ is an exciting and stimulating program that will engage your students and support their literacy development.

Content is organized into three stages that follow a scope and sequence of skills and knowledge – from simple to complex. Engaging decodable texts follow the same sequence, and are scaffolded for independent practice of newly learned skills.

Also Available in Spanish! See page 101 for details

For Structured Literacy

Build Literacy Learning TM

Turn to pages 27-36 for more about Flying Start to Literacy: PHONICS™

Build Literacy Learning™ is a program of seven curated collections of student books, each with a comprehensive Teacher Resource Book. Organized into topical, content-rich Text Study Units, they build on students’ knowledge and provide comprehensive teaching and learning activities related to the books.

See pages 15-24 for more for more about Build Literacy Learning™

Also Available in Spanish! See page 9 for details

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

myokapi.com

Visit our online store or find your rep at myokapi.com

For Shared Reading

Launch young readers into literacy through rhyme, rhythm, repetition, and highly predictable texts. Enjoy reading together and revisiting familiar books again and again while students develop a love of reading that can last a lifetime.

Also Available in Spanish!

See page 109 for details

See pages 37-39 for more on award-winning Lift Off to Literacy™

For Small-Group Instruction

Flying Start to Literacy’s paired narrative and informational texts, which are linked by tightly connected ideas, work as paired texts should—reading one text enhances understanding of the other. Experience the difference that The Power of the Pair® can make in your students’ reading achievements!

Beginning at Level N*, Okapi has built on the paired-text concept with Perspectives (Levels N–V), an additional volume of short, point of view texts exploring the issues raised in the paired texts.

Also Available in Spanish!

See page 112 for details

For Content Areas

See pages 40-63 for the entire span of developmental reading stages of our award-winning Flying Start to Literacy™

Give your students a flying start to content-based literacy with WorldWise: Content-based LearningTM, a high interest, informational literacy resource that encourages inquiry and questioning while extending knowledge in STEM and social studies topics linked to the standards.

Also Available in Spanish!

See page 136 for details

Turn to pages 64-77 for more about WorldWise: Content-based Learning™

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexile Levels, visit worldwise-reading.myokapi.com

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

Order today! 866.652.7436 or fax 800.481.5499

Grades PreK–1

Flying Start to Literacy: PHONICS™

An exciting resource for explicit and systematic phonics instruction for young students. Flying Start

Flying Start to Literacy: PHONICS™ will engage your students and support their literacy development in ways that are based on research and are both meaningful and supportive.

All the key components of a rich Foundational Skills resource are covered. Students are encouraged to explore oral language with rhymes and chants, to build vocabulary, and to engage in phonological awareness activities. The program follows a scope and sequence of skills and knowledge from common sounds of consonants and vowels to less common letter-sound patterns. Each Teaching Unit supports the explicit and systematic teaching of phonological awareness, phonics, morphology, and high-utility words. Writing instruction is included in each unit, providing opportunities for teaching letter-sound knowledge.

Modules One, Two, and Three

Common sounds of consonants and vowels

Online Program Support!

Review Scope & Sequence, Correlations, and more at flying-start-phonics.myokapi.com/ program-support-materials

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish! See page 101 for details

Double letters, adjacent consonants, long vowels

• Teacher Resource Book

• The Big Book of Rhymes • Alphabet Cards • 30 Decodable Books

flying-start-phonics.myokapi.com

Visit our online store or find your rep at myokapi.com

The program’s decodable readers are listed among The Reading League’s Decodable Text Sources and are included in the UFLI recommended decodables

Stage OneStage

Each lesson in the Stage One Units provides instruction on:

• Oral language development and listening comprehension

• Building a rich vocabulary

• Phonological awareness: identifying and manipulating syllables and phonemes with spoken words

• Phonics: letter-sound relationships and word building

• Writing: forming lowercase and uppercase letters and words

• High-utility words

• Consolidated learning activities where students can practice new knowledge and skills

In Stage One—with the focus on introducing the alphabet—the decodable books are read at the end of each module.

• Module One’s nine letters and nine high-utility words are featured in the first set of books.

• Module Two’s eighteen letters and nineteen high-utility words are featured in the second set of books.

• The full alphabet with accompanying high-utility words are covered in Module Three’s decodable books.

Grades PreK–1

OneStage Two

In Stage Two, the basic structure of the lessons continues. Attention turns to:

• Double letters

• Adjacent consonants

• Long vowels

• Reading longer multisyllabic and compound words

• Morphology

In Stage Two, the Modules Four and Five decodable books can be read at the end of each Unit. Each book contains words with the letter-sound correspondence the students have just learned.

Paired informational and narrative texts are introduced in Module Four.

“When I learned that [Okapi’s] Decodable Readers were going to be available, I couldn’t wait to view them. Students respond to the knowledge building that these books supply. The quality of the literature and informational texts disguise the fact that these are decodable books.”

—D. Myers, Spokane Public Schools

flying-start-phonics.myokapi.com

2829

Visit our online store or find your rep at myokapi.com

Stage ThreeProgram

Stage Three focuses on less common letter sounds. Students further build their growing bank of high-utility words. Mastering this bank of high-utility words allows students to practice their new phonetic knowledge in the context of a sentence and in a longer, connected text.

In Stage Three, the Modules Six and Seven decodable books can be read at the end of each Unit.

Grades PreK–1

ThreeProgram Components

Teacher Resource Books

Flying Start to Literacy: PHONICS™ is anchored by the Teacher Resource Books—one for each stage—that offer comprehensive, explicit, and systematic instruction divided into three modules for Stage One, and two modules each for Stages Two and Three. Each Module concludes with a review of the letter-sound correspondences taught in that module.. Handsomely designed, with full color throughout, Teacher Resource Books are designed to be easy to follow and clear in their organization.

STAGE ONE

STAGE TWO

STAGE THREE

Modules One, Two, and Three

Modules Four and Five

Modules Six and Seven

Nine units and a review in Modules One and Two; eight units and a review in Module Three.

Nine units for a specific phonic focus and a review unit per Module.

Nine units for a specific phonic focus and a review unit per Module.

Decodable Books

TheBigBookofRhymes

TheBigBookofRhymes is a lively, oversized collection of shareable poems, lushly illustrated in full color. It provides a rhyme for each letter of the alphabet as it is introduced. Rhymes can be used in oral language activities, phonological awareness, building vocabulary, and identifying high-utility words.

Seventy titles in all—these Decodable Books have been carefully crafted to reinforce the skills presented in each module. Compelling texts with recurring groups of characters are offered for Modules One, Two, and Three. Paired informational and narrative texts are introduced in Module Four. Teaching Notes included in every book offer invaluable support for using the texts as part of the overall instructional process. The student texts are 100% decodable when the sequence of instruction has been followed.

Alphabet Cards

Double-sided Alphabet Cards feature a picture on one side and the picture with its letter correspondence on the reverse. Colorful, laminated, and sturdy, these cards will withstand countless hours of student interactions.

3031

flying-start-phonics.myokapi.com Visit our online store or find your rep at myokapi.com

Instruction

Flying Start to Literacy: PHONICS™ teaches phonics in a systematic and explicit process along with five other key components required for literacy development: oral language, phonological awareness, fluency, vocabulary, and comprehension.

Oral Language Development

Extend oral language awareness by using letter-sound chants and rhymes focusing on the rhythm, rhyming words, clapping and clicking the syllables, hearing sounds in words, and by using varied oralreading expression, such as loud and soft/fast and slow.

Phonological Awareness

Develop phonological awareness through auditory activities that focus on the sound of the letter introduced in the unit.

Vocabulary

Find a word or words in the rhyme to explicitly teach to your students. Define the word using student friendly language.

Alphabet Review

Progressively review letter-sound correspondences to practice retrieving information.

flying-start-phonics.myokapi.com

Visit our online store or find your rep at myokapi.com

Grades PreK–1

Teaching Units follow the same structure throughout the program. Content is appropriate for the level of the students at each stage in the program.

High-Utility Words

High-utility words are useful, and many of these need to be taught explicitly. Sound-letter charts are used for explicit instruction of high-utility words.

Phonics

Encourage students to connect a sound to a letter and to write the letter in uppercase and lowercase.

Consolidate Learning

Activities for students (individually, in pairs, or small groups) to practice new knowledge and skills that will help them to develop accuracy and automaticity when reading and writing.

What to expect from Flying Start to Literacy: PHONICS™

A CLEARLY DEFINED PROGRESSION IN THE SCOPE AND SEQUENCE

• The Scope and Sequence moves from simple letter-sound correspondences to more complex.

• The sequence provides time for foundation skills to be established.

• Clearly defined goals for each Teaching Unit (and each activity within the unit) are a feature of the program.

• Recently taught letters and sounds are carefully reviewed.

• There are ample practice and application opportunities for student accuracy and confidence.

INSTRUCTION IN FOUNDATIONAL SKILLS: PHONOLOGICAL AWARENESS

Phonological awareness is linked to the focus of each Teaching Unit—as in “Say rat.” “Now say rat without the /r/.” “Yes, at.”

PHONICS

• Teaching goals for letter-sounds are explicitly stated.

• Words with the target letter-sound occur in wordbuilding activities.

• A writing activity is part of each Teaching Unit.

• Practice sentences that feature the focus letter-sound provide students with opportunities to decode and practice reading words with the letters and sounds they have learned.

ORAL LANGUAGE

• Multiple activities are used for the review and practice of the letter-sounds:

o Dictation of words occurs in units and reviews.

o Sound-letter charts are used for multisensory learning of letter-sounds.

o Clear images for each letter-sound can be used in activities in daily review.

Oral language involves listening comprehension and underpins reading and writing.

VOCABULARY

• Vocabulary development of new words occurs in each lesson.

• Vocabulary is linked to comprehension.

• Vocabulary used in chants and rhymes is defined.

ABOUT THE AUTHOR

Dr. Susan Hill is an Associate Professor of Early Childhood Education. An acclaimed researcher in the field of early language and literacy, she is the author of a number of books for teachers including Developing Early Literacy: Assessment and Teaching (Third Edition), research articles and chapters for the Handbook of Research on the Education of Young Children, the Handbook of Research Methods in Early Childhood Education, and Contemporary Perspectives on Research in Assessment and Evaluation in Early Childhood Education

HIGH UTILITY WORDS

• Useful words for reading and writing are taught and analyzed using sound-letter charts (orthographic mapping).

MORPHOLOGY AND SPELLING RULES

• Word building is developed.

• Morphological awareness builds word awareness.

ASSESSMENT

• Systematic reviews of content newly taught within each Teaching Unit.

• Further rigorous reviews are provided at the end of each Module.

DECODABLE BOOKS

• Decodable books provide practice for the phonics skills taught in each lesson.

• The books have engaging content and illustrations.

• From Stage Two onward, the decodable texts are paired informational and fiction books.

• Each book has easy-to-use Teaching Notes at the back of the text.

FLUENCY

• Fluency is encouraged in multiple readings of decodable books.

• Fluency and accuracy of letter-sounds and letter names is encouraged.

COMPREHENSION

• Listening comprehension is emphasized.

• Meaning-making occurs in fiction and informational texts.

• The addition of new words and the revisiting of those already taught occurs in teaching units and decodable texts.

• Activities for building words are provided.

• Comprehensive one-on-one Assessments are provided for each Stage.

• Decodable books are provided for each Module to check for decoding, fluency, and comprehension skills.

• Comprehension questions are literal, interpretive, and evaluative.

• The phonic focus is easy to identify in the decodable books, and is repeated within the book.

• The decodable books align with the scope and sequence.

• Practice and accurate reading and writing of the lettersounds is essential.

• Content knowledge is developed in informational texts.

• Fluency is built to support comprehension.

3435 flying-start-phonics.myokapi.com Visit our online store or find your rep at myokapi.com

Packages and Pricing

Add to your Complete Resource purchase with one-year digital access to all program components on Okapi Digital LiteracyTM for just $550! Use code OD FSPHST01-03 when ordering.

FREE Downloadable Materials to Support Instruction!

Essential instructional components are available for free downloading from the Okapi Digital Literacy™ platform. Helpfully organized by Stage and Module, each unit’s downloads provide everything you will need to place in students’ hands for reading, writing, and assessment.

Lift Off to Literacy™

Using a Shared Reading Approach

Develop early literacy skills through rhyme, rhythm, repetition, and highly predictable texts!

Your students will:

• enjoy reading together and revisiting familiar books again and again

• begin to recognize and read high-frequency words

• build knowledge of key vocabulary

• understand conventions of print.

Big Books

Eighteen appealing Big Books—stories, rhymes and informational texts:

•capture the readers’ attention and ensure group participation and engagement

•are ideal to introduce early literacy skills and concepts of print

•use rhyme, rhythm and repetition in the narrative titles

•introduce science and mathematics concepts in the informational texts

•link to the Vocabulary Starters.

Vocabulary Starters

•Sturdy, laminated cards with seven folding panels

•Unambiguous, full-color photographs introduce key vocabulary words

•Back of cards provide a variety of suggestions for introducing and reusing new words

Small Books

Small-book versions of the Big Books extend the shared reading experience. Using the Reading Pen for audio support, students listen and read along.

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

Visit our online store or find your rep at myokapi.com

Lesson Plan Cards and Program Overview

Easy-to-follow lesson plan cards are provided for each Big Book. These plans include explicit instruction to guide teachers through multiple readings of the text.

When revisiting the book, there are suggestions for modeling and teaching specific foundational skills. These skills include:

•phonemic awareness •phonics •oral language

•fluency •print concepts

•modeled writing

Program Overview includes Research Base, Standards Alignment, Progress Assessment, Scaffolding Tips, and more.

Reading Pens

The Reading Pens are preloaded with recordings of all 18 Lift Off to LiteracyTM titles. Touch the tip of the pen to the cover of a small-book version, then to any page, and hear that page read aloud. The pens:

•are durable, safe and easy to use

•enable readers to listen and follow text, reinforcing key vocabulary and foundational skills

•encourage listening and reading enjoyment

•provide encouragement and motivation for students who need additional support

•are excellent support for English Language Learners.

The link between Lift Off to Literacy TM Shared Reading books and Vocabulary Starters will enable your students to be familiar with the content and vocabulary of the paired texts at levels A and B of the Flying Start to Literacy TM program. When appropriate, they can move on to this next stage of the Flying Start to Literacy TM program for explicit reading instruction.

Rich language input and explicit literacy instruction give young English Learners a strong lift off to reading in English.

to Literacy™

Flying Start to Literacy™ The Award-Winning K–5 Literacy Resource

Program Overview

Flying Start to Literacy™ is an award-winning, highly flexible classroom resource that scaffolds students from shared reading to small group reading and ultimately to independence through best teaching practice and a solid grounding in reading research.

Flying Start to Literacy™ supports the systematic development of reading strategies and skills in beginning and developing readers:

• key vocabulary acquisition

• high-frequency words

• text complexity

• text types

• phonics and phonemic awareness

• fluency and comprehension

• the links between reading and writing

• assessment for instruction.

Paired Texts

Levels A–V

Flying Start to Literacy™ nurtures students across nine developmental reading stages (Early Emergent through Advanced Fluent) by its innovative use of thoughtfully linked pairs of books. Each of these pairs (one narrative and one informational) are connected by their shared high-frequency words, content vocabulary, and—especially—the big idea that unites them.

This compelling structure provides countless opportunities for students to make connections while thinking and talking their way purposefully through texts.

Paired Books connect meaningful information and appealing narratives and engage learners with content-rich reading.

• Before-, During-, and After- Reading activities

• Full spectrum of foundational instruction with ongoing assessment

• Synthesizing activities to reinforce key concepts in each pair of texts

Perspectives

Point of View Texts at Levels N–V

Perspectives are teamed with the paired books to create a dynamic, three-book concept set. Lesson Plans are provided for each Perspectives title, setting the stage for exciting classroom conversations and writing.

Vocabulary Starters

Shared Reading and Levels A–B

Vocabulary Starters provide direct reading support at the Early Emergent Stage.

• Sturdy, laminated cards with seven folding panels

• Unambiguous, full-color photographs introduce key vocabulary words

• Reverse side of each card provides a variety of suggestions for introducing and reusing new words

Lesson Plan Cards

Shared Reading and Levels A–V

Lesson Plan Cards deliver explicit, systematic instruction with diagnostic support built in.

• Before-, During-, and After- Reading activities

• Full spectrum of foundational instruction with ongoing assessment

• Synthesizing activities to reinforce key concepts in each pair of texts

Take-Home Books

Levels A–P

Six copies each of affordable black-and-white versions of 146 of the Student Titles (one title from each pair).

• Additional reading and writing activities for home

• An easy-to-implement opportunity for parental involvement

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

Visit our online store or find your rep at myokapi.com

Flying Start to Literacy™ Small Group Reading Instruction

Flying Start to Literacy™ Lesson Plan Cards:

•provide practical, systematic, and easy-toimplement instructional plans

•integrate (at the beginning reading stages) oral language, comprehension, phonemic awareness, phonics, vocabulary development, fluency, and writing

•include ongoing assessment and follow-up activities

•support ELL instruction with a highlighted section in every lesson plan

•offer assurance that instructional goals are being met, with standards links on the front of every card.

Before Reading

•Activate prior knowledge through a variety of engaging suggestions

•Introduce challenging or unfamiliar vocabulary

•Focus on reading strategies specific to the book

During Reading

•Monitor and support each student’s reading

•Revisit specific reading strategies as needed

•Guide students as they apply these strategies

After Reading

•Use discussion prompts to encourage collaborative conversations about the book

•Ask students to return to the text for evidence to support their responses

•Provide positive feedback on students’ use of the lesson’s reading strategies

Returning to the Book

•Develop fluency with modeling, paired practice, and independent re-reading

ReadingStrategies

Monitoring readingstrategies

•Work with words through a variety of suggestions for building phonemic awareness and reinforcing phonics

•Connect reading and writing with teacher modeling and prompts for student practice

Synthesizing the Pair

•Discussion prompts encourage students to consider the pair’s “big idea”

•Reproducible Activity Cards offer creative suggestions for exploring the topic further

•Blackline Masters provide opportunities for ongoing assessment

Grades K–5 • Levels A–V (1–50)*

Vocabulary development FOCUS

Closereading oftexts

Paired fiction and informational texts, photographic Vocabulary Starters, and English Learner instructional support bring reading success for ELs at all levels.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Also Available in Spanish! See page 112 for details

Complete Resource | Nine Reading Stages, Levels A–V (1–50)*

• 2040 Paired-Text Student Books (6 copies each of 340 titles)

• 252 Perspectives Texts (6 copies each of 42 titles)

• 170 Paired-Text Lesson Plan Cards (1 for each pair of titles)

• 42 Perspectives Lesson Plan Cards (1 for each title)

• 876 Take-Home Books (6 copies each of 146 titles)

• 24 Vocabulary Starters

• 19 Storage Boxes

Writingusingevidence fromthetext

Watch the Program Overview video!

Price without Shared Reading: OK FSAVK520-NOSR National List Price: $19,694 |Your Price $17,100

Add a 12-month school-wide Okapi Digital LiteracyTM license for LiftOfftoLiteracyTM!

