Skip to main content

Srimad Bhagavatam 4/3

Page 1

His Divine Grace A.C. Bhaktivedanta Swami Prabhupada

Founder-Aciirya ofthe International Society for Krishna Consciousness

Plate 1 Ashamed of his activities, King lndra fell down to touch the lotus feet of P]ihu Maharaja. (p. 787) Plate 2 The King took the water which had washed the lotus feet of the Kumliras and sprinkled it over his hair. . 891

"Just see how this chaste lady, Arci, is still following her husband upwards, as far as we can see." (p. 1007)

Plate 3 Plate 4 Lord Siva addressed the Supreme Personality of Godhead with his prayer. (p. 1 063) Plate 5 The cowherd boys of Vrndavana treat Kr�I).a as their equal. (p. 1082)

The Lord is superexcellently beautiful on account of His open and merciful smile and His sidelong glance upon His devotees. (p. 1085

Plate 6

"My

thf

Plate 7
dear Lord, those who desire to purify their existence must always engage in
meditation of Your lotus feet."
. 1091

Srlmad-Bhagavatam

Srlmad-Bhagavatam of K�SNA-DVAIPAYANAVYASA

ql;( �(�qq{JS,�(t� wt(49;fil4f� �¥f�t I m �ft'iqf(ijijl\t.te 'f( !}it 'il�fg+xa�11( II��II

pada sarat-padma-palasa-roci§a nakha-dyubhir no 'ntar-agharh vidhunvata pradarsaya svzyam apasta-sadhvasarh padarh guro marga-gurus tamo-ju§am (p. 1 ,088)

ALL
TO SRl
GLORY
GURU AND GAURANGA

Bhagavad-gita As It Is

Srimad-Bhagavatam, Cantos 1-4 ( 11 Vols.)

Sri Caitanya-caritamrta (2 Vols.)

Teachings of Lord Caitanya

The Nectar of Devotion

Sri Tsopani�ad

Easy Journey to Other Planets

Kr�ra Consciousness: The Topmost Yoga System

Kr�ra. The Supreme Personality of Godhead (2 Vols.)

Transcendental Teachings of Prahlad Maharaja

Transcendental Teachings of Caitanya Mahaprabhu

Kg;ra, the Reservoir of Pleasure

The Perfection of Yoga

Beyond Birth and Death

On the Way to Kr�ra

Raja-vidya: The King of Knowledge

Elevation to Kr�ra Consciousness

Lord Caitanya in Five Features

Back to Godhead Magazine (Founder)

International Society for Krishna Consciousness

3959 Landmark Street

Culver City, California 90230

A complete catalogue is available upon request.

Srlmad-Bhagavatam

Fourth Canto

''The creation of the Fourth Order"

<Part Three -Chapters 20-24 >

With the Original Sanskrit Text, Its Roman Transliteration, Synonyms, Translation and Elaborate Purports by His Divine Grace

A.C. Bhaktivedanta swami Prabhupada

Founder-Acarya of the International Society for Krishna Consciousness

THE BHAKTIVEDANTA BOOK TRUST New York· Los Angeles· London· Bombay

Readers interested in the subject matter of this book are invited by the International Society for Krishna Consciousness to correspond with its Secretary.