OD FSAVK500 | Your Price $3,150

With Lift Off to LiteracyTM (shared reading) included: OK FSAVK520 National List Price: $22,056 |Your Price $19,050

Add a 12-month school-wide Okapi Digital LiteracyTM license for FlyingStarttoLiteracyTM plus Shared Reading!

OD FSAVK500+SR | Your Price $3,600

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

flying-start.myokapi.com

Visit our online store or find your rep at myokapi.com

Early Emergent Reading Stage

Paired, Connected Texts at This Stage:

•Establish a full range of concepts about print

•Introduce common stems and vocabulary

•Introduce the first 26 high-frequency words

•Focus on phonemic awareness and phonics

•Build comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish!

See page 116 for details

Unique to the Early Emergent Stage – a Vocabulary Starter is provided for each pair of titles. It introduces the written form of key vocabulary through unambiguous, labeled photographs. Suggestions for introducing and reusing vocabulary words are included on the back of each Vocabulary Starter.

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

• 288 Student Books (6 copies each of 48 titles)

• 24 Lesson Plan Cards (1 for each pair of titles)

• 24 Vocabulary Starters (1 for each pair of titles)

• 144 Take-Home Books (6 copies each of 24 titles)

• 2 Storage Boxes

Early Emergent Reading Stage National List Price

Guided Reading Levels A–B (1–2)*

Add a 12-month school-wide OkapiDigitalLiteracyTM license for this stage!

Early Emergent Reading Stage 12-Packs | Levels A–B (1–2)*

My Body / Here I Am! The Body Vocabulary Starter OK FSEE1250-12

I Look at the Fruit / Eating Fruit Fruit Vocabulary Starter OK FSEE1290-12

Pets at Home / My Pet Pets Vocabulary Starter OK FSEE1010-12

Me / Dogs Doing Things Vocabulary Starter OK FSEE1050-12

In the Garden / Wow! Look at That Mini Beasts Vocabulary Starter OK FSEE1070-12

Where Are the Animals? / Animals at the Zoo Zoo Animals Vocabulary Starter OK FSEE1110-12

OK FSEE1018

$2,373 | Your Price $2,195

OD FSEE1018 Your Price $350

| $86.00 per package

12-Packs include 6 copies of each paired text plus lesson plan card and Vocabulary Starter. (National List Price: $92.40 per package)

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com. Guided Reading Level A (1)*Guided

What Shape Can You See? / Shapes Around Us / Shapes Vocabulary Starter OK FSEE1270-12

What’s at the Beach? / A Day at the Beach At the Beach Vocabulary Starter OK FSEE1370-12

Hide and Seek / My Birthday My Family Vocabulary Starter OK FSEE1030-12

In My Neighborhood / People Who Help Me People Who Help Us Vocabulary Starter OK FSEE1390-12

My Toys / Getting Around Movers Vocabulary Starter OK FSEE1090-12

Animal Babies / What Can You See? Baby Animals Vocabulary Starter OK FSEE1410-12

On My Bike / Can You Go Here? Position Vocabulary Starter OK FSEE1310-12

The Dress-up Box / Going Shopping Clothes Vocabulary Starter OK FSEE1350-12

Looking at You / Animals

OK FSEE1130-12

OK FSEE1170-12

Fish / Come and Look! Colors Vocabulary Starter OK FSEE1190-12

At Grandpa’s House / Cakes for Sale At School Vocabulary Starter OK FSEE1330-12

What’s the Weather Today? / I Like the Weather The Weather Vocabulary Starter OK FSEE1430-12

OK FSEE1150-12

OK FSEE1210-12

OK FSEE1230-12

flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

OK FSEE1470-12

Emergent Reading Stage

Paired, Connected Texts at This Stage:

•Revisit key vocabulary

•Revisit and extend high-frequency words

•Build comprehension and fluency through a range of reading strategies

•Introduce phonologically regular vocabulary (all words with short vowels).

Online Program Support! Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Look Inside the Book! Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish! See page 118 for details

“I like to dig,” said Turtle. “I will dig a big nest. I will dig down, down, down.”

• 240 Student Books (6 copies each of 40 titles)

• 20 Lesson Plan Cards (1 for each pair of titles)

• 120 Take-Home Books (6 copies each of 20 titles)

• 2 Storage Boxes

Guided Reading Levels C–D (3–6)*

Emergent Reading Stage OK FSEM2000 National List Price (Print Only) $1,817 | Your Price $1,685

Add a 12-month school-wide OkapiDigitalLiteracyTM OD FSEM2000 license for this stage! Your Price $350

Emergent Reading Stage 12-Packs | Levels C–D (3–6)* | $78.00 per package 12-Packs include 6 copies of each paired text plus lesson plan card. (National List Price: $84.00 per package)

Guided Reading Level C (3)*

OKFSEM2250-12

Looking for Animals / Where Is Frog?

OKFSEM2290-12

Look at My Clothes / Where Is My Mother?

OKFSEM2330-12

OKFSEM2370-12

OKFSEM2010-12

OKFSEM2270-12

Is

Guided Reading Level C (4)*

OKFSEM2070-12

OKFSEM2310-12

OKFSEM2030-12

OKFSEM2090-12

Guided Reading Level D (6)*

What Do Bats Eat? / Big Bat’s Lunch OKFSEM2350-12

Ant Nests / Where Is My Nest? OKFSEM2130-12

OKFSEM2190-12

Lots of Legs / The Best Legs OKFSEM2150-12

OKFSEM2210-12

OKFSEM2050-12

OKFSEM2110-12

My Camp Journal / A Monkey in the Camp OKFSEM2170-12

OKFSEM2390-12

OKFSEM2230-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

Guided Reading Levels E–F (8–10)*

Early Reading Stage

Paired, Connected Texts at This Stage:

•Revisit key vocabulary

•Revisit and extend high-frequency words

•Carefully introduce new, phonologically regular vocabulary

•Build comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish! See page 120 for details

• 240 Student Books (6 copies each of 40 titles)

• 20 Lesson Plan Cards (1 for each pair of titles)

• 120 Take-Home Books (6 copies each of 20 titles)

• 2 Storage Boxes

Early Reading Stage

Guided Reading Levels E–F (8–10)*

OK FSEA3000 National List Price (Print Only) $1,817 | Your Price $1,685

Add a 12-month school-wide OkapiDigitalLiteracyTM OD FSEA3000 license for this stage! Your Price $350

Early Reading Stage 12-Packs | Levels E–F (8–10)* | $78.00 per package 12-Packs include 6 copies of each paired text plus lesson plan card. (National List Price: $84.00 per package)

Guided Reading Level E (8)*

Insects / Where Are the Grapes?

OKFSEA3010-12

When the Sun Comes Up / When the Sun Is Going Down OKFSEA3070-12

Bat Rescue / Sally and the Bats OKFSEA3130-12

Animals That Need Mud / Mud, Mud, Mud!

OKFSEA3190-12

Squid / Big Squid and Little Squid OKFSEA3030-12

Our Spot / Where Can We Play? OKFSEA3090-12

The Great Cake Bake-off / A Cake for Cuddles OKFSEA3250-12

Looking After Your Frogs / Frog’s New Pond OKFSEA3110-12

Super Dogs / Nosey Saves the Day! OKFSEA3270-12

Charlie and the Crocodiles / Don’t Eat Me! OKFSEA3290-12

Guided Reading Level F (10)*

Teach Me How / Little Cub OKFSEA3150-12

Keeping Safe / Looking for Lunch OKFSEA3210-12

Keep Safe at the Beach / Sally’s Beach Rescue OKFSEA3330-12

Big Ships Need Tugboats / The Tugboat Team OKFSEA3230-12

Amazing Caterpillars / Caterpillars for Lunch OKFSEA3350-12

Looking After Ostrich Chicks / Father Ostrich and the New Chicks OKFSEA3370-12

The Plum Tree / My Tree OKFSEA3050-12

Big Homes, Little Animals / Tiff

OKFSEA3310-12

The Jump Rope Team / The Fun Run OKFSEA3170-12

Rides for Everyone / At the Fun Park OKFSEA3390-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

Transitional Reading Stage

Paired, Connected Texts at This Stage:

•Increase the complexity of language structures

•Revisit and extend high-frequency words

•Carefully introduce new, phonologically regular vocabulary

•Further develop comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish!

See page 122 for details

• 240 Student Books (6 copies each of 40 titles)

• 20 Lesson Plan Cards (1 for each pair of titles)

• 120 Take-Home Books (6 copies each of 20 titles)

• 2 Storage Boxes

Guided Reading Levels G–H (12–14)*

Transitional Reading Stage OKFSTR4000 NationalListPrice(PrintOnly) $1,817 | Your Price $1,685

Adda12-month school-wide OkapiDigitalLiteracyTM ODFSTR4000 licenseforthisstage! Your Price $350

Transitional Reading Stage 12-Packs | LevelsG–H(12–14)*| $78.00 per package 12-Packs include 6 copies of each paired text plus lesson plan card. (National List Price: $84.00 per package)

Guided Reading Level G (12)*

What’s for Breakfast? / The King’s Breakfast OK FSTR4010-12

Clever Tails / The Monkey’s Tail OK FSTR4070-12

Insect Eaters / I’m Hungry OK FSTR4130-12

Sea Otters and the Kelp Forest / The Luck of the Sea Otters OK FSTR4190-12

The Skating Club / Elly Goes Skating OK FSTR4030-12

Creepers and Climbers / Growing Watermelons OK FSTR4090-12

Insect Hunt / Getting Rid of Insects OK FSTR4250-12

Making Friends / The Blue Crane OK FSTR4110-12

A Frog in a Pond / Too Cold for Frog OK FSTR4270-12

Summer Vacation / Camping with Dad OK FSTR4290-12

Guided Reading Level H (14)*

Animals in Caves / There’s Gold in That Cave OK FSTR4150-12

Monsoon Rain / The Wise Bird OK FSTR4210-12

Fantastic Bridges / Jack the Explorer and the Hidden City OK FSTR4330-12

No More Trash / The Rock of Killeen OK FSTR4230-12

Caring for a Baby Monkey / Baby Squirrel Rescue OK FSTR4350-12

Hurricane Scrapbook / Where Is Coco? OK FSTR4370-12

Hiking / Maddy and the Prince OK FSTR4050-12

Manta Rays / The Ray Who Wanted to Fly OK FSTR4310-12

The Wreck of the Maitland / The Great Paddleboat Race OK FSTR4170-12

What Do Plants Need? / The Great PumpkinGrowing Contest OK FSTR4390-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

Guided Reading Levels I–J (16–18)*

Early Fluent Reading Stage

Paired, Connected Texts at This Stage:

•Support sustained reading with chapter books

•Increase the conceptual load

•Increase complexity of language structures

•Include less common letter combinations in the vocabulary

•Develop comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Also Available in Spanish!

See page 124 for details

Look Inside the Book! Review digital samples of books and lesson plans at myokapi.com/digital-samples Let us

• 240 Student Books (6 copies each of 40 titles)

• 20 Lesson Plan Cards (1 for each pair of titles)

• 120 Take-Home Books (6 copies each of 20 titles)

• 2 Storage Boxes

Guided Reading Levels I–J (16–18)*

Early Fluent Reading Stage OKFSEF5000 NationalListPrice(PrintOnly) $2,100 | Your Price $1,950

Adda12-month school-wide OkapiDigitalLiteracyTM ODFSEF5000 licenseforthisstage! Your Price $350

Early Fluent Reading Stage 12-Packs | LevelsI–J(16–18)*| $90.00 per package 12-Packs include 6 copies of each paired text plus lesson plan card. (National List Price: $96.60 per package)

Animal Smells / Angus Cleans Up OK FSEF5010-12

Ouch! That Hurts / That’s Not Funny, Charlie! OK FSEF5290-12

OK FSEF5130-12

You Can Make a Difference! / Save the Sea Otters! OK FSEF5370-12

Motorcycles / A New Job for Stan OK FSEF5250-12

Living Near a Volcano / Volcano Alert! OK FSEF5070-12

OK FSEF5330-12

Cleaning Up Our Wetland / The Baby Swans OK FSEF5190-12

Guided Reading Level I (16)*

and Dangerous Plants / Looking After

OK FSEF5030-12

Flamingos / Ruby in the Middle OK FSEF5310-12

When Lions Hunt / Rory’s Dance OK FSEF5270-12

New Life / Gasari’s Herd OK FSEF5090-12

Amazing Snakes / The Snake Olympics OK FSEF5050-12

Message Sent / Saving Dad OK FSEF5110-12

Guided Reading Level J (18)*

Food to Make and Eat / The Queen’s New Chef OK FSEF5150-12

Elephants / Brother Elephant OK FSEF5390-12

Surviving in the Frozen Forest / How Moose Learned to Swim OK FSEF5350-12

Swimmers / The Lucky Fishing Hat OK FSEF5210-12

Deep in the Sea / A Deep Sea Adventure OK FSEF5170-12

Robots Today, Robots Tomorrow / Robots Run Wild OK FSEF5230-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

5253 flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

Fluent Reading Stage

Paired, Connected Texts at This Stage:

•Support sustained reading with chapter books

•Increase the conceptual load

•Increase the complexity of language structures

•Include less common letter combinations in the vocabulary

•Develop comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Also Available in Spanish! See page 126 for details

Look Inside the Book! Review digital samples of books and lesson plans at myokapi.com/digital-samples Let us

• 288 Student Books (6 copies each of 48 titles)

• 24 Lesson Plan Cards (1 for each pair of titles)

• 144 Take-Home Books (6 copies each of 24 titles)

• 2 Storage Boxes

Guided Reading Levels K–M (20–28)*

Fluent Reading Stage OKFSFL6000 NationalListPrice(PrintOnly) $2,512 | Your Price $2,325

Adda12-month school-wide OkapiDigitalLiteracyTM ODFSEF6000 licenseforthisstage! Your Price $350

Fluent Reading Stage 12-Packs | LevelsK–M(20–28)*| $90.00 per package 12-Packs include 6 copies of each paired text plus lesson plan card. (National List Price: $96.60 per package)

Amazing Gardens / The Giant’s Garden OK FSFL6010-12

Polar Bears / A Bear Called Trouble OK FSFL6030-12

Looking After Tide Pools / The Smart Little Crab OK FSFL6050-12

Driver Ants / Killer Ants OK FSFL6070-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com. Guided Reading Level K (20)*Guided

Basketball Basics / Alex Stands Tall OK FSFL6250-12

Animal Show-offs / The Too-tight Tutu OK FSFL6270-12

Surviving the Flood / The Great Flood of Dusty Plains OK FSFL6290-12

A Long Day at the River / The Crocodile and the Plover OK FSFL6310-12

Animals That Store Food / A Tale of Two Squirrels OK FSFL6090-12

I Am an Inventor / Gabby’s Fast Ride OK FSFL6110-12

The Right Tools for the Job / Arnold Saves the Day OK FSFL6130-12

The First Flight / The Balloon Adventure OK FSFL6150-12

Meerkats at Work / Anwar, the Very Bright Meerkat OK FSFL6330-12

Protect the Oceans: Act Locally / The Kingdom of Bloom OK FSFL6350-12

My Faraway Home / The Last Lighthouse Keeper OK FSFL6370-12

Designed for Speed / The Sleeping Prince OK FSFL6390-12

Body Works / The Mystery Trip OK FSFL6170-12

Built by Hand / Dr. Zardos and the Mind Stone OK FSFL6190-12

Living in Space / Space Camp OK FSFL6210-12

Marathon Journal / The Marathon Man OK FSFL6230-12

Polar Bears and the Arctic Sea Ice / Atka’s Ice Adventure OK FSFL6410-12

Hummingbirds / The Kiss of a Hummingbird’s Wing OK FSFL6430-12

The Great Railroad Race / The Legend of Jimmy Drake OK FSFL6450-12

Frost / The Smallest Smudger OK FSFL6470-12

5455 flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

Paired Texts and Perspectives

“Learners will love the selection of short, authentic texts: posters, photographs, vox pops, interviews, arguments, personal recounts, reports, and primary source documents. And, teachers will love the resulting bursts of language, deep thinking, and powerful persuasive writing.“

—LindaHoyt,SeriesConsultant

Leveled texts partner with Perspectives collections to build and extend students’ understanding of timely concepts.

Issue: Disappearing Rainforests

Paired Texts Lesson Plan: Sequence

• Exploring Vocabulary

• Establishing Strategy Focus

• Reading with Teacher Support

• Working with a Partner

• Quick Writing

• Talk About the Book

• Vocabulary Reflection

• Strategy Reflection

Perspectives Lesson Plan: Sequence

• Inquiry

• Independent Partner Work

• Thinking and Talking Circles

• Reading Closely

• Writing a Persuasive Argument

Through the teaching and learning model embedded in the lesson plans, students build a metacognitive understanding of their own learning process.

Perspectives texts develop English Learners’ oral language, critical thinking, writing skills, and ability to express opinions and ideas.

Everything you love about Flying Start to LiteracyTM …

Beginning with the Fluent Plus stage, we continue our award-winning formula of pairing a narrative text with an informational text, both connected by the same big idea.

Informational texts present the big ideas around a concept. They go beyond readers’ personal experiences and include a range of features including primary sources that support the text.

Narrative texts reflect the big ideas through their characters and plots. They feature plots with subplots, non-sequential treatment of time, and a range of literary devices.

Lesson Plans for the pair encourage higher-level thinking and provide opportunities for students to write in response to both the text and to their collaborative conversations.

…plus Perspectives—short, point of view texts exploring the issues raised by the big ideas in the paired texts.

Extend students’ thinking with additional views of the issues introduced in the paired texts.

Perspectives contain short texts in a magazinestyle format and include posters, arguments, discussions, letters, and visual images.

Perspectives Lesson Plans engage and support students in critical discussions, and in recognizing different points of view. Performance task cards provide opportunities to demonstrate comprehension.

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

5657

Guided Reading Levels N–P (30–38)*

Fluent Plus Reading Stage

Paired, Connected Texts at This Stage:

•Support sustained reading with chapter books

•Increase the use of more specialized and technical language

•Use literary language

•Encourage drawing inferences from the text.

Perspectives Texts at This Stage:

•Present issues related to the paired texts

•Introduce the thinking and talking circle to promote deep discussion

•Promote close reading.

Review digital samples of books and lesson plans at myokapi.com/digital-samples Lesson Plans

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Look Inside the Book!

•216 Student Books (6 copies each of 36 titles)

•18 Paired-Text Lesson Plan Cards (1 for each pair of titles)

•108 Perspectives Books (6 copies each of 18 titles)

•18 Perspectives Books Lesson Plan Cards (1 for each title)

•108 Take-Home Books (6 copies each of 18 titles)

•3 Storage Boxes

Guided Reading Levels N–P (30–38)*

Fluent Plus Reading Stage OKFSFP7019 NationalListPrice(PrintOnly) $2,993 | Your Price $2,770

Adda12-month school-wide OkapiDigitalLiteracyTM ODFSFP7019 licenseforthisstage! Your Price $350

Fluent Plus Reading Stage 18-Packs | LevelsN–P(30–38)*| $145.00 per package

18-Packs include 6 copies of each paired text, 6 copies of the Perspectives book, and 2 lesson plan cards. (National List Price: $156.45 per package)

Guided Reading Level N (30)*Guided Reading Level O (34)*

Amazing Salamanders / Salamander Surprise! / Owning a Pet: What Should You Think About?

OK FSFP7010-18

Food Rescue / The King of Waste / Stop Wasting Food!: How Can We Do It?

OK FSFP7050-18

Famous Finds / The Lost Tomb / What Is Treasure?: What Do You Value?

OK FSFP7250-18

Corn Crazy / The Great Corn Invention / Food: What’s Good? What’s Bad?

OK FSFP7030-18

Saving Wild Wolves / Wolf Secret / The Big, Bad Wolf: True or False?

OK FSFP7070-18

Working in the Wild / The Goodmans Go Camping! / Wildlife in the City: Why Should We Protect It?

OK FSFP7270-18

Deadly Venom: Killer or Cure? / The Stubborn Princess / Dangerous Animals: What Do You Need to Know?

OK FSFP7090-18

The Question of Water / Ming Saves the Day / Water: The Key to Life

OK FSFP7130-18

Nature’s Red Flags / Bring Back the Frogs! / Mini Beasts: The Good, the Bad, and the Ugly

OK FSFP7290-18

Riding the Waves / Wipe-out! / Being Brave: What Does It Mean?

OK FSFP7110-18

Seasons in the Kelp Forest / Thunder Cave / Planet Ocean: How Important Is It?

OK FSFP7150-18

Dragons / Dragon Tales / Scary Stories: The Scarier the Better?

OK FSFP7310-18

Guided Reading Level P (38)*

Incredible Underground Homes / The Wild Caves / Places People Live: When Is a Home a Home?

OK FSFP7170-18

We Must Protect Old-Growth Forests / Dan’s Trees / Trees: Why Do We Need Them?

OK FSFP7210-18

The Plastic Plague / The Plastic-free Challenge / Plastic: Helpful or Harmful? OK FSFP7330-18

Wildfires / A Hard Choice / Fire: Friend or Foe?

OK FSFP7190-18

Under the Ice / Professor Valdor and the Giant Laser / Setting Goals: What’s Important?

OK FSFP7230-18

Electric Wind: The Story of William Kamkwamba / Marvelous Maddie / Thinking Outside the Box: What Does It Mean?

OK FSFP7350-18

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

5859 flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

Advanced Fluent Reading Stage Levels Q–S

Paired, Connected Texts at This Stage:

•Support sustained reading with chapter books

•Increase the use of more specialized and technical language

•Use literary language

•Encourage drawing inferences from the text.

Perspectives Texts at This Stage:

•Provide essential questions to promote purposeful reading

•Promote recognizing different points of view

•Include a variety of short, authentic texts

•Encourage collaborative conversations

•Extend learning through performance tasks.

Online Program Support!

Perspectives Lesson Plans help you engage and support students in critical discussions, assist them in recognizing different points of view, and write persuasively from their own perspectives.

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at flying-start.myokapi.com

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish!

See page 132 for details Look Inside the Book!

•144 Student Books (6 copies each of 24 titles)

•12 Paired-Text Lesson Plan Cards (1 for each pair of titles)

•72 Perspectives Books (6 copies each of 12 titles)

•12 Perspectives Books Lesson Plan Cards (1 for each title)

•2 Storage Boxes

Guided Reading Levels Q–S (40)*

Advanced Fluent Q–S Reading Stage OKFSAF8020 NationalListPrice(PrintOnly)

$2,134 | Your Price $1,975

Adda12-month school-wide OkapiDigitalLiteracyTM ODFSAF8020 licenseforthisstage! Your Price $350

Advanced Fluent Q–S Reading Stage 18-Packs | LevelsQ–S(40)*| $162.00 per package

18-Packs include 6 copies of each paired text, 6 copies of the Perspectives book, and 2 lesson plan cards. (National List Price: $174.30 per package)

Guided Reading Level Q (40)*Guided Reading Level R (40)*

What Makes a Champion? / Swim Like a Fish / Playing Competitive Sports: Is Competition Good for Children?

OK FSAF8010-18

Behind the Scenes at the Zoo / So Far from Home / Animals in Captivity: The Good and the Bad OK FSAF8130-18

HeroRATs / Clever Ratty / Putting Animals to Work: What Are the Issues?

OK FSAF8030-18

Get Me to School! / The Sky Ladder / An Education: A Right or a Privilege?

OK FSAF8150-18

First-time Visitors / Odysseus and the Cyclops / Hazardous Adventures: At What Cost?

OK FSAF8050-18

The Mighty Mississippi / River Boy / Sharing the River: What Are the Issues?

OK FSAF8170-18

Polio: A Frightening Disease / Dance On! / Preventing Diseases: What Are the Issues?

OK FSAF8070-18

What’s the Attraction? / Rescue at Blue Canyon / Vacation Destinations: Are They Overloved? OK FSAF8190-18

Guided Reading Level S (40)*

Our Active Earth / A New Geyser Erupts / Living in Dangerous Places: What Are the Issues?

OK FSAF8090-18

Protecting the People of the Arrow / Outsiders! / Uncontacted People: Should We Leave Them Alone?

OK FSAF8210-18

Clean Energy / Surviving the Earthquake / The Impact of Climate Change: Why Clean Energy Matters

OK FSAF8110-18

Exploring Space / Ocean Rescue / Space Exploration: Is It Worth It? OK FSAF8230-18

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

6061 flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

Guided Reading Levels T–V (50)*

Advanced Fluent Reading Stage Levels T–V

Paired, Connected Texts at This Stage:

•Motivate readers with rich content

•Support active engagement in reading

•Integrate reading, writing, listening, and speaking

•Stimulate critical thinking through reading closely.

Perspectives Texts at This Stage:

•Provide essential questions to promote purposeful reading

•Promote recognizing different points of view

•Include a variety of short, authentic texts

•Encourage collaborative conversations

•Extend learning through performance tasks.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment

Checklists, and MORE available online at flying-start.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish!

See page 134 for details

Perspectives Lesson Plans help you engage and support students in critical discussions, assist them in recognizing different points of view, and write persuasively from their own perspectives.

Guided Reading Levels T–V (50)*

BOXED

•144 Student Books (6 copies each of 24 titles)

•12 Paired-Text Lesson Plan Cards (1 for each pair of titles)

•72 Perspectives Books (6 copies each of 12 titles)

•12 Perspectives Books Lesson Plan Cards (1 for each title)

•2 Storage Boxes

Advanced Fluent T–V Reading Stage OKFSAF9020 NationalListPrice(PrintOnly)

$2,134 | Your Price $1,975

Adda12-month school-wide OkapiDigitalLiteracyTM ODFSAF9020 licenseforthisstage! Your Price $350

Advanced Fluent T–V Reading Stage 18-Packs | LevelsT–V(50)*| $162.00 per package

18-Packs include 6 copies of each paired text, 6 copies of the Perspectives book, and 2 lesson plan cards. (National List Price: $174.30 per package)

Guided Reading Level T (50)*Guided Reading Level U (50)*

Animals in Danger: Orangutans / Ahmad’s Journey / Disappearing Rainforests: What Are the Issues?

OK FSAF9010-18

Animal Partnerships / Honey Hunters / Living Together: Which Creature Benefits?

OK FSAF9130-18

Discovering the Lost World / Exploring Galápagos / Natural Wonders of the World: How Do We Protect Them?

OK FSAF9030-18

Restoring Coral Reefs / Colorful Coral / Ecosystems in Trouble: What Should We Save?

OK FSAF9150-18

Fighting for Children’s Rights / A Dollar a Day / Children and Work: What Are the Issues?

OK FSAF9050-18

Leading the Way / An Unlikely Leader / What Makes a Leader?: What Are the Issues?

OK FSAF9170-18

The Camera Doesn’t Lie! / The Scoop / Caught on Camera: The Power of Photography

OK FSAF9070-18

Living with Robots / Milo and the Robots / Robots: Helpful or Harmful?

OK FSAF9190-18

Reading Level V (50)*

Living in Harsh Environments / Into the Desert / Living with the Weather: What Are the Challenges?

OK FSAF9090-18

The Mystery of the Pyramids / King for a Week / Archaeological Treasures: Who Owns Them?

OK FSAF9110-18

Privacy and the Internet / Tagged! / Watching Every Move You Make: Privacy vs. Security

OK FSAF9210-18

Back from Extinction / The Return of the Woolly Mammoth / Extinction Is Forever: Or Is It?

OK FSAF9230-18

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexiles, click on the Correlations & Lexiles tab at flying-start.myokapi.com.

6263 flying-start.myokapi.com Visit our online store or find your rep at myokapi.com

WorldWise: Content-based Learning™

Fill the Knowledge Gap with Explicit Links to NGSS and C3 Standards

Program Overview

WorldWise: Content-based Learning™ is a high-interest informational literacy program that encourages inquiry and questioning while extending knowledge in science, social studies, and a range of STEM topics. Your students will excel as their knowledge of the world increases with compelling texts that build on essential concepts throughout the six stages of the program.

WorldWise: Content-based LearningTM features:

• Content to engage readers and build rich background knowledge

• Seamless flow between content and literacy

• Graphic devices and striking photographs to support the content

• Research opportunities with Find Out More, Think About..., and Did You Know?

Students will develop strategies and skills needed to read informational texts across a range of text types, enhanced by writing assignments that reflect what they’re learning!

WorldWise: Content-based LearningTM is highly versatile, teaching reading strategies at the same time as teaching science and social studies concepts. Lesson plan cards for each book establish a reading focus for the text with explicit links to the NGSS and C3 Standards. With any WorldWise: Contentbased LearningTM text, students are learning standards-linked content as they learn to read.

Expand your students’ knowledge base with:

•Meaningful graphics, engaging photography, and wide-ranging text types

•Writing that reinforces content knowledge

•Titles covering a broad range of topics— field-tested with students just like them!

“While knowledge offers a foundation for understanding our world, it’s application of knowledge that transitions students from passive absorption to active inquiry and innovative thinking.”

—Maria

Nichols, Educational Consultant

Watch the Program Overview video!

Guided Reading Levels A–V (1–50)*

Program Components

Student Books

WorldWise: Content-based Learning™ provides students with gradually increasing challenges. 174 titles linked to Grades K–5 Curriculum Standards cover natural, physical, and earth science, as well as social studies topics relevant to each grade level.

WorldWise: Content-based Learning™ texts introduce and revisit themes and concepts across the reading stages and build on initial concepts with increasing complexity.

Build rich background knowledge while exposing students to grade-appropriate syntax and key academic vocabulary.

Investigations

Lesson Plan Cards

WorldWise: Content-based Learning™ lesson plan cards support teachers in creating an active learning environment, in which all students know how to use content area reading strategies to think within and beyond any given text. Each card identifies the connection to state standards for informational texts as well as to one or more of the science or social studies standards. Educators can easily integrate these other content areas into their literacy block.

Investigations are inquiry-driven, independent project templates for students to use after reading any of the books at Grades 3-5. Investigations are available online only, with your purchase of the corresponding print products. See page 154 for complete details.

Complete Package | Grades K–5, Levels A–V (1–50)* | OK WWAVK500

• 1,044 Student Books (6 each of 174 titles)

• 174 Lesson Plan Cards (1 for each title)

• 10 Storage Boxes

National List Price: $9,868 |Your Price $8,750

Adda12-month school-wide OkapiDigitalLiteracyTM licensefor WorldWise:Content-basedLearningTM! ODWWAVK500| Your Price $1,740

WorldWise:Content-basedLearningTM develops English Learners’ STEM and social studies content literacy and academic language for school success.

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexile Levels, click on the Correlations & Lexiles tab at worldwise-reading.myokapi.com.

worldwise-reading.myokapi.com Visit our online store or find your rep at myokapi.com

WorldWise: Content-based Learning™

Texts at This Stage:

•Establish a full range of concepts about print

•Build comprehension and fluency through a range of reading strategies

•Introduce academic vocabulary specific to science and social studies

•Reinforce key vocabulary and concepts with picture glossaries.

•180 Student Books (6 copies each of 30 titles)

•30 Lesson Plan Cards (1 for each title)

•1 Storage Box

|

A–D (1–6)* Reading Stage

Adda12-month school-wide OkapiDigitalLiteracyTM ODWWGK0000 licenseforthisstage! Your Price $290

Next Generation Science: Grade K Outcomes

C3 Social Studies: Grade K Outcomes

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA. For Lexile Levels, click on the Correlations & Lexiles tab at worldwise-reading.myokapi.com.

Texts at This Stage:

•Introduce text features such as chapters, quotes, and captions

•Build comprehension and fluency through a range of reading strategies

•Expand the use of academic vocabulary specific to science and social studies.

Online Program Support!

For Writing Templates, Curriculum Outcomes and MORE, go to tinyurl.com/WW-Support-Materials

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish!

See page 140 for details

Let us help you

•216 Student Books (6 copies each of 36 titles)

•36 Lesson Plan Cards (1 for each title)

•1 Storage Box Levels E–J (8–18)* Reading Stage

Close-Ups

| Your Price

Adda12-month school-wide OkapiDigitalLiteracyTM ODWWG11000 licenseforthisstage! Your Price $290

6-Packs | LevelsE–J(8–18)*| $44.00 per package

6-Packs include 6 copies of the book plus lesson plan card. (National List

Next Generation Science: Grade 1 Outcomes

(8) OK WWG11050-6

Who Is First? E (8) OK WWG11060-6

C3 Social Studies: Grade 1 Outcomes

Parades F (10) OK WWG11110-6

Saving Up F (10) OK WWG11120-6

The Land Around Us G (12) OK WWG11170-6

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA. For Lexile Levels, click on the Correlations & Lexiles tab at worldwise-reading.myokapi.com.

WorldWise: Content-based Learning™

Supports Grade 2 Next Generation Science Standards and C3 Social Studies Outcomes

Texts at This Stage:

•Provide language structures of appropriate complexity

•Introduce less familiar content

•Introduce specialized and technical language

•Present a range of text types, and graphic devices such as diagrams, maps, and tables

•Encourage research opportunities with Think About..., Find Out More and Did You Know?

Online Program Support!

For Writing Templates, Curriculum Outcomes and MORE, go to tinyurl.com/WW-Support-Materials

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish!

See page 142 for details

A River’s Journey K (20) OK WWFL6010-6

•216 Student Books (6 copies each of 36 titles)

•36 Lesson Plan Cards (1 for each title)

•2 Storage Boxes Levels K–M (20–28)* Reading Stage OKWWFL6000 NationalListPrice(PrintOnly) $1,970 | Your Price $1,825

Adda12-month school-wide OkapiDigitalLiteracyTM ODWWFL6000 licenseforthisstage! Your Price $290

6-Packs | LevelsK–M(20–28)*| $50.00

per package

6-Packs include 6 copies of the book plus lesson plan card. (National List Price: $53.55 per package)

Cracking, Sinking, and Bubbling Over K (20) OK WWFL6020-6

Amazing Lifetimes L (24) OK WWFL6130-6 Deserts of the World L (24) OK WWFL6140-6

and Cooling: How Do

Generation Science: Grade 2 Outcomes

Monster Machines L (24) OK WWFL6150-6

Animals of the African Grasslands M (28) OK WWFL6250-6 Bridges M (28) OK WWFL6260-6 Champions of the Animal World M (28)

Robots L (24) OK WWFL6160-6

Sharing Our Yard L (24) OK WWFL6170-6

Side by Side L (24) OK WWFL6180-6

C3 Social Studies: Grade 2 Outcomes

Summer

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexile Levels, click on the Correlations & Lexiles tab at worldwise-reading.myokapi.com.

worldwise-reading.myokapi.com Visit our online store or find your rep at myokapi.com

WorldWise: Content-based Learning™

Texts at This Stage:

•Increase the conceptual load with less familiar content

•Increase the use of more specialized and technical language

•Increase the range of text and language features.

Online Program Support!

For Writing Templates, Curriculum Outcomes and MORE, go to tinyurl.com/WW-Support-Materials

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish!

See page 144 for details

•144 Student Books (6 copies each of 24 titles)

•24 Lesson Plan Cards (1 for each title)

•2 Storage Boxes

Guided Reading Levels N–P (30–38)*

Levels N–P (30–38)* Reading Stage OKWWFP7000 NationalListPrice(PrintOnly) $1,478 | Your Price $1,370

Adda12-month school-wide OkapiDigitalLiteracyTM ODWWFP7000 licenseforthisstage! Your Price $290

6-Packs | LevelsN–P(30–38)*| $56.00 per package

6-Packs include 6 copies of the book plus lesson plan card. (National List Price: $59.85 per package)

Next Generation Science: Grade 3 Outcomes

Animal Parents N (30) OK WWFP7010-6

Looking After Our World N (30) OK WWFP7080-6

Amazing Animal Survivors O (34) OK WWFP7150-6

New Country, New Life O (34) OK WWFP7190-6

The Weather Today N (30) OK WWFP7020-6

The Coral Reef O (34) OK WWFP7090-6

Bicycles by Design O (34) OK WWFP7160-6

Busy Highways O (34) OK WWFP7030-6

Plants: The Key to Life O (34) OK WWFP7100-6

Animals and Their Ancestors P (38) OK WWFP7170-6

The Long Journey: Matthew Henson P (38) OK WWFP7200-6

The Animal Kingdom P (38) OK WWFP7040-6

Keeping Well P (38) OK WWFP7110-6

Finding Our Way P (38) OK WWFP7180-6

Everything Moves P (38) OK WWFP7050-6

Monarch Butterflies: The Long Migration P (38) OK WWFP7120-6

Going, Going, Gone? P (38) OK WWFP7060-6

Animal Lifetimes N (30) OK WWFP7130-6

Caring for Animals N (30) OK WWFP7070-6

The Land Where I Live N (30) OK WWFP7140-6

C3 Social Studies: Grade 3 Outcomes

My Neighborhood N (30) OK WWFP7210-6

What Is Work? O (34) OK WWFP7220-6

Tell Me a Story N (30) OK WWFP7230-6

Then and Now: Four Generations of My Family O (34) OK WWFP7240-6

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexile Levels, click on the Correlations & Lexiles tab at worldwise-reading.myokapi.com.

7273 worldwise-reading.myokapi.com Visit our online store or find your rep at myokapi.com

WorldWise: Content-based Learning™

Texts at This Stage:

•Motivate readers with rich content

•Increase the use of more specialized and technical language

•Encourage drawing inferences from the text.

Online Program Support!

For Writing Templates, Curriculum Outcomes and MORE, go to tinyurl.com/WW-Support-Materials

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish! See page 146 for details

Extend the Learning with Investigations! See page 154 for more details.