International Society for Krishna Consciousness

3959 Landmark Street Culver City, California 90230

© 1974 the Bhaktivedanta Book Trust

All Rights Reserved

Library of Congress Catalogue Card Number: 75-189067

International Standard Book Number: 0-912776-48-X Printed by

Dai Nippon Printing Co., Ltd., Tokyo,
Japan
TABLE OF CONTENTS CHAPTER TWENTY Lord Vi��u·s Appearance in the sacrificial Arena ofMaharaja Prthu 765 Lord Vi�pu Appears on the Scene 765 The Intelligent Don't Become Addicted to the Body 769 The Devotee's Mind Becomes Broader and Transparent 774 Lord Vi�pu Instructs King }1thu 778 Lord Vi�!lu Pleased with J>rthu's Character 784 King·J>rthu Worships the Lord's Lotus Feet 788 Prayers Offered by Maharaja Prthu 792 Hearing from the Mouth of a Pure Devotee 797 Lakl'mi is the Mother of the Universe 802 Those Bound by the Sweet Words of the Vedas 805 J>rthu Maharaja Blessed by the Lord 809 The Lord Returns to His Abode 814 CHAPTER TWENTY-ONE Instructions bY Maharaja Prthu The King's City Beautifully Decorated All the Citizens Welcome the King The Demigods Follow in Prthu's Footsteps King J>rthu Initiates a Great Sacrifice Maharaja J>rthu's Beautiful Speech The Fate of an Impious King There Must Be a Supreme Authority vii 817 817 821 825 829 833 838 841
viii Abominable Persons Bewildered on the Path of Religion 848 A Devotee Manifests Renunciation 852 The Lord Accepts Different Types of Sacrifice 856 Vai�pavas Are More Powerful than Royalty 862 Regular Service to Briihmar;ws and Vai�TJavas 867 Offerings Accepted Through Mouths of Devotees 869 The Dust of the Lotus Feet of Vai�pavas 873 King frthu Congratulated by the Saintly Persons 877 CHAPTER TWENTY- TWO Prthu Maharaja's Meeting with the Four Kumaras 887 The Four Kumaras Arrive on the Spot 887 The King Worships the Four Kumaras 890 King frthu Speaks with Great Restraint 892 Four Kumaras Keep Themselves Like Small Children 899 Sanatkumara Begins to Speak 906 The Ultimate Goal of Life 910 Drinking the Nectar of the Glorification of the Lord 914 Devotees Should Lead a Simple Life 916 Increasing the Culture of Devotional Service 919 The Soul Subjected to Designations 924 The Strongest Obstruction to One's Self-interest 929 Liberation Has to Be Taken Very Seriously 932 Paramatma Is Eternally Transcendental 939 The Ocean of Nescience is Difficult to Cross 943 frthu Maharaja Offers Everything to the Kumaras 950 The Kumaras Praise the Character of the King 955 frthu Maharaja's Only Aim Is to Satisfy the Lord 957 Maharaja frthu Begets Five Sons 962
ix Maharaja Jlrthu Satisfies Everyone Prthu Maharaja's Reputation Loudly Declared CHAPTER TWENTY- THREE 967 971 Maharaja Prthu's Going Back Home 973 Maharaja Jlrthu Goes to the Forest 974 Severe Austerities Undergone by Prthu Maharaja 978 Maharaja Prthu Engages Completely in Devotional Service 984 Jlrthu Maharaja Gives Up His Material Body 990 Prthu Maharaja Is Released from All Designations 997 Queen Arci Follows the King into the Forest 999 Queen Arci Prepares a Funeral Pyre 1002 The Wives of the Demigods Glorify Queen Arci 1006 Queen Arci Reaches the Planet of Her Husband 1012 Benefits of Hearing the Narration of Maharaja Jlrthu 1016 Even a Pure Devotee Must Hear About Jlrthu Maharaja 1021 CHAPTER TWENTY-FOUR Chanting the song sung by Lord Siva 102s Vijitasva Becomes Emperor of the World 1025 The Three Sons of Maharaja Antardhana 1028 The Marriage of Maharaja Barhi�at 1034 The Sons of Pracinabarhi Meet Lord Siva 1039 Lord Siva is Accompanied by His Dangerous Energies 1042 The Great Lake Seen by the Pracetas 1046 Lord Siva Speaks to the Pracetas 1051 Devotees Are Very Dear to Lord Siva 1054 Prayer of Lord Siva 1063 Siva Prays to Lord Aniruddha 1068
X The Lord Expands His Transcendental Vibrations 1073 The Lord Is the Oldest and Supreme Enj oyer 1076 The Lord Is the Sum Total of All Beauty 1081 The Lord Has Shoulders Like a Lion 1086 The Beauty of the Lord's Lotus Feet 1089 Devotees Easily Attain the Lord 1093 Time Does Not Approach the Devotee 1095 The Lord is Spread All over the Universe 1101 The Universal Form Consists of Five Elements ll05 The Sc:rcalled Happiness of the Material Creation 1109 Time Scatters Everything 1112 Even Lord Brahma Worships the Lord 1ll6 The Yoga System of Chanting the Holy Name ll22 Achievement of Knowledge Is the Highest Perfection 1127 Value of Chanting the Prayers of Lord Siva 1129

CHAPTER TWENTY

LOrd Vi$fJU's Appearance in the sacrificial ArenaofMaharaja Prthu

TEXT I

maitreya uviica bhagaviin api vaikur-_tha� siikarh maghavatii vibhu� yajiiair yajiia-patis tu§.to yajiia-bhuk tam abhii§ata

maitreya� uviica-the great sageMaitreyacontinued to speak.;bhagavanthe Supreme Personality of Godhead, Vi$pu; api -also; vaikur-.tha[t-the Lord of Vaikuptha; siikam-along with; maghavata-King Indra; vibhu�the Lord; yajiiai[l.-by the sacrifices; yajiia-pat*- the Lord of all yajiias; tu§. taft- satisfied ; yajiia-bhuk - the enjoyer of the yajiia; tam-unto King Prthu; abhii§ata-said.

TRANSLATION

The great sage Maitreya continued: My dear Vidura, being very much satisfied by the performance of ninety-nine horse sacrifices, the Supreme Personality of Godhead, Lord Vi�r;tu, appeared onthescene. Accompanying Him was KingIndra. Lord Vi!;!r;tUthen began tospeak.

���
��:
�-- ijl{¥tl't<tII �II
¥ttlcUwtN
� � �: I �atf.qf�
�SC�il'ifn �'=W� �, t$¥tlq�tl 311�'11WI'lf!� �f«II�II 765
TEXT2 �ijl/"l/!ji!f/"1 �

Srimad-Bhagavatam

sri bhagaviin uviica

e.sa te 'kiir�id bhmigam

haya-medha-satasya ha k.samiipayata iitmiinam

amu.sya k�antum arhasi

sri bhagaviin uviica-the Supreme Personality of Godhead, Lord Vif2QU, spoke; e�a{t-this Lord Indra; te-your; akiir� it-performed; bha ngam-disturbance; haya-horse; medha-sacrifice; s"atasya-of the one-hundredth; ha-indeed; k�amiipayata{t-who is asking pardon; iitmiinam-unto yourself; amuna-him; kfiantum-to forgive; arhasi-you ought.

TRANSLATION

Lord Vi�Qu, the Supreme Personality of Godhead, said: My dear King PJ;"thu, lndra, the King of heaven, has disturbed your execution of one hundred sacrifices. Now he has come with Me to be forgiven by you. Therefore excuse him.

PURPORT

In this verse the word iitmiinam is very significant. It is a custom among yogis and jiiiinis to address one another (even an ordinary man) as one's self, for a transcendentalist never accepts a living being to be the body. Since the individual self is part and parcel of the Supreme Personality of Godhead, the self and the Superself are qualitatively nondifferent. As the next verse will explain, the body is only a superficial covering, and consequently an advanced transcendentalist will not make a distinction between one self and another.