•144 Student Books (6 copies each of 24 titles)

•24 Lesson Plan Cards (1 for each title)

•2 Storage Boxes

Guided Reading Levels Q–S (40)*

Levels Q–S (40)* Reading Stage OKWWAF8000 NationalListPrice(PrintOnly) $1,630 | Your Price $1,510

Adda12-month school-wide OkapiDigitalLiteracyTM ODWWAF8000 licenseforthisstage! Your Price $290

6-Packs | LevelsQ–S(40)*| $62.00 per package

6-Packs include 6 copies of the book plus lesson plan card. (National List Price: $66.15 per package)

Next Generation Science: Grade 4 Outcomes

Don’t Throw It Away! Q (40) OK WWAF8010-6

Animal Architects R (40) OK WWAF8080-6

Wild, Wild Weather Q (40) OK WWAF8150-6

That’s a Good Idea! Q (40) OK WWAF8020-6

Exploring Caves R (40) OK WWAF8090-6

Adventures in Wild Places S (40) OK WWAF8160-6

Helping Hands Q (40) OK WWAF8190-6

From Me to You R (40) OK WWAF8030-6

Nature’s Rooming House R (40) OK WWAF8100-6

How Animals Communicate S (40) OK WWAF8170-6

Heroes R (40) OK WWAF8200-6

Solving Problems: Dams, Bridges, and Canals R (40) OK WWAF8040-6

Shells on Their Backs R (40) OK WWAF8110-6

Our Bodies S (40) OK WWAF8180-6

It’s All About Energy S (40) OK WWAF8050-6

Living with the Tides S (40) OK WWAF8120-6

Our Moving Earth S (40) OK WWAF8060-6

Awesome Oceans Q (40) OK WWAF8130-6

Animal Shelters Q (40) OK WWAF8070-6

Talented Animals Q (40) OK WWAF8140-6

C3 Social Studies: Grade 4 Outcomes

Places We Call Home Q (40) OK WWAF8210-6

What Makes a City? R (40) OK WWAF8220-6

Against the Odds S (40) OK WWAF8230-6

Your Rights S (40) OK WWAF8240-6

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexile Levels, click on the Correlations & Lexiles tab at worldwise-reading.myokapi.com.

7475 worldwise-reading.myokapi.com Visit our online store or find your rep at myokapi.com

WorldWise: Content-based Learning

Texts at This Stage:

•Motivate readers with rich content

•Support active engagement in reading

•Integrate reading, writing, listening and speaking

•Stimulate critical thinking through reading closely.

Online Program Support!

For Writing Templates, Curriculum Outcomes and MORE, go to tinyurl.com/WW-Support-Materials

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in Spanish! See page 148 for details

Extend the Learning with Investigations! See page 154 for more details.

•144 Student Books (6copieseachof24titles)

•24 Lesson Plan Cards (1foreachtitle)

•2 Storage Boxes

How Do Plants Survive? U (50) OK WWAF9010-6

Rock Snot, Cane Toads, and Other Aliens T (50) OK WWAF9080-6

Wetlands U (50)

OK WWAF9150-6

The Salmon Stream U (50) OK WWAF9020-6

Powerful Ideas: John Muir U (50) OK WWAF9090-6

Climate Change V (50) OK WWAF9160-6

Who Are You? T (50)

OK WWAF9190-6

Money: Where Does It Come From? V (50) OK WWAF9200-6

Guided Reading Levels T–V (50)*

Levels T–V (50)* Reading Stage

OKWWAF9000 NationalListPrice(PrintOnly)

$1,630 | Your Price $1,510

Adda12-month school-wide OkapiDigitalLiteracyTM ODWWAF9000 licenseforthisstage! Your Price $290

6-Packs | Levels T–V (50)* | $62.00 per package

6-Packsinclude6copiesofthebookpluslessonplancard. (NationalListPrice:$66.15perpackage)

Next

Generation Science: Grade 5 Outcomes

Yellowstone: A Unique Ecosystem U (50) OK WWAF9030-6

Science for the People U (50) OK WWAF9100-6

Deserts V (50) OK WWAF9170-6

Animals and Us V (50) OK WWAF9040-6

Time Detectives U (50) OK WWAF9110-6

How Water Shapes the Land V (50) OK WWAF9180-6

Saving the Amazon River V (50) OK WWAF9050-6

From Hunter-Gatherers to Farmers V (50) OK WWAF9120-6

The Earth, the Sun, and the Moon V (50) OK WWAF9060-6

Sharing the Environment T (50) OK WWAF9130-6

Guiding Lights T (50) OK WWAF9070-6

The Wandering Albatross T (50) OK WWAF9140-6

C3 Social Studies: Grade 5 Outcomes

Living Away from It All T (50) OK WWAF9210-6

News Travels Quickly U (50) OK WWAF9220-6

Arctic People T (50) OK WWAF9230-6

High Up T (50) OK WWAF9240-6

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL. For Lexile Levels, click on the Correlations & Lexiles tab at worldwise-reading.myokapi.com.

worldwise-reading.myokapi.com Visitouronlinestoreorfindyourrepat myokapi.com

7677

Just Dual It!®

Okapi’s title-for-title publishing commitment means that—regardless of the instructional approach you’ve adopted—your emerging bilinguals will be assured of exciting and equitable resources in both English and Spanish.

To simplify your selection of dual-language resources, we have combined both languages into cost-effective bundles by program, by stage, and by selected program components. We invite you to browse the following pages to customize your next dual-language order.

For Shared Reading

Rhyme, rhythm, repetition, and highly predictable texts—with allowances made for the differences between languages— offer you opportunities to revisit (and co-visit) familiar texts again and again. For Dual Language bundles, see pages 79-83.

For Phonics

Systematic and explicit foundational skills instruction is provided to students in both English and Spanish. Seventy decodable books are included with each program, offering not just title-for-title equity, but all-new original texts in authentic Spanish! For Dual Language bundles, see pages 79-83.

For Small Group Instruction

Spreading across nine developmental reading stages—from Early Emergent to Advanced Fluent—more than 300 paired texts in each language work as paired texts are meant to work, with one text enhancing understanding of the other. For Dual Language bundles, see pages 79-83.

For Content-based Literacy

Develop content literacy in two languages with these essential resources fully aligned with Next Generation Science Standards and C3 Social Studies Outcomes. For Dual Language bundles, see pages 79-83.

Contact your local Okapi sales representative to learn more about the range of dual-language resources available from us. Dual-language leveled bookroom collections can be found on pages 156-159.

Complete Programs in Dual-Language Bundles

Foundational Skills in English and Spanish

Combine your order for Flying Start to Literacy: PHONICS™ with its Spanish counterpart, Despegando hacia la lectura: FONÉTICA™. Three stages in each language follow a scope and sequence of skills and knowledge from simple to complex. Engaging, decodable texts follow the same sequence and are scaffolded for independent practice of newly learned skills.

OK DLPHST01-03 $5,964 | Your Price $4,995

Shared Reading in English and Spanish

Lift Off to Literacy: Using a Shared Reading Approach™ and Despegando hacia la lectura: Un enfoque de la lectura™ each feature 18 captivating big books for a delightful shared-reading experience, and are accompanied my small-book editions of the big books, vocabulary starters, our unique Reading Pens, and full instructional support for multiple readings of each title.

OK DLSR1300 $4,725 | Your Price $3,100

Small Group Instruction in English and Spanish

Flying Start to Literacy™ and Despegando hacia la lectura® nurture students across nine developmental reading stages (Early Emergent through Advanced Fluent) by their innovative use of thoughtfully linked pairs of books. Each of these pairs (one narrative and one informational) are connected by their shared highfrequency words, content vocabulary, and—especially— by the big idea that unites them.

(With Shared Reading)

OK DLAVK520 $44,112 | Your Price $36,840 (Without Shared Reading)

OK DLAVK520-NOSR $39,388 | Your Price $33,250

Content Area Reading in English and Spanish

WorldWise: Content-based Learning™ and ExploraMundos™ are high-interest, informational literacy programs that encourage inquiry and questioning while extending knowledge in science, social studies, and a range of STEM topics with explicit links to the NGSS and C3 Social Studies Outcomes.

OK WEAVK500 $19,736 | Your Price $17,150

Combined English-Spanish Bundles of Individual Program Stages

OKDLPHST01 Flying Start to Literacy: PHONICS™and Despegando hacia la lectura:FONÉTICA™StageOne

OKDLPHST02 Flying Start to Literacy:PHONICS™and Despegando hacia la lectura:FONÉTICA™StageTwo

LiftOfftoLiteracy™and Despegando hacia la lectura™:Unenfoquedelecturacompartida “MyFamilyandMe/Mifamiliayyo”TopicSet

OKDLSR2000 LiftOfftoLiteracy™and Despegando hacia la lectura™:Unenfoquedelecturacompartida “IntheWorld/Enelmundo”TopicSet

LiftOfftoLiteracy™and Despegando hacia la lectura™:Unenfoquedelecturacompartida “LivingThings/Seresvivos”TopicSet

Combined, Single-Copy Classroom Libraries

OKDLPHST01-AODR Flying Start to Literacy: PHONICS™and Despegando hacia la lectura:FONÉTICA™StageOne

OKDLPHST02-AODR Flying Start to Literacy: PHONICS™and Despegando hacia la lectura:FONÉTICA™StageTwo

OKDLPHST03-AODR Flying Start to Literacy: PHONICS™and Despegando hacia la lectura:FONÉTICA™StageThree

OKDLEE1018-AOS Flying Start to Literacy™and Despegando hacia la lectura™EarlyEmergentStage

OKDLEM2000-AOS Flying Start to Literacy™and Despegando hacia la lectura™EmergentStage

$234

OKDLEA3000-AOS Flying Start to Literacy™and Despegando hacia la lectura™EarlyStage $504 $480

OKDLTR4000-AOS Flying Start to Literacy™and Despegando hacia la lectura™TransitionalStage $504 $480

OKDLEF5000-AOS Flying Start to Literacy™and Despegando hacia la lectura™EarlyFluentStage

OKDLFL6000-AOS Flying Start to Literacy™and Despegando hacia la lectura™FluentStage

OKDLFP7019-AOS Flying Start to Literacy™and Despegando hacia la lectura™FluentPlusStage

$560

OKDLFP7019-PAOS Flying Start to Literacy™and Despegando hacia la lectura™Perspectives/Perspectivas FluentPlusStage $284 $270

OKDLAF8020-AOS Flying Start to Literacy™and Despegando hacia la lectura™AdvancedFluentQ-SStage

OKDLAF8020-PAOS Flying Start to Literacy™and Despegando hacia la lectura™Perspectives/Perspectivas AdvancedFluentQ-SStage

OKDLAF9020-AOS Flying Start to Literacy™and Despegando hacia la lectura™AdvancedFluentT-VStage

OKDLAF9020-PAOS Flying Start to Literacy™and Despegando hacia la lectura™Perspectives/Perspectivas AdvancedFluentT-VStage

OKWEGK0000-AOS WorldWise: Content-based Learning™and ExploraMundos™KindergartenStage

OKWEG11000-AOS WorldWise: Content-based Learning™and ExploraMundos™Grade1Stage

OKWEFL6000-AOS WorldWise: Content-based Learning™and ExploraMundos™Grade2Stage

ODWEFP7000-AOS WorldWise: Content-based Learning™and ExploraMundos™Grade3Stage

ODWEAF8000-AOS WorldWise: Content-based Learning™and ExploraMundos™Grade4Stage

ODWEAF9000-AOS WorldWise: Content-based Learning™and ExploraMundos™Grade5Stage

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

Visitouronlinestoreorfindyourrepat

$456

Combined Lesson Plan SetsDual-Language

SetsDual-Language Intro-Packs

Essential Add-On Sets

DECODABLE READER SIX-PACKS

Six-packs for other programs can be found on their respective product pages: Flying Start to Literacy™ (pages 44-63), WorldWise: Content-based Learning™ (pages 66-77), Despegando hacia la lectura® (pages 116-135) and ExploraMundos™ (pages 138-149).

Flying Start to Literacy: PHONICS ™

STAGE ONE - MODULE 1

Pip,Sam,andTim

TheMap

Tim!

TheCat

PipandtheCat

STAGE ONE - MODULE 2

Meg,DanandKim

TagIsFun

ItIsHot

TheFog

ThePup

STAGE ONE - MODULE 3

What’sintheBox?

ILikePup

TheDogintheMud

ICanFixIt

CanWeGo?

STAGE TWO - MODULE 4

HopandRun

Run,Jack,Run!

HowAntsMakeNests

ANestforStan

IntheFog

STAGE TWO - MODULE 5

Tails

MeeMee’sTail

ThisSunnyDay

NightIsComing

OKFSPHS1M1DR01-6 $38 $36

OKFSPHS1M1DR02-6 $38 $36

OKFSPHS1M1DR03-6 $38 $36

OKFSPHS1M1DR04-6 $38 $36

OKFSPHS1M1DR05-6 $38 $36

OKFSPHS1M2DR01-6 $38 $36

OKFSPHS1M2DR02-6 $38 $36

OKFSPHS1M2DR03-6 $38 $36

OKFSPHS1M2DR04-6 $38 $36

OKFSPHS1M2DR05-6 $38 $36

TheCap

TipIt!

HitIt,Sam!

TheHat

IsItMyHat?

OKFSPHS1M1DR06-6

$38 $36

OKFSPHS1M1DR07-6 $38 $36

OKFSPHS1M1DR08-6 $38 $36

OKFSPHS1M1DR09-6 $38 $36

OKFSPHS1M1DR10-6 $38 $36

OKFSPHS1M3DR01-6 $38 $36

OKFSPHS1M3DR02-6 $38 $36

OKFSPHS1M3DR03-6 $38 $36

OKFSPHS1M3DR04-6 $38 $36

OKFSPHS1M2DR09-6 $38 $36

OKFSPHS1M3DR05-6 $38 $36 TheFoxandtheHen OKFSPHS1M3DR06-6 $38

OKFSPHS1M3DR10-6 $38 $36

OKFSPHS2M4DR01-6 $38 $36

OKFSPHS2M4DR02-6 $38 $36

OKFSPHS2M4DR03-6 $38 $36

OKFSPHS2M4DR04-6 $38 $36

ChadIsLost

LegsandWings

OKFSPHS2M4DR05-6 $38 $36

OKFSPHS2M4DR06-6 $38 $36

OKFSPHS2M4DR07-6 $38 $36

MyLegsAretheBest! OKFSPHS2M4DR08-6 $38 $36

DogsThatHelpUs OKFSPHS2M4DR09-6 $38 $36

OKFSPHS2M4DR10-6 $38 $36 NationalYour ProductCode

MyDogScamp

OKFSPHS2M5DR01-6 $38 $36

OKFSPHS2M5DR02-6 $38 $36

OKFSPHS2M5DR03-6 $38 $36

OKFSPHS2M5DR04-6 $38 $36

Tugboats OKFSPHS2M5DR05-6 $38 $36

TheBraveTugboats OKFSPHS2M5DR06-6 $38 $36

TheSkateClub

EllyandHopeGetFit

RidesforAll

WhatanExcuse!

OKFSPHS2M5DR07-6 $38 $36

OKFSPHS2M5DR08-6 $38 $36

OKFSPHS2M5DR09-6 $38 $36

OKFSPHS2M5DR10-6 $38 $36

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

Ordertoday! 866.652.7436 orfax 800.481.5499

STAGE THREE - MODULE 6

HowtoLookAfterFrogs

APondforFrog

AtOurFarm

LookingforaFarm

Caves

STAGE THREE - MODULE 7

TeachingTheirYoung

LittleCubIsHungry

Bridges

CedrickandtheLostCity

PlantsThatHarmAnimals

STAGE ONE - MODULE 1

Lili,PepeyMemo

Elmapa

Memo

OKFSPHS3M6DR01-6 $38 $36

OKFSPHS3M6DR02-6 $38 $36

OKFSPHS3M6DR03-6 $38 $36

OKFSPHS3M6DR04-6 $38 $36

OKFSPHS3M6DR05-6 $38 $36

OKFSPHS3M7DR01-6 $38 $36

OKFSPHS3M7DR02-6 $38 $36

OKFSPHS3M7DR03-6 $38 $36

OKFSPHS3M7DR04-6 $38 $36

OKFSPHS3M7DR05-6 $38 $36

BigStanandHairyTim

SnakesThatHunt

TheSnakeGames

Monsoon

OKFSPHS3M6DR06-6

OKFSPHS3M6DR07-6

OKFSPHS3M6DR08-6 $38 $36

OKFSPHS3M6DR09-6

TheVeryBadDog

ANewFriend

TheDanceoftheBlueCrane

HikingwithMax

PrinceEphramIsLost

Despegando hacia la lectura: FONÉTICA™

OKDHPHS1M1DR01-6 $38 $36

OKDHPHS1M1DR02-6 $38 $36

OKDHPHS1M1DR03-6 $38 $36

Elgato OKDHPHS1M1DR04-6 $38 $36

Liliyelgato

STAGE ONE - MODULE 2

Rosa,QuiqueyCeci

¡Tetoca!

¡Quécalor!

¡Quéricasopa!

Fifo

STAGE ONE - MODULE 3

¡Quéhayenesacaja?

MegustaBaco

Elperroenellodo

Yolareparo

¿Nosvamosya?

STAGE TWO - MODULE 4

Elsolsale

Losnidosdelashormigas

OKDHPHS1M1DR05-6 $38 $36

OKDHPHS1M2DR01-6 $38 $36

OKDHPHS1M2DR02-6 $38 $36

OKDHPHS1M2DR03-6 $38 $36

OKDHPHS1M2DR04-6 $38 $36

OKDHPHS1M2DR05-6 $38 $36

Lili

¡Pega,Pepe!

OKFSPHS3M7DR06-6

OKFSPHS3M7DR07-6

OKFSPHS3M7DR08-6 $38 $36

OKFSPHS3M7DR09-6 $38 $36

OKFSPHS3M7DR10-6 $38 $36

OKDHPHS1M1DR07-6

OKDHPHS1M1DR08-6

Esmío OKDHPHS1M1DR09-6

¡Para!

OKDHPHS1M3DR01-6 $38 $36

OKDHPHS1M3DR02-6 $38 $36

OKDHPHS1M3DR03-6 $38 $36

OKDHPHS1M3DR04-6 $38 $36

OKDHPHS1M3DR05-6 $38 $36

¡Acomer!