TEXT3

�: m�it � WR� it{hi+U: I

;nf�(f�ttf{ '1100 t.�iH¥{ II � II

sudhiya{t siidhavo lake

naradeva narottamii{t niibhidmhyanti bhiitebhyo

yarhi niitmii kalevaram

su-dhiya{t-the most intelligent persons; siidhava{t-who are inclined to perform welfare activities; lake-in this world; nara-deva-0 King; narauttamii{t-the best of human beings; na abhidmhyanti-never become mali-

766
[Canto 4, Ch. 20

Text 4) Lord Vi�l}u's Appearance in the Sacrificial Arena 767

cious; bhutebhya[l,-toward other living beings; yarhi-because ; na-never; ii.tmii.-the self or soul; kalevaram-this body.

TRANSLATION

0 King, one who is advanced in intelligence and eager to perform welfare activities for others is considered best amongst human beings. An advanced human being is never malicious to others. Those with advanced intelligence are always conscious that this material body is different from the soul.

PURPORT

In daily life we find that when a madman commits murder, he is excused even by a high-court judge. The idea is that a living entity is always pure because he is part and parcel of the Supreme Personality of Godhead. When he falls into the clutches of material energy, he becomes a victim of the three modes of material nature. Indeed, whatever he does, he does under the influence of material nature. As stated in Bhagavad-gitii.:

na kartr tvarit na karmii.r-i lokasya srjati prabhu[l, na karma-phala-sarityogarit svabh ii.vas tu pravartate

"The embodied spirit, master of the city of his body, does not create activities, nor does he induce people to act, nor does he create the fruits of action. All this is enacted by the modes of material nature." (Bg. 5.14)

Actually the living entity or soul does not do anything; everything is done under the influence of the modes of material nature. When a man is diseased, the symptoms of the disease become a source of all kinds of pain. Those who are advanced in transcendental consciousness or Kr�J;la consciousness are never envious, neither of the soul nor of the activities of the soul under the influence of material nature. Advanced transcendentalists arecalled sudhiya[l,. Sudht meansintelligence, sudhimeanshighly advanced, and sudht means devotee.One who is both devoted and highly advanced in intelligence does not take action against the soul or the body. If there is any discrepancy, heforgives. It is said that forgiveness is a quality of those who are advancing in spiritual knowledge.

TEXT4 � � �� �mm �tt+tlttttl 1 � � qt GIRfl � mettn II'JII

puru.sii yadi muhyanti tviidrsii deva-miiyayii srama eva pararh jiito dirghayii vrddha-sevayii

puruflii�-persons; yadi-if;· muhyanti-become bewildered; tvii-drsii�Like you; deva-of the Supreme Lord; miiyayii-by the energy; srama�exertion;eva-certainly;param-only;jiita�- produced;dirghayii- fora long time; vrddha-sevayii-by serving the superiors.

TRANSLATION

If a personality like you, who are so much advanced because of executing the instructions of the previous acaryas, is carried away by the influence of My material energy, then all your advancement may be considered simply a waste of time.

PURPORT

In this verse the word vrddha-sevaya is very significant. Vrddha means "old." Sevayii means "by service." Perfect knowledge is acquired from the aciiryas or liberated souls. No one can be perfect in knowledge without being trained by the paramparii system. Prthu Maharaja was completely trained in that line; therefore he did not deserve to be considered an ordinary man. An ordinary man, who has only a conception of bodily existence, is always bewildered by the modes of material nature.

TEXTS

at((: mf'Pi �WlNtll"il't�Pt: I

3Tl� � ��Sfffl�SW{�t\' II '-\ II

ata� kiiyam imam vidviin

avidyii-kiima-karmabhi�

iirabdha iti naiviismin

pratibuddho 'nu.sajjate

ata�-therefore; kiiyam-body; imam-this; vidviin-he who has knowledge; avidyii-by nescience; kama-desires; karmabh*-and by activities; iirabdha�-created;iti-thus; na-never; eva-certainly; asmin-to this body; pratibuddha�-one who knows; anu.sajjate-becomes addicted.

768 Srimad-Bhagavatam
[Canto 4, Ch. 20

Those who are in full knowledge of the bodily conception of life, who know that this body is composed of nescience, desires and activities resulting from illusion, do not become addicted to the body.

PURPORT

As stated in a previous verse, those with good intellect (sudhiya�) do not accept themselves to be the body. Being a creation of nescience, the body has two types of activities. In the bodily conception, when we think that sense gratification will help us, we are in illusion. Another kind of illusion is to think that one will become happy by trying to satisfy the desires that arise from the illusory body, or by attaining elevation to the higher planetary systems, or by performing various types of Vedic rituals. This is all illusion. Similarly, material activities performed for political emancipation and social and humanitarian activities performed with an idea that people of the world will be happy are also illusory because the basic principle is the bodily conception, which is illusory. Whatever we desire or perform under the bodily conception is all illusion. In other words, Lord Vi�Qu informed Prthu Maharaja that although the sacrificial performances set an example for ordinary people, there was no need for such sacrificial performances as far as his personal self was concerned. As confirmed in Bhagavad-gitii:

traigurya-vi.fiayii veda

nistraiguryo bhaviirjuna

nirdvandvo nitya-sattva-stho

niryoga-k§ema iitmaviin

"The Vedas mainly deal with the subject of the three modes of material nature. Rise above these modes, 0 Arjuna. Be transcendental to all of them. Be free from all dualities and from all anxieties for gain and safety, and be established in the self." (Bg. 2.45)

The ritualistic performances recommended in the Vedas mainly depend on the three modes of material nature. Consequently Arjuna was advised to transcend the Vedic activities. The activities Arjuna was advised to perform were the transcendental activities of devotional service.