Lasmantas

Fifoyellodo

Corre,Rosa,corre

Elgatomalo

OKDHPHS1M2DR07-6 $38 $36

OKDHPHS1M2DR08-6 $38 $36

OKDHPHS1M2DR09-6 $38 $36

OKDHPHS1M2DR10-6

Lagallinayelzorro OKDHPHS1M3DR06-6 $38 $36

Elzorromalo

OKDHPHS2M4DR01-6 $38 $36

OKDHPHS2M4DR02-6 $38 $36

Laspatasylasalasdelosanimales OKDHPHS2M4DR03-6 $38 $36

Losperrosderescate

Elsolesemete

OKDHPHS2M4DR04-6 $38 $36

OKDHPHS2M4DR05-6 $38 $36

OKDHPHS1M3DR07-6 $38 $36

Lisa OKDHPHS1M3DR08-6 $38 $36

Lacaja OKDHPHS1M3DR09-6 $38 $36

¡Quérico! OKDHPHS1M3DR10-6 $38 $36 NationalYour

ElnidodeLuela

Laneblina

Cletoylaneblina

Flaco

OKDHPHS2M4DR06-6 $38 $36

OKDHPHS2M4DR07-6 $38 $36

OKDHPHS2M4DR08-6 $38 $36

OKDHPHS2M4DR09-6 $38 $36

¡Tengolasmejorespatas! OKDHPHS2M4DR10-6 $38 $36 NationalYour

STAGE TWO - MODULE 5

Enelparque

Despegando hacia la lectura: FONÉTICA™ continued

OKDHPHS2M5DR01-6 $38 $36

Losremolcadores OKDHPHS2M5DR02-6 $38 $36

Brincamosycorremos OKDHPHS2M5DR03-6 $38 $36

Lacoladelosanimales OKDHPHS2M5DR04-6 $38 $36

FrancisyFrida OKDHPHS2M5DR05-6 $38 $36

STAGE THREE - MODULE 6

Enlagranja

OKDHPHS3M6DR01-6 $38 $36

Unavemuyprudente OKDHPHS3M6DR02-6 $38 $36

Elmonzón OKDHPHS3M6DR03-6 $38 $36

Trinibuscaotragranja OKDHPHS3M6DR04-6 $38 $36

Lasranassonbuenasmascotas OKDHPHS3M6DR05-6 $38 $36

STAGE THREE - MODULE 7

Lospuentes OKDHPHS3M7DR01-6 $38 $36

Riuylaciudadperdida OKDHPHS3M7DR02-6 $38 $36

Cómocuidanasuscrías OKDHPHS3M7DR03-6 $38 $36

Moy,elcachorrodeleón OKDHPHS3M7DR04-6 $38 $36

Losamigos OKDHPHS3M7DR05-6 $38 $36

¡Corre,Kuki! OKDHPHS2M5DR06-6 $38 $36

¡Nohayexcusa! OKDHPHS2M5DR07-6 $38 $36

¡Quévergüenza! OKDHPHS2M5DR08-6 $38 $36

Wilbur OKDHPHS2M5DR09-6

Patineresdivertido OKDHPHS2M5DR10-6

Elreydelestanque OKDHPHS3M6DR06-6 $38 $36

Serpientesquecazan OKDHPHS3M6DR07-6 $38 $36

¡Eureka! OKDHPHS3M6DR08-6 $38 $36

Andrésysupadre OKDHPHS3M6DR09-6 $38 $36

Lascuevas OKDHPHS3M6DR10-6 $38 $36

Lagrullaazul OKDHPHS3M7DR06-6 $38 $36

Megustapasear OKDHPHS3M7DR07-6 $38 $36

ElpríncipeCuomo OKDHPHS3M7DR08-6 $38 $36

Unperromuymalo OKDHPHS3M7DR09-6 $38 $36

Plantasquelastiman OKDHPHS3M7DR10-6 $38 $36

CLASSROOM LIBRARIES

One copy of each student text offered in small libraries by stage level. Use these sets for supplementing our programs with additional copies for whole-class and small-group.

Flying Start to Literacy: PHONICS™

CompleteClassroomLibrary(70StudentBooks,StagesOne-Three)

Flying Start to Literacy™

WorldWise: Content-based Learning™

GradeK(30StudentBooks) OKWWGK0000-AOS $205 $195

Grade1(36StudentBooks) OKWWG11000-AOS $246 $234

Grade2(36StudentBooks) OKWWFL6000-AOS $284 $270

Grade3(24StudentBooks)

OKWWFP7000-AOS $214 $204

Grade4(24StudentBooks) OKWWAF8000-AOS

Grade5(24StudentBooks) OKWWAF9000-AOS

Despegando hacia la lectura: FONÉTICA™

StageOne(30StudentBooks) OKDHPHST01-AODR $189 $172

StageTwo(20StudentBooks)

StageThree(20StudentBooks) OKDHPHST03-AODR

CompleteClassroomLibrary(70StudentBooks,StagesOne-Three) OKDHPHST01-03-AODR

Despegando hacia la lectura®

EarlyEmergent(48StudentBooks) OKDHEE1018-AOS

Emergent(40StudentBooks)

FluentPlus Perspectivas (18StudentBooks) OKDHFP7019-PAOS

AdvancedFluentQ-S Perspectivas (12StudentBooks) OKDHAF8020-PAOS

AdvancedFluentT-V(48StudentBooks) OKDHAF9020-AOS

AdvancedFluentT-V Perspectivas (12StudentBooks) OKDHAF9020-PAOS $113

ExploraMundos™

GradeK(30StudentBooks)

Grade1(36StudentBooks)

Grade2(36StudentBooks) OKEMFL6000-AOS $284 $270

Grade3(24StudentBooks) OKEMFP7000-AOS $214 $204

Grade4(24StudentBooks) OKEMAF8000-AOS $239 $228

Grade5(24StudentBooks) OKEMAF9000-AOS $239 $228

Visitouronlinestoreorfindyourrepat myokapi.com

LESSON PLAN SETS & TEACHER RESOURCE BOOKS

Expand the reach of your program purchase with these additional instructional components. Lesson Plan Sets and individual Teacher Resource Books will ensure that all teachers sharing the program will have our award-winning instructional support at their fingertips!

Flying Start to Literacy: PHONICS ™

StageOneTeacherResourceBook(Modules1-3)

StageOneTeacherResourceBook(Modules1-3)

StageTwoTeacherResourceBook(Modules4-5)

StageThreeTeacherResourceBook(Modules6-7)

Biliteracy para todos™

Despegando hacia la lectura: FONÉTICA™

Despegando hacia la lectura®

EarlyEmergent(24LessonPlanCards)

El poder de la lectura™

ExploraMundos™

GradeK(30LessonPlanCards)

Grade1(36LessonPlanCards)

Grade2(36LessonPlanCards) OKEMFL6000-AOLP $227 $216

Grade3(24LessonPlanCards)

Grade4(24LessonPlanCards) OKEMAF8000-AOLP $151 $144

Grade5(24LessonPlanCards)

INTRO-PACKS

Let us introduce you to the difference our flagship programs can make in your classroom with these cost-effective Intro-Packs. More than just a taste of the programs, our Intro-Packs have been assembled to provide you with the same rich experience of the complete programs, but at prices that meet any budget!

Flying Start to Literacy™

EarlyEmergent

OKFSEE1000-ST $583 $475

Emergent OKFSEM2000-ST $532 $435

Early OKFSEA3000-ST $532 $435

Transitional

OKFSTR4000-ST $532 $435

EarlyFluent OKFSEF5000-ST $617 $505

WorldWise: Content-based Learning™

GradeKIntro-Pack

Grade1Intro-Pack

OKWWGK0000-ST $284 $230

OKWWG11000-ST $284 $230

Grade2Intro-Pack OKWWFL6000-ST $321 $260 Grade3Intro-Pack

Despegando hacia la lectura®

EarlyEmergent

OKDHEE1000-ST $583 $475

Emergent OKDHEM2000-ST $532 $435

Early OKDHEA3000-ST $532 $435

Transitional OKDHTR4000-ST $532 $435

EarlyFluent

OKDHEF5000-ST $617 $505

ExploraMundos™

GradeKIntro-Pack OKEMGK0000-ST $284 $230

Grade1Intro-Pack OKEMG11000-ST $284 $230

Grade2Intro-Pack OKEMFL6000-ST $321 $260

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

Biliteracy para todos

Biliteracy para todos™ Teaching for language connections

Biliteracy para todos™ , your essential resource for dual-language learning, is a uniquely designed, standards-based program carefully crafted for Spanish-English instruction targeting language, content, and translanguaging practices.

Thoughtfully selected text pairs in English and Spanish provide the primary means for students to explore how the two languages are alike and different.

Biliteracy para todos™ provides resources for teachers to engage bilingual learners in two related activities:

• Contrasting and analyzing the two languages of instruction

• Using their complete linguistic repertoire during whole class and small group literacy instruction.

See page 3.

Available in three complete stages (Early, Developing, and Advanced), each stage of Biliteracy para todos™ consists of two separate resources. These are available as standalone products or as one comprehensive package by stage:

• Cross Linguistic Connections (CLC) for whole or small group instruction encompasses phonology, morphology, grammar, and syntax.

• Preview-View-Review (PVR) for small group reading instruction.

TRANSLANGUAGING

Biliteracy para todos™ builds on students’ ability to translenguar to actively develop biliteracy. Translanguaging is not only about moving from one language to another, it is also about how bilingual students use language. Students use their complete language system, which is composed of features of both languages, to make sense of their world.

Biliteracy para todos™ lessons are designed for teachers working with emergent and experienced bilinguals in different educational contexts. The lessons provide intentional translanguaging opportunities, allowing bilingual learners to flexibly use their full linguistic repertoire as they become bilingual and biliterate.

BILITERACY

In Biliteracy para todos™, biliteracy is seen from the perspectives of both the biliteracy teacher and the biliterate student.

CLC and PVR lessons create opportunities for teachers to implement their biliteracy teaching in an intentionally designed way.

Students are encouraged to become biliterate as they move through the three stages of the program’s biliteracy progression. Through this process, the students use their full linguistic repertoire to gain understanding of how English and Spanish are similar and different.

biliteracy.myokapi.com

Visit our online store or find your rep at myokapi.com

Preview-View-Review (PVR)

The Structure

English as the Target Language

• Vista Previa: the teacher and students use Spanish to build background knowledge and vocabulary.

• View: in English, the teacher works with the students to support reading comprehension and language.

• Repaso: the teacher and students clarify and extend understanding in Spanish.

Spanish as the Target Language

• Preview: the teacher and students use English to build background knowledge and vocabulary.

• Vista: in Spanish, the teacher works with the students to support reading comprehension and language.

• Review: the teacher and students clarify and extend understanding in English.

Dynamic and Interdependent Nature of PVR

Biliteracy para todos™

Cross Linguistic Connections (CLC)

Introduction / Introducción

The teacher:

Mini-Lesson / Mini-lección

Student Investigation / Investigación

Investigación del estudiante Haga que los estudiantes lean las siguientes oraciones en la página 17 del libro en español y en inglés. L

akes (p.4) Diga: En español la vocal /a/ en las palabras las y han dice su nombre. En inglés la vocal /a/ en la palabra tiene un sonido corto no dice su nombre, pero la /a/ en la palabra snakes tiene un sonido largo y dice su nombre. En la tabla, escriba otros ejemplos de palabras de una sílaba en español y en inglés. (p.18) (p.15) (p.4) k ng (p.6) f ind (p.11) h nt (p.10) (p.8) (p.12) cl (p.12) Diga: Identi quen los sonidos largos y cortos de las palabras en inglés compárenlas con los sonidos en español. Pregunte: ¿Qué notan acerca de los sonidos de las vocales en estas palabras? Discusión de parejas: Noto que en español, la vocal ( tiene sólo (un) sonido (dice su nombre). Sin embargo en inglés, la vocal ) tiene un sonido (corto) en (king), y un sonido (largo) en ( nd).

•provides initial language and literacy instruction in Spanish or English during the language arts block.

•facilitates access to biliteracy by connecting language and literacy skills previously learned in Spanish or English during the language arts block.

•engages students in discussions and explores similarities and differences between the two languages of instruction.

•creates opportunities for students to demonstrate metalinguistic awareness by applying language and literacy skills discussed during CLC lessons in the other language across all content areas.

Review / Repaso

The Structure of CLC Lessons

During the designated CLC lesson, the students work in bilingual pairs.

The teacher:

•introduces the lesson and the mini lesson

•guides and works with the students during the student investigation and the creation of the anchor chart to summarize how the languages are similar or different

•encourages the students to reflect and write independently in their journals during the review.

Dynamic and Interdependent Nature of CLC

biliteracy.myokapi.com Visit our online store or find your rep at myokapi.com

Biliteracy para

Biliteracy para todos™

Teaching for language connections

Integral Instruction Delivered Through Downloadable Online Resources!

Downloadable tools to support your instruction in both English and Spanish are available on the Okapi Digital Literacy TM platform.

Cross Linguistic Connections

CLC SENTENCE STEMS

Cross Linguistic Connections

Developing Biliteracy Set 1: Phonology

In English _______ has a _______ vowel sound,but _______ has a _______ vowel sound.In Spanish,the letter

In English,the letters a,e,and

have a _____ vowel _____ in the words _____, _____, and _____. In English,the letters a and o have a _____ vowel _____ in the words _____ and _____. In Spanish,the letters a,e,i,o,u have _____ sound.

CLC Developing

In English,the vowels a,e,i,o,u have a _____ and a _____ sound. But in Spanish,the vowels a,e,i,o,u have only _____ sound. For example,______.

CLC Developing Biliteracy Set 1:PhonologyWriting

Vista Previa-View-Repaso Developing

Biliteracy para todos

Biliteracy para todos™ Teaching for language connections

See Essential Program Support on the Okapi Digital Literacy™ Preview Site

Access the Okapi Digital Literacy™ Preview Site by going to: https://preview.okapi-digital-literacy.com/login

biliteracy.myokapi.com

Visit our online store or find your rep at myokapi.com

Biliteracy para todos

Biliteracy para todos™

Teaching for language connections

Mercuri & Pratts

Meet the Biliteracy para todos™ Program Authors!

Mercuri & Pratts are experienced educational consultants and have been a guiding force in improving student achievement, channeling the latest research into effective practices for emerging bilinguals through teaching for interdisciplinary biliteracy, dual language and language transfer. Offering an array of Professional Development modules, Mercuri & Pratts work closely with schools and families while also presenting at educational conferences such as La Cosecha and CABE. Mercuri & Pratts’ continuing work supports students in reaching academic and linguistic goals.

Dr. Sandra Mercuri is a nationally and internationally recognized consultant in the areas of second language acquisition, dual-language education, and curriculum integration for biliteracy development. Dr. Mercuri has over 30 years of experience teaching in K–12 schools and as a college professor in Argentina and the United States. She provides professional development for teachers, administrators, and parents on second language acquisition and bilingualism, dual-language education, translanguaging pedagogy, and ESL strategies. Her latest published work on biliteracy is La enseñanza en el aula bilingüe: Content, language and biliteracy (Caslon, 2020)

Dr. Vivian Pratts is an experienced bilingual teacher, elementary principal, and bilingual/ESL PK–12 director. She has over 30 years of educational experience and is currently an educational consultant. Dr. Pratts provides professional development for parents, teachers, and administrators as well as coaching principals in the areas of leadership and second language acquisition. Her current research interests include translanguaging with emergent and experienced bilinguals, and how teachers can extend and support the linguistic repertoire of students. With Dr. Sandra Mercuri, she co-authored the article Designing and Implementing Effective Professional Development and Coaching for Dual Language Programs at DualLanguageSchools.org.

Together, their most recent professional book for educators is C.L.L.I.F: A Transformative Framework for Multilingual Learners Embracing Students Full Linguistic Repertoire (Velázquez Press, 2024).

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

9697 Order today! 866.652.7436 or fax 800.481.5499

Biliteracy para todos

Biliteracy para todos™

Teaching for language connections

Program Videos: Unlocking a World of Learning and Connection

Biliteracy para todos™ authors Dr. Sandra Mercuri and Dr. Vivian Pratts provide an assortment of videos that offer instructional strategies with teachers and innovative approaches to:

• Embrace students’ language practices and culture

• Connect the two languages of instruction

• Empower teachers and students through biliteracy practices

Mercuri & Pratts

Webinar Presentation of Biliteracy para todosTM

Mercuri & Pratts on What We Mean by Cross Linguistic Connections

See More on Our Vimeo Channel!

Mercuri & Pratts on What We Mean by Teaching to the Potential

See how Biliteracy para todos™ impacted achievement in just one summer school program!

biliteracy.myokapi.com

Achievement Gains with Biliteracy para todos™

Biliteracy para todos

Biliteracy para todos™ Teaching for language connections

CROSS LINGUISTIC CONNECTIONS

Early Stage 10 “Grab-and-Go” Sets,eachcontaining: •48Books(12copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Developing Stage 10 “Grab-and-Go” Sets,eachcontaining: •48Books(12copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Advanced Stage 8 “Grab-and-Go” Sets,eachcontaining: •48Books(12copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Combined Three Stages 28 “Grab-and-Go” Sets,eachcontaining: •48Books(12copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Early Stage 18 “Grab-and-Go” Sets,eachcontaining: •24Books(6copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Developing Stage 18 “Grab-and-Go” Sets,eachcontaining: •24Books(6copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Advanced Stage 10 “Grab-and-Go” Sets,eachcontaining:

•24Books(6copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Combined Three Stages 46 “Grab-and-Go” Sets,eachcontaining: •24Books(6copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

CLC AND PVR COMBINED

Early Stage 10 “Grab-and-Go” CLC Sets,eachcontaining: OKBPTCOM01 $7,531 $6,750

•48Books(12copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

18 “Grab-and-Go” PVR Sets,eachcontaining: •24Books(6copieseachof4studenttitlesinEnglishandSpanish) •1TeacherResourceGuide

Developing Stage 10 “Grab-and-Go” CLC Sets,eachcontaining:

•48Books(12copieseachof4studenttitlesinEnglishandSpanish)

•1TeacherResourceGuide

18 “Grab-and-Go” PVR Sets,eachcontaining: •24Books(6copieseachof4studenttitlesinEnglishandSpanish)

•1TeacherResourceGuide

Advanced Stage 8 “Grab-and-Go” CLC Sets,eachcontaining: OKBPTCOM03 $6,136 $5,540

•48Books(12copieseachof4studenttitlesinEnglishandSpanish)

•1TeacherResourceGuide

10 “Grab-and-Go” PVR Sets,eachcontaining:

•24Books(6copieseachof4studenttitlesinEnglishandSpanish)

•1TeacherResourceGuide

Combined Three Stages 28 “Grab-and-Go” CLC Sets,eachcontaining: OKBPTCOM01-03 $22,088 $19,100

•48Books(12copieseachof4studenttitlesinEnglishandSpanish)

•1TeacherResourceGuide

46 “Grab-and-Go” PVR Sets,eachcontaining:

•24Books(6copieseachof4studenttitlesinEnglishandSpanish)

•1TeacherResourceGuide

Spanish-Language Resources for Grades K & Up

Our stellar lineup of resources in Spanish have at their core a solid base in literacy research, adherence to best teaching practice, and an ease-of-implementation that will have your classrooms experiencing real and lasting achievement!

For Phonics

Despegando hacia la lectura: FONÉTICA™ is an authentic Spanish phonics program designed to support students’ biliteracy development as they learn to read in Spanish while making cross linguistic connections to English literacy skills that have a positive transfer. The program includes a systematic and explicit approach to teaching early foundational skills in Spanish using all the literacy components in a cohesive unit.

Also Available in English!

See page 27 for details

For Structured Literacy

El poder de la lectura

El poder de la lectura is the Spanish language alternative to Build Literacy Learning™ , providing an explicit and systematic approach to Spanish foundational skills instruction.

See pages 101-108 for more about Despegando hacia la lectura: FONÉTICA™

Also Available in English!

See page 15 for details

See pages 9-14 for more on El poder de la lectura

myokapi.com

Visitouronlinestoreorfindyourrepat myokapi.com

For Shared Reading

Launch young readers into literacy through rhyme, rhythm, repetition, and highly predictable texts. Enjoy reading together and revisiting familiar books again and again while students develop a love of reading that can last a lifetime.

Also Available in English!

See page 37 for details

® See pages 109-111 for more on award-winning Despegando hacia la lectura ®: Un enfoque de lectura compartida

For Small-Group Instruction

Despegando hacia la lectura’s paired narrative and informational texts, which are connected by a big idea, build the foundations necessary to launch students successfully on their path to college and career readiness. Experience the difference that The Power of the Pair ® can make in your students’ reading achievements! Beginning at Level N*, Okapi has built on the paired-text concept with Perspectivas (Levels N–V), an additional volume of short, point of view texts exploring the issues raised in the paired texts.