Text6] Lord Vi!IQU's Appearance in the Sacrificial Arena 769 TRANSLATION
TEXT6 314(1�6: msmqwt)�ql�� � I ���nfq ifi: itllfl\+Hti �: II � II

asamsakta{l. sarire 'sminn amunotpiidite grhe apatye dravir-e viipi ka{l. kuryiin mamatiirh budha[l.

asarhsakta[l.-being unattached; sarire-tothe body; asmin-this; amuniiby such a bodily conception; utpiidite-produced; grhe-house; apatyechildren; dravirte-wealth; vii-or; api-also; ka{l.-who; kuryiit-would do; mamatam-affinity; budhafl.-learned person.

TRANSLATION

How can a highly learned person who has absolutely no affinity for the bodily conception oflifebe affected bythebodilyconception in regard to house, children, wealth and similar other bodily productions?

PURPORT

The Vedic ritualistic ceremonies are certainly meant to please the Supreme Personality of Godhead, Lord Vi�Q.U. However, by such activities one does not factually satisfy the Lord. Rather, with the sanction of the Lord, one tries to satisfy his own senses. In other words, materialists who areespeciallyinterestedinsensegratificationare given permission or license to enjoy sense gratification by executing the Vedic ritualistic ceremonies. That is called traigu(lya-vifiayii vedii[l.. The Vedic performances are based on the three modes of material nature. Those who are elevated above the material condition are not at all interested in such Vedic performances. Rather, they are interested in the higher duties of transcendental loving service to the Supreme Personality of Godhead. Such devotional service is called nistraigu(lya. Devotional service to the Lord has nothing to do with the material conception of bodily comfort.

TEXT7

�: �: (q4iiti1RIMgansmgunw:r: 1

�m�:�M(I€+{1S�f{ls�: �: \9

eka{l. suddhafl. svayam-jyotir

nirgur-o 'sau gur-iisrayaft

sarva-go 'niivrtaft siik§i

niriitmiitmiitmanaft paraft

770 Srimad-Bhagavatam
[Canto 4, Ch_ 20

eka�-one; suddha�-pure; svayam-self; jyot* -effulgent; nirgu[l�without material qualifications; asau-that; gu[la-iisraya�-the reservoir of good qualities; sarva-ga[t-able to go everywhere; antivrta[l-without being covered by matter; siik.si-witness; niriitmii-without another self; iitmaiitmana[l-to the body and mind; para[l-transcendental.

TRANSLATION

The individual soul is one, pure, nonmaterial and self-effulgent. He is the reservoir of all good qualities, and He is all-pervading. He is without material covering, and He is the witness of all activities. He is completely distinguished from other living entities, and He is transcendental to all embodied souls.

PURPORT

In the previous verse two significant words are used: asamsakta[l, meaning "without attachment," and budha[l, meaning "fully cognizant of everything." By full cognizance it is meant that one should know about his own constitutional position as well as the position of the Supreme Personality of Godhead. According to Sri ViSvanatha Cakravarti Thakura, in this verse Lord Vi9Qu is describing Himself or the Paramatma. The Paramatma is always distinguished from the embodied soul as well as the material world. Therefore He has been described as para. That para, or Supreme Personality of Godhead, is eka, meaning one. The Lord is one, whereas the conditioned souls embodied within the material world exist in many varieties of form. There are demigods, human beings, animals, trees, birds, bees, and so forth. Thus the living entities are not eka but many. As confirmed in the Vedas: nityo nityiiniim cetanas cetaniiniim. The living entities, who are many and who are entangled in this material world, are not pure. However, the Supreme Personality of Godhead is pure and detached. Due to beingcovered by the material body, the living entities are not self-effulgent, but the Supreme Personality of Godhead, Paramatma, is self-effulgent. The living entities, being contaminated by the modes of material nature, are called saguQ.a, whereas Paramatmii, the Supreme Per� sonality of Godhead, is nirguQ.a, not being under the influence of the material modes. The living entities, being encaged in material qualities, are guT}iisrita, whereas the Supreme Personality of Godhead is guT}iisraya. The conditioned soul's vision is covered by material contamination; therefore he cannot see the cause of his resultant action and he cannot see his past lives.The Supreme Personality of Godhead,not being covered by a material body, is the witness of all the activities of the living entity. But both of

Text 7] Lord Vi�QU's Appearance in the Sacrificial Arena 771

them, the living entity and the Paramatma, the Supreme Personality of Godhead,are iitma, or spirit.They are one in quality, yet they are different in so many ways, especially in regard to the six opulences the Supreme Personality of Godheadhasinfull. Full knowledge means that the jiva-iitma, the living entity, must know both his position and the Supreme's position. That is full knowledge.

TEXTS

� � ij"ft+tl�+tl�+iR�� � �'f: I

ya evarh santam iitmiinam iitma-stharh veda puru,sa{l niijyate prakrti-stho 'pi tad-gu[lai{l sa mayi sthita{l

11�11

ya{l-anyone who; evam-thus; san tam- existing; atmanam-the individual atma and the Supreme Personality of Godhead, Paramatma; atmastham-situated within his body; veda-knows; pu ru . sa[t-person; na-never; ajyate-is affected; prakrti-in material nature; stha{l-situated ; api- although; tat-gu[lai{l-by the material modes of nature; sa{l-such a person; mayi-in Me; sthitaft-situated.