Also Available in English! See page 40 for details

For Content Areas

See pages 112-135 for the entire span of developmental reading stages of Despegando hacia la lectura ®

Give your students a flying start to Content-based literacy with ExploraMundosTM, a high interest, informational literacy resource that encourages inquiry and questioning while extending knowledge in STEM and social studies topics linked to the standards.

Also Available in English! See page 64 for details

Turn to pages 136-149 for more about ExploraMundosTM

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

Grades PreK–1

™

Despegando hacia la lectura: FONÉTICA™

Foundational reading skills in Spanish, plus cross-linguistic connections to support biliteracy development!

Despegando hacia la lectura: FONÉTICA™ is an authentic Spanish phonics program designed to support students’ biliteracy development as they learn to read in Spanish, while making cross-linguistic connections to related English literacy skills. The program offers a systematic and explicit approach to teaching early foundational skills in Spanish using literacy components in a cohesive unit: oral language development, phonological awareness, and phonics.

Decodable sentences and decodable books for students to practice their newly learned skills are included in the program. In addition, students will have opportunities to write and practice skills using the dictation method. Teachers will find cross-linguistic connection mini lessons for letters and sounds that have a positive transfer to English at the end of each unit.

STAGE ONE

Modules One, Two, and Three

Vowel sounds, consonants, and digraphs

STAGE TWO

STAGE THREE

Online Program Support!

Modules Four and Five

Consonants, diphthongs, and complex syllables

• Teacher Resource Book

• El gran libro de rimas

• Alphabet Cards

• 30 Decodable Books

• Teacher Resource Book

• 20 Decodable Books

Modules Six and Seven

Scope & Sequences and MORE available online at fonetica.myokapi.com/program-support-materials

Complex syllables, diphthongs, and the hiatus

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

fonetica.myokapi.com

Visit our online store or find your rep at myokapi.com

• Teacher Resource Book

• 20 Decodable Books

Also Available in English

See page 27 for details

Stage OneStage

Each lesson in the Stage One Units provides instruction on:

• Oral language and vocabulary development

• Phonological awareness: identifying and manipulating syllables and phonemes with spoken words

• Phonics: blending syllables and word building

• Writing: forming lowercase and uppercase letters and words

• High-utility words

• Consolidated learning activities which include dictation

• Cross-linguistic connections

In Stage One—with the focus on introducing the alphabet—the decodable books are read at the end of each module.

• Module One’s nine letters and nine high-utility words are featured in the first set of books.

• Module Two’s seventeen letters and nine new high-utility words are featured in the second set of books.

• The full alphabet with nine additional high-utility words are covered in Module Three’s decodable books.

OneStage Two

In Stage Two, the basic structure of the lessons continues. The instructional focus is on:

• Consonants, diphthongs, and complex syllables

• Reading longer multisyllabic and compound words

• Morphology

In Stage Two, a Module Four or Five book can be read at the end of each Unit. Each book contains words with the syllables the students have just learned in that Unit. Informational texts are introduced in Module Four.

Stage ThreeProgram

Stage Three focuses on complex syllables, diphthongs, and the hiatus.

Students continue to work with complex syllables and diphthongs. The hiatus is introduced in Module Seven. These skills allow students to practice their new phonetic knowledge in the context of a sentence and in a longer, connected text.

In Stage Three, a Module Six or Seven decodable book can be read at the end of each Unit. Each book contains words with the complex syllables, diphthongs, and the hiatus the students have just learned in that Unit.

ThreeProgram Components

Teacher Resource Books

Despegando hacia la lectura: FONÉTICA™ is anchored by the Teacher Resource Books—one for each stage—that offer comprehensive, explicit, and systematic instruction in Spanish, divided into three modules for Stage One, and two modules each for Stages Two and Three. Each Module concludes with a review of the letter-sound correspondences taught in that Module. Carefully designed, with full color throughout, Teacher Resource Books are easy to follow and clear in their organization.

STAGE ONE

STAGE TWO

STAGE THREE

Modules One, Two, and Three

Modules Four and Five

Modules Six and Seven

Elgranlibroderimas

The big book of rhymes is a lively, oversized collection of shareable poems, lushly illustrated in full color. It provides a rhyme for each letter of the alphabet. Rhymes can be used in oral language activities, phonological awareness, building vocabulary, and identifying high-utility words.

Nine units for a specific phonic focus and a review unit per Module.

Nine units for a specific phonic focus and a review unit per Module.

Nine units for a specific phonic focus and a review unit per Module.

Decodable Books

Seventy titles in all—these Decodable Books have been carefully crafted to reinforce the skills presented in each module. Compelling texts with recurring groups of characters are offered for Modules One, Two, and Three. Informational texts are introduced in Module Four, and account for half of the decodable texts in the upper modules. Teaching Notes included in every book offer invaluable support for using the texts as part of the overall instructional process.

Tarjetas del alfabeto

Double-sided alphabet cards feature a picture on one side and the picture with its letter correspondence on the reverse. Colorful, laminated, and sturdy, these cards will withstand countless hours of student interactions.

Instruction

Despegando hacia la lectura: FONÉTICA™ teaches phonics in a systematic and explicit process along with five other key components for literacy development: oral language, phonological awareness, fluency, vocabulary, and comprehension.

Oral Language Development

Extend oral language awareness by using letter-sound chants and rhymes focusing on the rhythm, rhyming words, clapping and clicking the syllables, hearing sounds in words, and by using varied oralreading expression, such as loud and soft/fast and slow.

Phonological Awareness

Develop phonological awareness through auditory activities that focus on the sound of the letter introduced in the unit.

Sonido (fonema) /t/

Letra (grafema) Tt

Lenguaje oral

Dilo

Meta

• Desarrollar el lenguaje oral, la rima y el vocabulario.

Lea la rima e invite a los estudiantes a repetir después de usted. Enfóquese en el sonido de la /t/. Aplaudan al escuchar palabras con el sonido /t/.

♫

Tengo, tengo, tengo Tengo, tengo, tengo. Tú no tienes nada.

Tengo tres ovejas en una cabaña.

Una me da leche, otra me da lana, y otra mantequilla toda la semana.

De Despegando hacia la lectura: Fonética El gran libro de rimas Vea Módulo dos, Unidad 1, rima reproducible página 123.

Vocabulario y lenguaje

Explique el significado de palabras desconocidas; por ejemplo, una cabaña es una vivienda pequeña. Lana es el pelo de las ovejas que sirve para tejer. Discuta la rima y el ritmo. Haga preguntas y asegúrese que los estudiantes respondan en oraciones completas. Pregunte: ¿Dónde tiene las ovejas el hablante del poema?

Conciencia fonológica Escúchalo

Metas

• Combinar sonidos para formar sílabas.

• Identi car palabras que riman.

• Separar y contar sílabas.

• Unir sílabas para formar palabras.

• Manipular sílabas.

Combinar sonidos

Diga el sonido de cada letra. Pídales a los estudiantes que repitan los sonidos y los combinen para decir una sílaba. /t/ /a/ = ta /t/ /e/ = te /t/ /i/ = ti /t/ /o/ = to /t/ /u/ = tu

Rimas

Diga una palabra y las dos opciones de rima. Pídales a los estudiantes que identifiquen las dos palabras que riman. Después, repitan las palabras que riman. gato,lana,pato (gato,pato)

quito,grito,lino (quito,grito)

Explique el significado de palabras desconocidas; por estudiantes que identifiquen las dos palabras que riman.

tapa,capa,toma (tapa,capa) moto,foto,loco (foto,moto) bate,calle,tomate (bate,tomate)

Separar y contar sílabas

Diga la palabra y pídales a los estudiantes que escuchen, la repitan y que la separen en sílabas aplaudiendo por cada sílaba.

tomo = /to/ /mo/ (2) bonito = /bo/ /ni/ /to/ (3) todo = /to/ /do/ (2) tomate = /to/ /ma/ /te/ (3) terraza = /te/ /rra/ /sa/ (3)

Vocabulary

Find a word or words in the rhyme to explicitly teach to your students. Define the word using student-friendly language.

Alphabet Review

Progressively review letter-sound correspondences to practice retrieving information. Syllable reviews starts in Module One, Unit 6.

Repaso del alfabeto

Diga el sonido y nombre de cada letra usando las tarjetas del alfabeto. Explique que cada letra tiene una forma mayúscula y una minúscula.

Introduzca la canción del alfabeto y pídales a los estudiantes que canten con usted.

Diga: Acompáñenme a cantar la canción. Presten atención cuando estoy señalando cada letra con el dedo.

Vea la página 135 para la canción del alfabeto.

Repaso de las sílabas

Repase las sílabas aprendidas en lecciones previas, usando los carteles de clase o la pizarra. ma,sa,pa,la me,se,pe,le mi,si,pi,li mo,so,po,lo mu,su,pu,lu Vea la página 137 para la sílabas.

Unir sílabas

Diga las sílabas de cada palabra y pídales a los estudiantes que escuchen, las repitan y las unan para formar una palabra.

/ta/ /ko/ = taco /ta/ /sa/ = taza /ti/ /bu/ /rón/ = tiburón /tim/ /bre/ = timbre /te/ /lé/ /fo/ /no/ = teléfono

Manipular sílabas: añadir sílaba nal

Luego pídales que añadan una sílaba al final.

Diga la sílaba. Pídales a los estudiantes que la repitan. Luego pídales que añadan una sílaba al final. sílaba añadir palabra /ta/ /rro/ tarro /mo/ /to/ moto /jo/ /ta/ jota /go/ /ta/ gota

Módulo dos Unidad 1

Fonética

Escríbelo

Metas

• Identi car y conectar la letra t con el sonido /t/.

• Escribir la t minúscula y la T mayúscula.

• Combinar la t con las vocales para formar sílabas.

• Escribir palabras que comienzan con sílabas de la t

Conectar letra y sonido

Diga: Laletra t produceelsonido/t/. Señale la letra t y la imagen del tigre en la tarjeta del alfabeto de Despegando hacia la lectura: Fonética. Diga: Lapalabra tigre comienzaconel sonido/t/. Lea la tarjeta.

Pregunte: ¿Quépuedodibujarquecomienceconelsonido/t/ quehacelaletra t?Sí,tigre(tortuga,tomate,taco,televisión).

Dibuje el objeto y escriba la palabra al lado. Haga un cartel para la clase con palabras que comiencen con la t Escribir la letra t

Demuestre cómo escribir la letra t minúscula y hable en voz alta, cuando esté formando la letra. Diga: Vamos a a prender a escribir la letra t, que hace el sonido /t/. Empezamos arriba y hacemos una línea hacia abajo y cruzamos con una pequeña líneas. ¡Listo! Repita varias veces con toda la clase. Pídales a los estudiantes que escriban la letra t varias veces. Revise lo escrito.

Vea Módulo dos, Unidad 1, página 170 para escribir la letra mayúscula. Formar sílabas

Diga: Voyadecirelsonidodecadaletra,señalándolaconeldedo.

Pídales a los estudiantes que repitan los sonidos y los combinen para hacer una sílaba. t-a = ta t-e = te t-i = ti t-o = to t-u = tu

Escribir palabras

Demuestre cómo segmentar palabras al escribir.

Diga: Voy a escribir la palabra tomo La digo despacio: /to/ /mo/. La sílaba /to/ esta formada por las letras t-o. La sílaba /mo/ esta formada por las letras m-o. Estas son las sílabas de la palabra tomo. Leamos tomo. Pídales a los estudiantes que escriban la palabra varias veces. Revise lo escrito.

Palabras de alta utilidad

Lo veo y lo digo

Meta

• Aprender la palabra de alta utilidad: jala

Diga: Vamos a aprender una nueva palabra. Enseñe la palabra jala y dígala lentamente.

Escriba la palabra jala y diga: Puedo escuchar las sílabas ja-la y los sonidos /j/ /a/ /l/ /a/.

Dibuje unas cajas de sonido para enseñar los sonidos de la palabra.

Diga: Voy a poner una marca en cada caja por cada sonido que escucho. Después,escribirélaletraquerepresentaelsonido. Apunte a las letras y sonidos o sílabas que los estudiantes ya conocen: a, la

Apoye a los estudiantes mientras aprenden una palabra nueva. Pueden deletrear la palabra en voz alta, aplaudir al escuchar las letras, escribir la palabra en el aire y en el piso. Pídales a los estudiantes que escriban la palabra varias veces. Revise lo escrito.

Aprendizaje consolidado

Léelo

Pídales a los estudiantes que practiquen la lectura con las letras, sonidos y sílabas que ya aprendieron. Consulte las oraciones de práctica del Módulo dos, Unidad 1, en la página XX. Dictado

Dependiendo del nivel de sus estudiantes, puede dictar las sílabas (ta, te, ti, to, tu), palabras del cartel hecho en clase, o una oración de las de práctica de lectura.

Comprando sílabas

Pídales a los estudiantes que tomen turnos completando la frase, Fui de compras y me compré un(a) … completando la frase con una palabra que tenga la sílaba de la t. Por ejemplo: Fuidecomprasymecompréuntaco. Los estudiantes continúan con el juego pensando en palabras que tienen las sílabas de la t (ta, te, ti, to, tu).

Conexiones interlingüísticas

El sonido de la Tt es igual en inglés y español. Consulte la minilección de conexiones interlingüísticas del Módulo dos, Unidad 1, en la página 182.

Grades PreK–1

Teaching Units follow the same structure throughout the program. Content is appropriate for the level of the students at each stage in the program.

High-Utility Words

High-utility words are useful, and many of these need to be taught explicitly. Sound-letter charts are used for explicit instruction of high-utility words.

Phonics

Encourage students to connect a sound to a letter and to write the letter in uppercase and lowercase.

Consolidate Learning

Activities for students (individually, in pairs, or small groups) to practice new knowledge and skills that will help them to develop accuracy and automaticity when reading and writing.

Cross-Linguistic Connections

Cross-linguistic connection mini lesson for letters and sounds with a positive transfer to English.

fonetica.myokapi.com Visit our online store or find your rep at myokapi.com

About the Authors

EMELIA AHMED

Program author Emelia Ahmed is a literacy educator with 30 years of experience and a Master of Science degree in Reading. She has taught reading instruction in Spanish and English, coached educators, and supported curriculum development. Her past roles include teacher, principal, curriculum director, and adjunct professor. She now partners with districts as a biliteracy consultant.

LOURDES HUICI CLEVER

Lourdes Huici Clever, author of the decodable reading books in the program, was born in Mexico City, and was raised speaking Spanish, German, and English. With a Master of Arts in Spanish from Colorado, she has been a professional bilingual editor and translator for 30 years, as well as teaching at several Colorado colleges.

DORA DEBOER

Author Dora DeBoer has spent over 18 years championing bilingual education and literacy development. With a Master’s degree in Educational Leadership, her commitment to fostering multilingual proficiency and educational equity inspires educators and empowers students.

Package Includes

• Teacher Resource Book

STAGE ONE

• 30 Decodable Books in six-packs

• A Big Book of Rhymes

• Alphabet Cards

STAGE TWO

STAGE THREE

• Teacher Resource Book

• 20 Decodable Books in six-packs

ProductCode National ListPrice Your Price

COMPLETE RESOURCE

Stages One, Two and Three

• Teacher Resource Book

• 20 Decodable Books in

• Three Teacher Resource Books

• 70 Decodable Books in six-packs

• A Big Book of Rhymes

• Alphabet Cards

Add to your Complete Resource purchase with one-year digital access to all program components on Okapi Digital LiteracyTM for just $550! Use code OD DHPHST01-03 when ordering.

Despegando hacia la lectura® Un enfoque de lectura compartida

Develop early literacy skills through rhyme, rhythm, repetition, and highly predictable texts!

Your students will:

• enjoy reading together and revisiting familiar books again and again

• begin to recognize and read high-frequency words

• build knowledge of key vocabulary

• understand conventions of print.

Big Books

Eighteen appealing Big Books—stories, rhymes and informational texts:

•capture the readers’ attention and ensure group participation and engagement

•are ideal to introduce early literacy skills and concepts of print

•use rhyme, rhythm, and repetition in the narrative titles

•introduce science and mathematics concepts in the informational texts

•link to the Vocabulary Starters.

Vocabulary Starters

•Sturdy, laminated cards with seven folding panels

•Unambiguous, full-color photographs introduce key vocabulary words

•Back of cards provide a variety of suggestions for introducing and reusing new words

Small Books

Small-book versions of the Big Books extend the shared reading experience. Using the Reading Pen for audio support, students listen and read along.

despegando.myokapi.com

Visitouronlinestoreorfindyourrepat myokapi.com

Lesson Plan Cards and Program Overview

Easy-to-follow lesson plan cards are provided for each Big Book. These plans include explicit instruction to guide teachers through multiple readings of the text.

When revisiting the book, there are suggestions for modeling and teaching specific foundational skills. These skills include:

•phonemic awareness • phonics

•oral language • fluency

•print concepts • modeled writing

Program Overview includes Research Base, Standards Alignment, Progress Assessment, Scaffolding Tips, and more.

Reading Pens

The Reading Pens are preloaded with recordings of all 18 Un enfoque de lectura compartida titles. Touch the tip of the pen to the cover of a small-book version, then to any page, and hear that page read aloud. The pens:

•are durable, safe and easy to use

•enable readers to listen and follow text, reinforcing key vocabulary and foundational skills

•encourage listening and reading enjoyment

•provide encouragement and motivation for students who need additional support.

The link between Despegando hacia la lectura ® Shared Reading books and Vocabulary Starters will enable your students to be familiar with the content and vocabulary of the paired texts at levels A and B of the Despegando hacia la lectura

program. When appropriate, they can move on to this next stage of the program for explicit reading instruction.

Research shows that young Spanish-speaking children who develop literacy in their home language perform better in school.

Despegando hacia la lectura® Un enfoque de lectura compartida

Packages and Pricing

TOPIC SETS

National List Price: $788 / Your Price: $525 Per Set

TopicSetsInclude:

• 6BigBooks

• 36SmallBooks

• 6LessonPlanCards

• 6VocabularyStarters

• 4ReadingPens

• 1ProgramGuide

• 1ClassroomStorageBox

Mi familia y yo Topic Set OK DHSR1000 En el mundo Topic Set OK DHSR2000

Seres vivos Topic Set OK DHSR3000

RenéelronchosoCompartimoslafrutaVeofigurasLacarretera¿Cuáleslamejor mascota? Unespantapájaros divertido

La tienda de campaña ¡Ay caramba! En el bosque de los cuentos El pequeño Mariano

Mi perro CiclónLas cosas favoritas de la abuela

¡Qué alboroto!LA GRAN aventura de Ramona

Elosogoloso¿Quéanimal viveaquí?

LetiLechuga ysuoruga

Despegando® Shared Reading| Complete Resource | OK DHSR1300

• 18 Big Books (1eachof18titles)

• 108 matching Small Books (6eachof18titles)

• 18 Lesson Plan Cards (1eachof18cards)

• 18 Vocabulary Starters (1foreachtitle)

• 12 Reading Pens

• 3 Program Overview Guides

¿Quéhacenlosanimalesenelzoológico?

National List Price $2,363 | Your Price $1,550

Add a 12-month school-wide Okapi Digital LiteracyTM license for Unenfoquedelecturacompartido! OD DHSR1300 | Your Price $450

despegando.myokapi.com

Visitouronlinestoreorfindyourrepat myokapi.com

Despegando hacia la lectura® K–5 Spanish Literacy Resource

Program Overview

What is unique about Despegando hacia la lectura®?

•Supportslanguagedevelopment amongalllearnerswithemphasis onkeyvocabulary

•ScaffoldsbothEnglishandSpanish learnerstowardreadingandlanguage proficienciesintheirprimaryaswellas secondarylanguage

•Deliversallteachertalkandinstructions bytheteachertothestudentsinSpanish.

Paired Texts

Levels A–V

Despegando hacia la lectura ® is a comprehensive, Spanish-language, literacy resource that can be fully implemented as a stand-alone early literacy program. Combine it with its English language counterpart—the award-winning Flying Start to LiteracyTM— for rigorous dual-literacy instruction. Despegando hacia la lectura ® has been carefully crafted with meticulous attention paid to the unique issues relating to phonics and phonemic awareness for Spanish-language learners. It reflects the core structure of the Spanish language.

Paired Books connect meaningful information and appealing narratives and engage learners with content-rich reading.

• Before-, During-, and After- Reading activities

• Full spectrum of foundational instruction with ongoing assessment

• Synthesizing activities to reinforce key concepts in each pair of texts

Perspectivas

Point of View Texts at Levels N–V

Perspectivas are teamed with the paired books to create a dynamic, three-book concept set. Lesson Plans are provided for each Perspectivas title, setting the stage for exciting classroom conversations and writing.

Grades K–5 • Levels A–V (1–50)*

Vocabulary Starters

Shared Reading and Levels A–B

Vocabulary Starters provide direct reading support at the Early Emergent Stage.

• Sturdy, laminated cards with seven folding panels

• Unambiguous, full-color photographs introduce key vocabulary words

• Reverse side of each card provides a variety of suggestions for introducing and reusing new words

Lesson Plan Cards

Shared Reading and Levels A–V

Lesson Plan Cards deliver explicit, systematic instruction with diagnostic support built in.

• Before-, During-, and After- Reading activities

• Full spectrum of foundational instruction with ongoing assessment

• Synthesizing activities to reinforce key concepts in each pair of texts

Take-Home Books

Levels A–P

Six copies each of affordable black-and-white versions of 146 of the Student Titles (one title from each pair at A—P).

• Additional reading and writing activities for home

• An easy-to-implement opportunity for parental involvement

despegando.myokapi.com

Visitouronlinestoreorfindyourrepat myokapi.com

Despegando hacia la lectura® Small Group Reading Instruction

Despegando hacia la lectura®

Lesson Plan Cards:

•provide practical, systematic, and easy-toimplement instructional plans

•integrate (at the beginning reading stages) oral language, comprehension, phonemic awareness, phonics, vocabulary development, fluency, and writing

•include ongoing assessment and follow-up activities

•support ELL instruction with a highlighted section in every lesson plan

•offer assurance that instructional goals are being met, with standards links on the front of every card.

Before Reading

•Activate prior knowledge through a variety of engaging suggestions

•Introduce challenging or unfamiliar vocabulary

•Focus on reading strategies specific to the book

During Reading

•Monitor and support each student’s reading

•Revisit specific reading strategies as needed

•Guide students as they apply these strategies

After Reading

•Use discussion prompts to encourage collaborative conversations about the book

•Ask students to return to the text for evidence to support their responses

•Provide positive feedback on students’ use of the lesson’s reading strategies

Returning to the Book

•Develop fluency with modeling, paired practice, and independent re-reading

Lesson Plans

Reading Strategies

Monitoring reading strategies

•Work with words through a variety of suggestions for building phonemic awareness and reinforcing phonics

•Connect reading and writing with teacher modeling and prompts for student practice

Synthesizing the Pair

•Discussion prompts encourage students to consider the pair’s “big idea”

•Reproducible Activity Cards offer creative suggestions for exploring the topic further

•Blackline Masters provide opportunities for ongoing assessment

Tarjeta de actividades

Paired fiction and informational texts, photographic Vocabulary Starters, and English Learner instructional support bring reading success for ELs at all levels. Grades K–5 • Levels A–V (1–50)*

Complete Resource | Nine Reading Stages, Levels A–V

• 2040 Paired-Text Student Books (6copieseachof340titles)

• 252 Perspectivas Texts (6copieseachof42titles)

• 170 Paired-Text Lesson Plan Cards (1foreachpairoftitles)

• 42 Perspectivas Lesson Plan Cards (1foreachtitle)

• 876 Take-Home Books (6copieseachof146titles)

• 24 Vocabulary Starters

• 19 Storage Boxes

Vocabulary development

Writing using evidence from the text

(1–50)*

Price without Shared Reading: OK DHAVK520-NOSR

National List Price: $19,694 |Your Price $17,100

Add a 12-month school-wide Okapi Digital LiteracyTM license for Despegandohacialalectura!

OD DHAVK500 | Your Price $3,150

With Un enfoque de lectura compartida™ (shared reading) included: OK DHAVK520

National List Price: $22,056 |Your Price $19,050

Add a 12-month school-wide Okapi Digital LiteracyTM license for Despegandohacialalectura plus Shared Reading!

OD DHAVK500+SR | Your Price $3,600

Early Emergent Reading Stage

Paired, Connected Texts at This Stage:

•Establish a full range of concepts about print

•Introduce common stems and vocabulary

•Introduce first high-frequency words

•Focus on phonemic awareness and phonics

•Build comprehension and fluency through a range of reading strategies.

Online Program Support!

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in English!

See page 44 for details

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com Let us help you customize a

UniquetotheEarlyEmergentStage–a Vocabulary Starter is providedforeachpairoftitles.Itintroducesthewrittenformof keyvocabularythroughunambiguous,labeledphotographs. Suggestionsforintroducingandreusingvocabularywordsare includedonthebackofeachVocabularyStarter.

BOXED CLASSROOM SET

•288 Student Books (6copieseachof48titles)

•24 Lesson Plan Cards (1foreachpairoftitles)

•24 Vocabulary Starters (1foreachpairoftitles)

•144 Take-Home Books (6copieseachof24titles)

•2 Storage Boxes

Guided Reading Levels A–B (1–2)*

Early Emergent Reading Stage OK DHEE1018 National List Price (Print Only)

$2,373 | Your Price $2,195

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHEE1018 license for this stage! Your Price $350

Early Emergent Reading Stage 12-Packs | Levels A–B (1–2)* | $86.00 per package

12-Packsinclude6copiesofeachpairedtextpluslessonplancardandVocabularyStarter. (NationalListPrice:$92.40perpackage)

Guided Reading Level A (1)*Guided

Reading Level B (2)*

Mi cuerpo / ¡Aquí estoy! El cuerpo Vocabulary Starter OK DHEE1250-12

Miro las frutas / Comer fruta Frutas Vocabulary Starter OK DHEE1290-12

Mascotas en casa / Mi mascota Mascotas Vocabulary Starter OK DHEE1010-12

Yo / Perros / Hacer cosas Vocabulary Starter OK DHEE1050-12

En el jardín / ¡Vaya! Mira eso Animales en miniatura Vocabulary Starter OK DHEE1070-12

¿Dónde están los animales? / Animales en el zoológico / Animales del zoológico Vocabulary Starter OK DHEE1110-12

¿Qué forma puedes ver? / Las formas a nuestro alrededor / Formas Vocabulary Starter OK DHEE1270-12

¿Qué hay en la playa? / Un día en la playa En la playa Vocabulary Starter OK DHEE1370-12

Escondite / Mi cumpleaños

Mi familia Vocabulary Starter OK DHEE1030-12

En mi vecindario / Las personas que me ayudan / Las personas que nos ayudan Vocabulary Starter OK DHEE1390-12

Mis juguetes / Ir por todas partes Transporte Vocabulary Starter OK DHEE1090-12

Las crías de los animales / ¿Qué puedes ver? / Los animales jóvenes Vocabulary Starter OK DHEE1410-12

En mi bicicleta / ¿Puedes llegar hasta aquí? / Posición Vocabulary Starter OK DHEE1310-12

La caja de disfraces / Ir de compras Ropa Vocabulary Starter OK DHEE1350-12

Te miro / Animales de la granja Animales de granja Vocabulary Starter OK DHEE1130-12

En la tienda / Cosas que me gustan Compras Vocabulary Starter OK DHEE1170-12

Peces / ¡Ven a ver! Colores Vocabulary Starter OK DHEE1190-12

¿Qué hiciste? / Ir a lugares / Lugares a los que voy Vocabulary Starter OK DHEE1230-12

En la casa del abuelo / Pasteles para vender / En la escuela Vocabulary Starter OK DHEE1330-12

¿Cómo está el tiempo hoy? / Me gusta el tiempo que hace / El estado del tiempo Vocabulary Starter OK DHEE1430-12

Mírame jugar / El patio de juegos Patio de juegos Vocabulary Starter OK DHEE1150-12

Un día en el zoológico / Mira mi perro Las emociones Vocabulary Starter OK DHEE1450-12

Mi familia y yo / ¿Puedes hacer esto? Me gusta … Vocabulary Starter OK DHEE1210-12

Hacemos sopa / El huerto Las verduras Vocabulary Starter OK DHEE1470-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

despegando.myokapi.com

116117

Visitouronlinestoreorfindyourrepat myokapi.com

Emergent Reading Stage

Paired, Connected Texts at This Stage:

•Revisit key vocabulary

•Revisit and extend high-frequency words

•Build comprehension and fluency through a range of reading strategies. Also Available in English!

See page 46 for details Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

•240 Student Books (6copieseachof40titles)

•20 Lesson Plan Cards (1foreachpairoftitles)

•120 Take-Home Books (6copieseachof20titles)

•2 Storage Boxes

Emergent Reading Stage OK DHEM2000 National List Price (Print Only) $1,817 | Your Price $1,685

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHEM2000 license for this stage! Your Price $350

Emergent Reading Stage 12-Packs | Levels C–D (3–6)* | $78.00 per package 12-Packsinclude6copiesofeachpairedtextpluslessonplancard. (NationalListPrice:$84.00perpackage)

Mi caballo / La carrera de autos

OKDHEM2250-12

Buscar animales / ¿Dónde está Rana?

OKDHEM2290-12

Mira mi ropa / ¿Dónde está mi madre?

OKDHEM2330-12

Tortugas / Un hogar para la tortuga OKDHEM2370-12

La frutería / Las bananas son lo mejor OKDHEM2270-12

Guided Reading Level C (3)*

Ganadores / El conejo y el zorro OKDHEM2010-12

Guided Reading Level C (4)*

En el bosque / Encontrar alimento OKDHEM2030-12

Sorprendentes partes de animales / La tortuga está atascada OKDHEM2310-12

¿Qué comen los murciélagos? / El almuerzo del gran murciélago OKDHEM2350-12

Hagamos el baile del mono / La danza del monito OKDHEM2390-12

La gran caja / El pirata Sam OKDHEM2070-12

Guided Reading Level D (6)*

Nidos de hormigas / ¿Dónde está mi nido? OKDHEM2130-12

¿Qué soy? / Rena crece OKDHEM2190-12

Llegó la niebla / Perdidos en la niebla OKDHEM2090-12

Muchas patas / Las mejores patas OKDHEM2150-12

Arañas / Una buena trampa OKDHEM2210-12

Los hermanos mayores / El gato y el ratón OKDHEM2050-12

En la granja del abuelo / Una nueva granja para Vaca OKDHEM2110-12

Mi diario de campamento / Un mono en el campamento OKDHEM2170-12

En movimiento / El auto del abuelo OKDHEM2230-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with

despegando.myokapi.com

118119

Visitouronlinestoreorfindyourrepat myokapi.com

Early Reading Stage

Paired, Connected Texts at This Stage:

•Revisit key vocabulary

•Revisit and extend high-frequency words

•Build comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in English!

See page 48 for details

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

•240 Student Books (6copieseachof40titles)

•20 Lesson Plan Cards (1foreachpairoftitles)

•120 Take-Home Books (6copieseachof20titles)

•2 Storage Boxes

Guided Reading Levels E–F (8–10)*

Early Reading Stage OK DHEA3000 National List Price (Print Only) $1,817 | Your Price $1,685

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHEA3000 license for this stage! Your Price $350

Early Reading Stage 12-Packs | Levels E–F (8–10)* | $78.00 per package

12-Packsinclude6copiesofeachpairedtextpluslessonplancard. (NationalListPrice:$84.00perpackage)

Guided Reading Level E (8)*

Insectos / ¿Dónde están las uvas? OKDHEA3010-12

Cuando sale el sol / Cuando se pone el sol OKDHEA3070-12

Rescate de murciélagos / Sara y los murciélagos OKDHEA3130-12

Animales que necesitan lodo / ¡Lodo, lodo, lodo! OKDHEA3190-12

Calamar / Gran Calamar y Pequeño Calamar OKDHEA3030-12

Nuestro lugar / ¿Dónde podemos jugar? OKDHEA3090-12

El gran concurso de pasteles / Un pastel para Mimoso OKDHEA3250-12

Cómo cuidar de tus ranas / El nuevo estanque de Rana OKDHEA3110-12

Superperros / ¡Metiche nos salvó! OKDHEA3270-12

Charlie y los cocodrilos / ¡No me comas! OKDHEA3290-12

Guided Reading Level F (10)*

Enséñame cómo hacerlo / Pequeño Cachorro OKDHEA3150-12

Mantenerse a salvo / Buscar el almuerzo OKDHEA3210-12

Mantenerse a salvo en la playa / El rescate de Sara en la playa OKDHEA3330-12

Los grandes barcos necesitan remolcadores / El equipo de remolcadores OKDHEA3230-12

Orugas asombrosas / Orugas para el almuerzo OKDHEA3350-12

Cuidar a los polluelos de avestruz / Papá Avestruz y los nuevos polluelos OKDHEA3370-12

El ciruelo / Mi árbol OKDHEA3050-12

Grandes casas, animales pequeños / ¡Tina se va de casa! OKDHEA3310-12

El equipo para saltar a la cuerda / La carrera divertida OKDHEA3170-12

Atracciones para todos / En el parque de atracciones OKDHEA3390-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

despegando.myokapi.com

120121

Visitouronlinestoreorfindyourrepat myokapi.com

Transitional Reading Stage

Paired, Connected Texts at This Stage:

•Present students with more complex language structures

•Revisit and extend high-frequency words

•Further develop comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in English!

See page 50 for details

•240 Student Books (6copieseachof40titles)

•20 Lesson Plan Cards (1foreachpairoftitles)

•120 Take-Home Books (6copieseachof20titles)

•2 Storage Boxes

Guided Reading Levels G–H (12–14)*

Transitional Reading Stage OK DHTR4000 National List Price (Print Only) $1,817 | Your Price $1,685

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHTR4000 license for this stage! Your Price $350

Transitional Reading Stage 12-Packs | Levels G–H (12–14)* | $78.00 per package 12-Packsinclude6copiesofeachpairedtextpluslessonplancard. (NationalListPrice:$84.00perpackage)

Guided Reading Level G (12)*

¿Qué hay para desayunar? / El desayuno del Rey OKDHTR4010-12

Colas inteligentes / La cola del mono OKDHTR4070-12

Comedores de insectos / Tengo hambre

OKDHTR4130-12

Las nutrias marinas y el bosque de algas / La suerte de las nutrias marinas

OKDHTR4190-12

El club de patinaje / Ele va a patinar OKDHTR4030-12

Enredaderas y trepadoras / Cultivo de sandías OKDHTR4090-12

Caza de insectos / Deshacerse de los insectos OKDHTR4250-12

Hacer amigos / La grulla azul OKDHTR4110-12

Una rana en un estanque / Demasiado frío para Rana OKDHTR4270-12

Vacaciones de verano / Acampar con papá OKDHTR4290-12

Caminatas / Maya y el príncipe OKDHTR4050-12

Mantarrayas / La mantarraya que quería volar OKDHTR4310-12

Guided Reading Level H (14)*

Animales en cuevas / Hay oro en esa cueva

OKDHTR4150-12

Lluvia monzónica / El ave sabia OKDHTR4210-12

Puentes fantásticos / Juan el explorador y la ciudad oculta

OKDHTR4330-12

No más basura / La roca de Killeen OKDHTR4230-12

Cuidar a un mono bebé / El rescate de las ardillas bebé OKDHTR4350-12

Álbum del huracán / ¿Dónde está Coco? OKDHTR4370-12

El naufragio del Maitland / La gran carrera de vapores de ruedas

OKDHTR4170-12

¿Qué necesitan las plantas? / El gran concurso de cultivo de calabazas OKDHTR4390-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

despegando.myokapi.com

122123

Visitouronlinestoreorfindyourrepat myokapi.com

Early Fluent Reading Stage

Paired, Connected Texts at This Stage:

•Support sustained reading with the introduction of chapter books

•Increase the conceptual load

•Increase the complexity of language structures

•Continue to develop comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in English!

See page 52 for details

Necesitarás:

•240 Student Books (6copieseachof40titles)

•20 Lesson Plan Cards (1foreachpairoftitles)

•120 Take-Home Books (6copieseachof20titles)

•2 Storage Boxes

Guided Reading Levels I–J (16–18)*

Early Fluent Reading Stage OK DHEF5000 National List Price (Print Only) $2,100 | Your Price $1,950

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHEF5000 license for this stage! Your Price $350

Early Fluent Reading Stage 12-Packs | Levels I–J (16–18)* | $90.00 per package

12-Packsinclude6copiesofeachpairedtextpluslessonplancard. (NationalListPrice:$96.60perpackage)

Guided Reading Level I (16)*

Los olores de los animales / Ángel hace limpieza

OKDHEF5010-12

¡Ay! Me duele / ¡No tiene gracia, Carlitos! OKDHEF5290-12

Mi diario de fútbol / Los Leones Valientes

OKDHEF5130-12

¡Puedes marcar la diferencia! / ¡Salvemos a las nutrias marinas!