TRANSLATION

Although within the material nature, one who is thus situated in full knowledge of the Paramatma and atma is never affected by the modes of material nature, for he is always situated in My transcendental loving service.

PURPORT

Whenthe Supreme Personality of Godhead appears in this materialworld, Heis not affected by the modes of material nature. Similarly,those who are always connected with the Supreme Personality of Godhead, even though they be within the material body or the material world, are not affected by the material qualities. That is explained very nicely in Bhagavad-gita:

mam ca yo 'vyabhicare7J-a bhakti-yogena sevate sa gul).iin samatityaitan brahma-bhilyiiya kalpate

772 Srimad-Bhagavatam [Canto 4, Ch. 20
--�3fif�sfq��:«�ft4ij:

·'Onewho engages in full devotional service, who does not fall down in any circumstance, at once transcends the modes of material nature and thus comes to the level of Brahman." (Bg. 14.26)

Thus one who is unflinchingly engaged in the devotional service of the Lord surpasses the material qualities and attains Brahman realization. In this connection Srila Rupa Gosvaml says that if a person is always engaged in the service of the Lord with his body, words and mind, he is to be considered liberated, although living in the material world.

TEXT9

�:��f.l�f.tmft:�;a4t1Rij: I

� �"'fi'(ij� ij;ft mf"t sm'T�fu II � II

ya�. sva-dharmer-a miirh nityarh niriiSi[l. sraddhayiinvita[l. bhajate sanakais tasya mano riijan prasidati

ya[l.-anyone who; sva-dharmer-a-by his occupational duties; miim-Me; nityam-regularly; n iriisi[l.-without any motive; sraddhayii-with faith and devotion; anvita[l.-endowed; bhajate-worships ; sanakai[l.-gradually; tasyahis; mana[!.-mind; riijan-0 King Prthu; prasidati-becomes fully satisfied.

TRANSLATION

The Supreme Personality of Godhead, Lord Vi�Qu, continued: My dear King Prthu, when one situated in his occupational duty engages in My loving service without motive for material gain, he gradually becomes very satisfied within.

PURPORT

This verse is also confirmed by the VifirtU Puriir-a. Occupational duties are known as varr-asrama-dharma and apply to the four divisions of material and spiritual life-namely, briihmar-a, k§atriya, vaiSya and sudra, and brahmacarya, grhastha, viinaprastha and sannyiisa. If one works according to the varr-iisrama-dharma system and does not desire fruitive results, he gets satisfaction gradually. Discharging one's occupational duty as a means of rendering devotional service unto the Supreme Personality of Godhead is the ultimate goal of life. Bhagavad-gitii confirms this as the process of karma-yoga. In other words, we should act only for the satisfaction and

773
Text9] Lord Vi�Qu's Appearance in the Sacrificial Arena

serviceofthe Lord. Otherwisewe will be entangled by the resultant actions. Everyoneissituatedinhis occupationalduty,but the purpose ofmaterial occupations should not be for material gain. Rather, everyone should offer the results of his occupationalactivities. A briihmar-a especially should executehisoccupationaldutiesnotformaterial gain but to please the Supreme Personality of Godhead. The k§atriya, vaisya and sudra should work in a similar way. In this material world everyone is engaged in various professional and occupational duties,but the purpose of such activities should be to please the Supreme Personality of Godhead. Devotional service is very simple, and anyone can adopt it. Let one remain what he is; he need orily install the Deity of the Supreme Lord in his house. The Deity may be Radha-K.r��::ta or Lak�mi-NarayaJ::ta (there are many other forms of the Lord). In this way a briihmar-a, k§atriya, vaisya or sudra can worship the Deity with the results of his honest labor. Regardless of one's occupational duty, one should adopt the devotional means of hearing, chanting, remembering, worshiping, offering everything to the Lord, and engaging in His service. In this way one can very easily engage himself in the service of the Lord. When the Lord is pleased with one's service, one's mission in life is fulfilled.

TEXT 10

qf(��'ffigui: (144tJ��;ir Ff���t�: I

�;d it e+N�if iR1 ����II� oil

parityakta-gur-a� samyag darsano visadiisaya� siintirh me samavasthiinarh brahma kaivalyam asnute

parityakta-gur-a�-one who is disassociated from the material modes of nature; samyak-equal; darsana�-whose vision; visada-uncontaminated; iisaya�-whose mind or heart; siintim-peace ; me-My; samavasthiinamequal situation; brahma-spirit; kaivalyam-freedom from material contamination;asnute-achieves.

TRANSLATION

When the heart is cleansed of all material contamination, the devotee's mind becomes broader and transparent, and he can see things equally. At that stage of life there is peace, and one is situated equally with Me as sac-cid-ananda-vigraha.

774 Srimad-Bhagavatam [Canto 4, Ch. 20

The Mayavada conception of kaivalya and that of the Vai�Qava community is different. The Mayavadi thinks that as soon as one is free from all material contamination, he is merged into the existence of the Supreme. The Vai�Qava philosopher's conception of kaivalya is different. He understands both his position and the position of the Supreme Personality of Godhead. In the uncontaminated condition, the living entity understands that he is the eternal servitor of the Supreme, and that is called Brahman realization, the spiritual perfection of the living entity. This rapport is very easily achieved. As stated in Bhagavad-gitii, when one is engaged in the transcendental loving service of the Lord, he is immediately situated on the transcendental platform of kaivalya or Brahman.