OKDHEF5370-12

Motocicletas / Un nuevo trabajo para Tomás OKDHEF5250-12

Vivir cerca de un volcán / ¡Alerta volcánica! OKDHEF5070-12

Al rescate / Supersam OKDHEF5330-12

La limpieza de nuestro pantano / Los polluelos de cisne OKDHEF5190-12

Plantas pegajosas y peligrosas / Cuidando a Chispa OKDHEF5030-12

Flamencos / Rubí en el medio OKDHEF5310-12

Cuando los leones cazan / El baile de Rory OKDHEF5270-12

La nueva vida de Nadif / La manada de Gasari OKDHEF5090-12

Guided Reading Level J (18)*

Comida divertida para preparar y comer / El nuevo cocinero de la Reina

OKDHEF5150-12

Elefantes del desierto / Hermano elefante OKDHEF5390-12

Sobrevivir en el bosque helado / Cómo Alce aprendió a nadar OKDHEF5350-12

Natación en aguas heladas / El gorro de pesca de la suerte OKDHEF5210-12

Serpientes asombrosas / Las olimpíadas de serpientes OKDHEF5050-12

Mensaje enviado / Salvamos a papá OKDHEF5110-12

En lo profundo del mar / Una aventura en lo profundo del mar OKDHEF5170-12

Robots de hoy, robots del mañana / Robots fuera de control OKDHEF5230-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

despegando.myokapi.com

124125

Visitouronlinestoreorfindyourrepat myokapi.com

Fluent Reading Stage

Paired, Connected Texts at This Stage:

•Support sustained reading with chapter books

•Increase the conceptual load

•Increase the complexity of language structures

•Continue to develop comprehension and fluency through a range of reading strategies.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com

Look Inside the Book! Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in English! See page 54 for details

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

•288 Student Books (6copieseachof48titles)

•24 Lesson Plan Cards (1foreachpairoftitles)

•144 Take-Home Books (6copieseachof24titles)

•2 Storage Boxes

Fluent Reading Stage 12-Packs

Fluent Reading Stage

Guided Reading Levels K–M (20–28)*

OK DHFL6000 National List Price (Print Only) $2,512 | Your Price $2,325

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHFL6000 license for this stage! Your Price $350

| Levels

K–M

(20–28)* | $90.00 per package

12-Packsinclude6copiesofeachpairedtextpluslessonplancard. (NationalListPrice:$96.60perpackage)

Guided Reading Level K (20)*Guided Reading Level L (24)*Guided Reading Level M (28)*

Jardines asombrosos / El jardín del gigante

OKDHFL6010-12

Osos polares / Un oso llamado Problemas

OKDHFL6030-12

Cuidar las charcas de marea / El pequeño cangrejo listo

OKDHFL6050-12

Hormigas guerreras / Hormigas asesinas OKDHFL6070-12

Conceptos básicos de baloncesto / Alicia con la cabeza en alto

OKDHFL6250-12

Animales que tratan de impresionar / El tutú ajustado

OKDHFL6270-12

Sobrevivir a la inundación / La gran inundación de Valle Polvoriento OKDHFL6290-12

Un largo día en el río / La cocodrilo y la chorlito OKDHFL6310-12

Animales que almacenan alimentos / Historia de dos ardillas OKDHFL6090-12

Soy inventor / El vehículo veloz de Gloria OKDHFL6110-12

Las características físicas adecuadas / Arturo presta ayuda OKDHFL6130-12

El primer vuelo / La aventura en globo OKDHFL6150-12

Suricatas trabajando / Anuar, la suricata brillante OKDHFL6330-12

Protejamos los océanos: actuemos localmente / El Reino de Floralia OKDHFL6350-12

Mi casa lejana / La última farera OKDHFL6370-12

Diseñados para la velocidad / El príncipe durmiente OKDHFL6390-12

El funcionamiento del cuerpo / El viaje misterioso OKDHFL6170-12

Construido a mano / El Dr. Zardos y la Piedra Mental OKDHFL6190-12

Vivir en el espacio / El campamento espacial OKDHFL6210-12

Diario del maratón / El hombre del maratón OKDHFL6230-12

Los osos polares y el hielo del mar Ártico / La aventura de Atka en el hielo OKDHFL6410-12

Colibríes / El beso de un ala de colibrí OKDHFL6430-12

La gran carrera del ferrocarril / La leyenda de Jimmy Drake OKDHFL6450-12

Escarcha / El pequeño encendedor de ahumadores OKDHFL6470-12

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

despegando.myokapi.com

126127

Visitouronlinestoreorfindyourrepat myokapi.com

Paired Texts and Perspectivas

“Learners will love the selection of short, authentic texts: posters, photographs, vox pops, interviews, arguments, personal recounts, reports, and primary source documents. And, teachers will love the resulting bursts of language, deep thinking, and powerful persuasive writing.“

—LindaHoyt,SeriesConsultant

Leveled texts partner with Perspectivas collections to build and extend students’ understanding of timely concepts.

Issue: Disappearing Rainforests

Paired Texts Lesson Plan: Sequence

• Exploring Vocabulary

• Establishing Strategy Focus

• Reading with Teacher Support

• Working with a Partner

• Quick Writing

• Talk About the Book

• Vocabulary Reflection

• Strategy Reflection

Perspectivas Lesson Plan: Sequence

• Inquiry

• Independent Partner Work

• Thinking and Talking Circles

• Reading Closely

• Writing a Persuasive Argument

Through the teaching and learning model embedded in the Lesson Plans, students build a metacognitive understanding of their own learning process.

Perspectivas motivate and enable Spanishspeaking ELs to express opinions and explore ideas about what they read.

Everything you love about Despegando hacia la lectura® …

Beginning with the Fluent Plus stage, we continue our award-winning formula of pairing a narrative text with an informational text, both connected by the same big idea.

Informational texts presentthebigideasaround aconcept.Theygobeyondreaders’personal experiencesandincludearangeoffeatures includingprimarysourcesthatsupportthetext.

Narrative texts reflectthebigideas throughtheircharactersandplots. Theyfeatureplotswithsubplots, non-sequentialtreatmentoftime, andarangeofliterarydevices.

Lesson Plans forthepairencouragehigher-levelthinking andprovideopportunitiesforstudentstowriteinresponseto boththetextandtotheircollaborativeconversations.

…plus Perspectivas—short, point of view texts exploring the issues raised by the big ideas in the paired texts.

Extend students’ thinking with additional views of the issues introduced in the paired texts.

Perspectivas containshorttextsinamagazinestyleformatandincludeposters,arguments, discussions,letters,andvisualimages.

Perspectivas Lesson Plans engageandsupportstudentsincritical discussions,andinrecognizingdifferentpointsofview.Performance taskcardsprovideopportunitiestodemonstratecomprehension.

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with

despegando.myokapi.com

Visitouronlinestoreorfindyourrepat myokapi.com

Fluent Plus Reading Stage

Paired, Connected Texts at This Stage:

•Support sustained reading with chapter books

•Increase the use of more specialized and technical language

•Use literary language

•Encourage drawing inferences from the text.

Perspectivas Texts at This Stage:

•Present issues related to the paired texts

•Introduce the thinking and talking circle to promote deep discussion

•Promote close reading.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com

Perspectivas Lesson Plans helpyouengageand supportstudentsincriticaldiscussions,assistthem inrecognizingdifferentpointsofview,andwrite persuasivelyfromtheirownperspectives.

En el camino a la escuela, me encontré con Isabella cuando salía del edi cio de apartamentos donde vive. Es una compañera de mi clase, pero nunca nos vemos fuera de la escuela.

Deberían haber visto la cara de Isabella cuando vio a Goldie. Estaba realmente entusiasmada.

–¡No sabía que tenías un perro! ¿Cómo se llama? –me preguntó.

–Goldie. Es un labrador de pura raza. ¿Quieres acariciarlo?

–¡Me encantaría! –dijo Isabella, y se inclinó mientras dejaba con cuidado sobre el suelo una caja de plástico que llevaba.

–Es hermoso –susurró, mientras acariciaba con suavidad la cabeza de Goldie.

Le dije que cuando Goldie fuera mayor, lo llevaría a exhibiciones, y que seguro ganaría muchos premios.

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

Guided Reading Levels N–P (30–38)*

BOXED

•216 Student Books (6copieseachof36titles)

•18 Paired-Text Lesson Plan Cards (1foreachpairoftitles)

•108 Perspectivas Books (6copieseachof18titles)

•18 Perspectivas Books Lesson Plan Cards (1foreachtitle)

• 108 Take-Home Books (6copieseachof18titles)

• 3 Storage Boxes

Fluent Plus Reading Stage OK DHFP7019 National List Price (Print Only) $2,993 | Your Price $2,770

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHFP7019 license for this stage! Your Price $350

Fluent Plus Reading Stage 18-Packs | Levels N–P (30–38)* | $145.00 per package

18-Packsinclude6copiesofeachpairedtext,6copiesofthe Perspectivas book,and2lessonplancards.

(NationalListPrice:$156.45perpackage)

Guided Reading Level N (30)*Guided Reading Level O (34)*

Salamandras asombrosas / Salamandra sorpresa / Tener una mascota:

¿Qué debes saber?

OKDHFP7010-18

Rescate de alimentos: Aprovechar mejor la comida / El rey del despilfarro / ¡Dejemos de desperdiciar comida!: ¿Cómo podemos lograrlo?

OKDHFP7050-18

Hallazgos famosos / La tumba perdida / ¿Qué es un tesoro?: ¿Qué cosas valoras?

OKDHFP7250-18

Locura por el maíz / El gran invento de maíz / Los alimentos: ¿Cuáles hacen bien y cuáles no?

OKDHFP7030-18

Salvar a los lobos salvajes / El secreto del lobo / El lobo malvado: ¿Verdadero o falso?

OKDHFP7070-18

Trabajos en la naturaleza / Los Bienhechor salen de campamento / Vida salvaje en la ciudad: ¿Por qué debemos protegerla?

OKDHFP7270-18

Veneno mortal: ¿mata o cura?/ La princesa obstinada / Animales peligrosos: ¿Qué debemos saber?

OKDHFP7090-18

El problema del agua / Ming salva al pueblo / El agua: ¿Es la clave de la vida?

OKDHFP7130-18

Montando olas / ¡Caída espectacular! / Ser valiente: ¿Qué significa?

OKDHFP7110-18

Reading Level P (38)*

Increíbles casas subterráneas / Las cuevas naturales / Los lugares donde vivimos: ¿A qué llamamos hogar?

OKDHFP7170-18

Incendios forestales / Una elección difícil / El fuego: ¿Es amigo o enemigo?

OKDHFP7190-18

Las estaciones en el bosque de algas / La cueva de Los Truenos / El planeta Océano: ¿Cuán importante es?

OKDHFP7150-18

Las alertas de la naturaleza / ¡Que vuelvan las ranas! / Animalitos: El bueno, el malo y el feo

OKDHFP7290-18

Dragones / Cuentos de dragones / Cuentos que dan miedo: ¿Cuanto más miedo dan mejor?

OKDHFP7310-18

Debemos proteger los bosques vírgenes / Los árboles de Dan / Los árboles: ¿Por qué los necesitamos?

OKDHFP7210-18

Bajo el hielo / La profesora Valdor y el láser gigante / Fijar metas: ¿Qué es lo importante?

OKDHFP7230-18

La plaga del plástico / El desafío sin-plástico / El plástico: ¿Es útil o dañino?

OKDHFP7330-18

Viento eléctrico / La maravillosa Maddie / Tener una mente no cuadriculada: ¿Que significa?

OKDHFP7350-18

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

despegando.myokapi.com

130131

Visitouronlinestoreorfindyourrepat myokapi.com

Advanced Fluent Reading Stage Levels Q–S

Paired, Connected Texts at This Stage:

•Support sustained reading with chapter books

•Increase the use of more specialized and technical language

•Use literary language

•Encourage drawing inferences from the text.

Perspectivas Texts at This Stage:

•Provide essential questions to promote purposeful reading

•Promote recognizing different points of view

•Include a variety of short, authentic texts

•Encourage collaborative conversations

•Extend learning through performance tasks.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in English!

See page 60 for details

Perspectivas Lesson Plans helpyouengageand supportstudentsincriticaldiscussions,assistthem inrecognizingdifferentpointsofview,andwrite persuasivelyfromtheirownperspectives.

Let us help you customize a resource that matches your instructional goals AND budget. Contact us at info@myokapi.com

•144 Student Books (6copieseachof24titles)

•12 Paired-Text Lesson Plan Cards (1foreachpairoftitles)

•72 Perspectivas Books (6copieseachof12titles)

•12 Perspectivas Books Lesson Plan Cards (1foreachtitle)

•2 Storage Boxes

Guided Reading Levels Q–S (40)*

Advanced Fluent Q–S Reading Stage OK DHAF8020 National List Price (Print Only) $2,134 | Your Price $1,975

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHAF8020 license for this stage! Your Price $350

Advanced Fluent Q–S Reading Stage 18-Packs | Levels Q–S (40)* | $162.00 per package

18-Packsinclude6copiesofeachpairedtext,6copiesofthe Perspectivas book,and2lessonplancards. (NationalListPrice:$174.30perpackage)

Guided Reading Level Q (40)*Guided Reading Level R (40)*

¿Cómo se hace un campeón? / Como pez en el agua / Deportes competitivos: ¿Es la competencia buena para los niños?

OKDHAF8010-18

Tras la escena del zoológico / Tan lejos de casa / Animales en cautiverio: Lo bueno y lo malo

OKDHAF8130-18

HeroRATs: Ratas heroínas / Una ratita inteligente / Animales que trabajan: ¿Cuáles son los puntos de vista?

OKDHAF8030-18

¡Llévame a la escuela! / Escalera al cielo / La educación: ¿Derecho o privilegio?

OKDHAF8150-18

Los primeros visitantes / Odiseo y el Cíclope / Aventuras arriesgadas: ¿A qué costo?

OKDHAF8050-18

El majestuoso río Mississippi / El niño y el río / Compartir el río: ¿Cuáles son los retos?

OKDHAF8170-18

Polio: Una enfermedad aterradora / ¡A bailar! / Prevenir enfermedades: ¿Cuáles son los puntos de vista?

OKDHAF8070-18

¿Cuál es la atracción? / Rescate en el Cañón Azul / Destinos de vacaciones: ¿Demasiado populares?

OKDHAF8190-18

Nuestra Tierra activa / Nace un géiser / Vivir en lugares peligrosos: ¿Cuáles son los puntos de vista?

OKDHAF8090-18

Energía limpia / Sobreviviente del terremoto / El impacto del cambio climático: ¿Por qué es importante la energía limpia?

OKDHAF8110-18

Proteger al pueblo flechero / ¡Intrusos! / Pueblos no contactados: ¿Deberíamos dejarlos en paz?

OKDHAF8210-18

Explorar el espacio / Rescate en el mar / Explorar el espacio: ¿Sirve de algo?

OKDHAF8230-18

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

132133 despegando.myokapi.com

Visitouronlinestoreorfindyourrepat myokapi.com

Advanced Fluent Reading Stage Levels T–V

Paired, Connected Texts at This Stage:

•Motivate readers with rich content

•Support active engagement in reading

•Integrate reading, writing, listening, and speaking

•Stimulate critical thinking through reading closely.

Perspectivas Texts at This Stage:

•Provide essential questions to promote purposeful reading

•Promote recognizing different points of view

•Include a variety of short, authentic texts

•Encourage collaborative conversations

•Extend learning through performance tasks.

Online Program Support!

Scope & Sequences, Pacing Guides, Assessment Checklists, and MORE available online at despegando.myokapi.com

Look Inside the Book!

Review digital samples of books and lesson plans at myokapi.com/digital-samples

Also Available in English! See page 62 for details

Perspectivas Lesson Plans helpyouengageand supportstudentsincriticaldiscussions,assistthem inrecognizingdifferentpointsofview,andwrite persuasivelyfromtheirownperspectives.

Let us help you customize a

•144 Student Books (6copieseachof24titles)

•12 Paired-Text Lesson Plan Cards (1foreachpairoftitles)

•72 Perspectivas Books (6copieseachof12titles)

•12 Perspectivas Books Lesson Plan Cards (1foreachtitle)

•2 Storage Boxes

Guided Reading Levels T–V (50)*

Advanced Fluent T–V Reading Stage OK DHAF9020 National List Price (Print Only)

$2,134 | Your Price $1,975

Add a 12-month school-wide OkapiDigitalLiteracyTM OD DHAF9020 license for this stage! Your Price $350

Advanced Fluent T–V Reading Stage 18-Packs | Levels T–V (50)* | $162.00 per package

18-Packsinclude6copiesofeachpairedtext,6copiesofthe Perspectivas book,and2lessonplancards.

(NationalListPrice:$174.30perpackage)

Guided Reading Level T (50)*Guided Reading Level U (50)*

Animales en peligro: El orangután / La jornada de Ahmad / Las selvas tropicales desaparecen: ¿Cuáles son los puntos de vista?

OKDHAF9010-18

Alianzas entre animales / Recolectores de miel / Convivencia:

¿Qué criatura se beneficia más?

OKDHAF9130-18

Descubrir el mundo perdido / La exploración de las islas Galápagos / Maravillas naturales: ¿Cómo las protegemos?

OKDHAF9030-18

Restaurar los arrecifes de coral / Corales coloridos / Ecosistemas en problemas: ¿Podemos salvarlos?

OKDHAF9150-18

La lucha por los derechos de los niños / Un dólar por día / Los niños y el trabajo: ¿Cuáles son los puntos de vista?

OKDHAF9050-18

Liderar el camino / Un líder improbable / ¿Qué hace a un líder?: ¿Cuáles son los retos?

OKDHAF9170-18

¡La cámara no miente! / El notición / En la mira: El poder de la fotografía

OKDHAF9070-18

La vida en los climas extremos / En el desierto / Convivir con el clima: ¿Cuáles son los desafios?

OKDHAF9090-18

Vivir con robots / Milo y los robots / Robots: ¿Útiles o dañinos?

OKDHAF9190-18

Internet y privacidad / ¡Etiquetado! / La vigilancia a cada paso: ¿Privacidad vs. seguridad?

OKDHAF9210-18

El misterio de las pirámides / Rey por una semana / Tesoros arqueológicos: ¿A quién le pertenecen?

OKDHAF9110-18

Regresar de la extinción / El regreso del mamut lanudo / Extinto por siempre: ¿O no?

OKDHAF9230-18

*Levels indicated by letters are Okapi’s unique measurements, comparable to the Guided Reading levels of Fountas and Pinnell. Numerical levels in parentheses align with DRA/EDL.

134135 despegando.myokapi.com

Visitouronlinestoreorfindyourrepat myokapi.com

ExploraMundos

ExploraMundos™ Fill the Knowledge Gap with Explicit Links to NGSS and C3 Standards

Program Overview

ExploraMundos™ is a high-interest informational literacy program that encourages inquiry and questioning while extending knowledge in science, social studies, and a range of STEM topics. Your students will excel as their knowledge of the world increases with compelling texts that build on essential concepts throughout the six stages of the program.

ExploraMundosTM features:

•Relatablecontenttoengagereaders andbuildrichbackgroundknowledge

•Seamlessflowbetweencontentandliteracy

•Graphicdevicesandstriking photographstosupportthecontent

•Researchopportunitieswith Inténtalo, Piénsalo, and ¿Lo sabías?

Studentswilldevelopstrategiesandskillsto readinformationaltextsacrossarangeoftext types,enhancedbywritingassignmentsthat reflectwhatthey’relearning!

ExploraMundos™ is highly versatile, teaching reading strategies at the same time as teaching science and social studies concepts. Lesson plan cards for each book establish a reading focus for the text with explicit links to the NGSS and C3 Standards. With any ExploraMundos™ text, students are learning standards-linked content as they learn to read.

Expand your students’ knowledge base with:

•Meaningful graphics, engaging photography, and wide-ranging text types

•Writing that reinforces content knowledge

•Titles covering a broad range of topics— field-tested with students just like them!

“While knowledge offers a foundation for understanding our world, it’s application of knowledge that transitions students from passive absorption to active inquiry and innovative thinking.”