TEXT ll

udiisTnam ivadh yak�am dravya-jiiana-kriyiitmaniim kutastham imam iitmiinam yo vediipnoti sobhanam

udiisinam-indifferent; iva-simply; adhyak§am-the superintendent; dravya-of the physical elements; jiiiina-knowledge-acquiring senses; kriyii-working senses; iitmaniim-and of the mind; kuta-s tham-fixed; imam-this; iitmiinam-soul; ya[t-anyone who; veda-knows; iipnot i- gets; sobhanam-all good fortune.

TRANSLATION

Anyone who knows that this material body made of the five gross elements, the sense organs, the working senses and the mind is simply supervised by the fixed soul is eligible to be liberated from material bondage.

PURPORT

Thisverse describeshowonecan becomeliberated from material bondage. The first point is that one must know that the soul is different from his body. The soul is called dehT, or one who possesses the body, and the

Text ll] Lord Vi�Qu's Appearance in the Sacrificial Arena 775
PURPORT
��Cf�
lolt��ltmt;ni{_ I �l{'i+tl�l{l;j� ��1si1Rf �II��II

material body is called deha, or the embodiment of the souL The body is changing at every moment,but the soul is fixed;therefore the soul is called kiitastham. The change of body is enacted by the reactions of the three modes of nature. One who has understood the fixed position of the soul should not be disturbed by the incoming and outgoing interactions of the modes of material nature in the form of happiness and distress. In Bhagavad-g"itii also Lord Kr�Q.a recommends that since happiness and distress come and go due to the interaction of the modes of nature on the body, one should not be disturbed by such external movements. Even though one is sometimes absorbed in such external movements, he has to learn to tolerate them. The living entityshould be always indifferent to the action and reaction of the external body.

Lord Kr�Q.a says inBhagavad-g"itii that the body made of the gross physicalelements (earth,water, fire, air and sky) and the subtle elements (mind, intelligence and ego) is completely different from the soul proper. One should therefore not be disturbed by the action and reaction of these eight gross and subtle material elements. The practical process to attain this stage of indifference is to execute devotional service. Only one who constantly engages in devotional service twenty-four hours a day can be indifferent to the action and reaction of the external body. When a man is absorbed in a particular thought, he does not hear or see any external activities, even though they are enacted in his presence. Similarly, those who are fully absorbed in devotional service do not care what is going on with the external body. That status is called samadhi. One who is actually situated in samadhi is understood to be a first-class yogi. TEXT

bhinnasya lingasya gu[ta-praviiho

dravya-kriyii-kiiraka-cetanatmanafl

dr�tiisu sampatsu vipatsu siirayo na vikriyante mayi baddha-sauhrdiifl

776 Srimad-Bhagavatam [Canto 4, Ch. 20
12 � � gur�it R�€fii(Ch�<t;n�: ����� ;r fqf�q--�m-� if'(tii«a: 11��11

bhinnasya-different; lingasya-of the body; gur-a-of the three modes of material nature; praviiha[l.-the constant change; dravya-physical elements; kriyii-activities of the senses; kiiraka-demigods; cetanii-and the mind; atmana[l.-consisting of; dr§. tiisu-when experienced; sampatsuhappiness; vipatsu- distress; siiraya[l.-those who are advanced in knowledge; na-never; vikriyante-become disturbed; mayi-unto Me; baddhasauhrdii[l.-bound in friendship.

TRANSLATION

Lord Vi�I].U told King Prthu: My dear King, the constant change of this material world is due to the interaction of the three modes of material nature. The five elements, the senses, the demigods who control the senses, as well as the mind, which is agitated by spirit soul-all these taken together comprise the body. Since the spirit soul is completely different from this combination of gross and subtle material elements, My devotee who is connected with Me in intense friendship and affection, being completely in knowledge, is never agitated by material happiness and distress.

PURPOR T

The question may be raised that if the living entity has to act as the superintendent of the activities of the bodily combination, then how can he be indifferent to the activities of the body? The answer is given here: these activities are completely different from the activities of the spirit soul of the living entity. A crude example can be given in this connection. A businessman riding in a motorcar sits in the car, supervises its running, and advises the driver. He knows how much gasoline is used up, and he knows everything about the car, but still he is apart from the car and is more concerned with his business. Even while riding in the car, he thinks of his business and his office. He has no connection with the car, although he is sitting there. As the businessman is always absorbed in thoughts of his business, so the living entity can be.. absorbed in thoughts of rendering loving service to the Lord.Then it will be · possible to remain separate from the activities of the material body: This .position of neutrality can only be possible for a devotee.

The word baddha-sauhrdii[l.- "bound in friendship"-is particularly used here. Karmis, jniin'is and yogis cannot be bound in devotional service. Karm'is fully engage in the activities of the body. Their aim of life is to give comfort to the body only. ]niinis try to get out of entanglement by

Text 12] Lord Vi�I].u's Appearance in the Sacrificial Arena 777

philosophical speculation, but they have no standing in the liberated position.Because theydo not takeshelter under the lotusfeet of the Lord, they fall down from the exalted position of Brahman realization. YogTs also have a bodily concept of life-they think that they can achieve something spiritual by exercising the body through dhiirar.tii, iisana, priirtiiyiima, etc. A devotee's position is always transcendental because of his intimate relationship with the Supreme Personality of Godhead. Therefore, to remain always aloof from the actions and reactions of the body and engage in one's real occupation, namely, rendering service to the Lord, canonly be possiblefor devotees.

TEXT 13

samal) samiinottama-madhyamiidhamal) sukhe ca du/;lkhe ca jitendriyiisayal) mayopaklpfiikhila-loka-samyuto vidhatsva vTriikhila-loka-rak�artam

sama[l-equipoised; samana-all equal; uttama-one who is greater; madhyama- one who is in an intermediate position; adhama[l-one who is in alowerstandardoflife;sukhe-inhappiness;ca- and;du[lkhe-indistress; ca-also; jita-indriya-having controlled the senses; asaya[l- and mind; maya-by Me; upak[pta-arranged;akhila- all; loka- by people;samyuta[lbeing accompanied; vidhatsva-give; vira-0 hero; akhila-all; loka-to the citizens; rak;Sacwm-protection.

TRANSLATION

My dear heroic King, please keep yourself always equipoised and treat people equally, whether they are greater than you, in the intermediate stage or lower than you. Do not be disturbed by temporary distress or happiness. Fully control your mind and senses. In this transcendental position, try to execute your duty as king in whatever condition of life

778 Srimad-Bhagavatam [Canto 4, Ch. 20
�: �141tiht�q\.lp{l�: ���:��f���: I �qfta•��M1sJt � iffi�ll��ll

you may be posted by My arrangement, for your only duty here is to give protection to the citizens of your kingdom.

PURPORT

Here is an example of receiving direct instruction from the Supreme Personality of Godhead, Lord Vil;il).U. One has to execute the order of Lord Vi�Q.u, whether receiving it directly from Him or from His bona fide representative, the spiritual master. Arjuna fought the Battle of Kuruk�etra under the direct order of the Supreme Personality of Godhead, l<.rl;iQ.a. Similarly, here J>rthu Maharaja is also being given orders by Lord Vi��;tu regarding the execution of his duty. We have to stick to the principles stated in the Bhagavad-gita. Vyavasayatmika buddhi�: every man's duty is to receive orders from Lord Kr�Q.a or from His bona fide representative and take these orders as his life and soul, without personal considerations. Srila Visvanatha Cakravarti Thakura states that one should not care very much whether he is going to be liberated or not, but he should simply execute the direct order received from the spiritual master. If one sticks to the principle of abiding by the order of the spiritual master, he will always remain in a liberated position. A common man must execute the rules and regulations of varr;tiisrama-dharma by working in his prescribed duty according to the caste system (briihmar;ta, k�atriya, vaisya and sudra) and the spiritual order system (brahmacarya, grhastha, vanaprastha and sannyiisa). If one simply executes regularly and strictly the injunctions given for the different divisions of life, then one satisfies Lord Vi�J).U.

As a king, Prthu Maharaja was ordered by Lord Vi��;tu to keep himself always aloof from the activities of the bodily situation and to engage always in the service of the Lord and thus keep himself in the liberated stage. The word baddha-sauh,rdiift in the previous verse is explained herewith. One can fully remain in intimate connection with the Supreme Lord directly or receive orders from His bona fide representative the spiritual master and execute the orders sincerely when one keeps aloof from the activities of the body. The Lord helps us by giving us directions how to act in devotional service and thus advance on the path back home, back to Godhead. He instructs us outwardly in the form of the spiritual master. Therefore, one should not accept the spiritualmaster as an ordinary human being. The Lord says, iiciiryarh marh vijaniyan navamanyeta karhicit: one should not treat the spiritual master as an ordinary human being because

Text 13] Lord Vi�Qu's Appearance in the Sacrificial Arena 779

he is the substitute for the Supreme Personality of Godhead.(Bhag.ll.l7.27) One should treat the spiritual master as the Supreme Personality of Godhead and never be envious of him or consider him to be an ordinary human being. If we follow the instruction of the spiritual master and execute devotional service to the Lord, we will remain always free from the contamination of bodily or material activities, and our life will be successful.

TEXT 14

�: ��iter oo

q�(11PHI�ij�� 't84!d't I C(fi;q'-11 ��: 31���T cmlits�ll�'<lll

sreya� prajii-piilanam eva riijno yat siimpariiye sukrtiit �a�,tham arhsam hartiinyathii hrta-puflya� prajiiniim arak�itii karahiiro 'gham atti

sreya�-auspicious; prajii-piilanam-ruling over the general mass of people; eva- certainly; riijiia[l.-for the king; yat-because; siimpariiye-in the next birth; su-krtiit-from the pious activities; §a§{ham arhsam-onesixth part; hartii- collector; anyathii- otherwise; hrta-pur-ya[l.- being bereft of the results of pious activities; prajiiniim-of the citizens; arak�itii-one who does not protect; kara-hiira[l.-tax collector; agham-sin; atti- receives or suffers.

TRANSLATION

To give protection to the general mass of people who are citizens of the state is the prescribed occupational duty for a king. By acting in that way, the king in his next life shares one sixth of the result of the pious activities of the citizens. But a king or executive head of state who simply collects taxes from the citizens hut does not give them proper protection as human beings has the results of his own pious activities taken away by the citizens, and in exchange for his not giving protection he becomes liable to punishment for the impious activities of his subjects.

PURPORT

The question may be raised here that if everyone engaged in spiritual activities to attain salvation and became indifferent to the activities of the

780 Srimad-Bhagavatam [Canto 4, Ch. 20

material world, then how could things as they are go on? And if things are to go on as they ought to, how can a head of state be indifferent to such activities? In answer to this question the word sreya�, "auspicious," is used here. The division of activities in society as arranged by the Supreme Personality of Godhead was not blindly or accidently created, as foolish people say. The briihmarta must do his duty properly, and the k�atriya, the vaisya and even the sudra must do the same. And every one of them can achieve the highest perfection of life-liberation from this material bondage. This is confirmed in Bhagavad-gitii. Sve sve karmarty abhirata� sarhsiddhirh labhate nara�: "By executing one's prescribed duties, one can attain the highest perfection." (Bg. 18.45)

Lord Vi�Q.U advised Maharaja Prthu that a king is not enjoined to give up his kingdom and the responsibility of protecting the prajiis or citizens to instead go away to the Himalayas for liberation. He can attain liberation while executing his royal duties. The royal duty or the duty of the head of state is to see that the prajiis or the general mass of people are doing their respective duties for spiritual salvation. A secular state does not necessitate a king or head of state who is indifferent to the activities of the prajiis. In the modern state the government has many rules and regulations for conducting the duties of the prajiis, but the government neglects to see that the citizens advance in spiritual knowledge. If the government is careless in this matter, the citizens will act whimsically, without any sense of God realization or spiritual life, and thus become entangled in sinful activities.

An executive head should not be callous to the welfare of the general mass of people while he simply goes on collecting taxes. The king's real duty is to see that the citizens gradually become fully Kr9f.la conscious. Kr9f.la conscious means completely free from all sinful activities. As soon as there is complete eradication of sinful activities in the state, then there will be no more war, pestilence, famine or natural disturbances. This was actually prevailing during the reign of Mahiuaja Yudhi9�hira. If a king or head ofthe government is able to induce the citizensto become Kr9f.la conscious, then he is worthy to rule over the mass of people; otherwise, he has no right to levy taxes. If the king looks after the spiritual interests of the citizens, he can levy taxes without difficulties. In this way both the subjects and the king will be happy during this life, and in the next life the king will be able to share one sixth of the pious activities of the citizens. Otherwise, by levying taxes on the sinful citizens he will have to share the reactions of their sinful activities.

This same principle can be applied to parents and the spiritual masters as well. If parents simply give birth to children like cats and dogs but cannot

Text 14) Lord Vi�r.m's Appearance in the Sacrificial Arena 781

save their children from imminent death, they become responsible for the activities of their animalistic children. Lately, such children are turning into hippies. Similarly, if a spiritual master cannot direct his disciples to become free of sinful activities, he becomes responsible for their sinful acts. These subtle laws of nature are unknown to the present leaders of society. Since the leaders of society have a poor fund of knowledge and the citizens in general are rogues and thieves, there cannot be an auspicious situation for human society. At the present moment the whole world is full of such an incompatible combination of state and citizens, and therefore there is constant tension, war and anxiety as an inevitable result of such social conditions.

TEXT 15

II Z �II

evarh dvijiigryiinumatiinuvrttadharma-pradhiino 'nyatamo 'vitiisyii�

hrasvena kiilena grhopayiitiin dra§tiisi siddhiin anurakta-loka�

evam-thus;dvija-of the briihmar;ws; agrya-by the foremost; anumataapproved; anuvrtta-received by disciplic succession; dharma-religious principles; pradhiinafi.-he whose chief interest is; anyatamaft-unattached; avita-the protector; asyii[t-of the earth;hrasvena-short;kiilena-in time; grha-to your home; upayiitiin-having come personally; dra§tiisi-you will see; siddhiin- perfected personalities; anurakta-loka[t-being loved by the citizens.

TRANS LATION

Lord Vi��u continued: My dear King P]-thu, if you continue to protect the citizens according to the instructions of the learned brahmap.a authorities, as they are received by the disciplic succession-by hearing-from master to disciple, and if you follow the religious principles laid down by them, without attachment to ideas manufactured by mental concoction, then every one of your citizens will be happy and will love you, and very soon you will be able to see such already liberated personalities as the four Kumaras [ Sanaka, Sanlitana, Sananda and Sanat-kumlira].

782 Srimad-Bhagavatam [Canto 4, Ch. 20
il!i{l4�1ijfl fuittta<"ffi�l�:

Lord Vi��u advised King Prthu that everyone should follow the principles of varruisrama-dharma; then, in whatever capacity one remains within this materialworld,his salvation is guaranteed after death. In this age, however, since the system of varrtiisrama-dharma is topsy-turvy, it is very difficult to strictly follow all the principles. The only method for becoming perfect in life is to develop Kr��a consciousness. As varrtiisrama-dharma is executed fromdifferent positionsbydifferent men, so the Kr�r:Ia consciousness principles can be followed by everyone in every part of the world.

There is a specific purpose in mentioning herein that one should follow the dvijiigryas, the most prominent briihmartas like Parasara and Manu. These great sages have already given us instructions how to live according to the principles of varrtiisrama-dharma. Similarly, Saniitana Gosviimi and Rupa Gosviimi have given us rules and regulations for becoming pure devotees of the Lord. It is essential, therefore, to follow the instructions of the iiciiryas in the paramparii system who have received the knowledge as passed down from spiritual master to disciple. In this way, although living in our material condition of life, we can get out of the entanglement of material contamination without leaving our positions. Lord Caitanya Mahiiprabhu advises, therefore, that one does not have to change his position. One simply has to hear from the perfect source (this is called paramparii) and follow the principles for practical application in life; thus one can attain the highest perfection of life, liberation, and go back home, back to Godhead. In other words, the change required is a change in consciousness, not in the body. Unfortunately, in this fallen age, people are concerned with the body, not with the soul. They have invented so many "isms" pertaining to the body only, not to the soul.

In the modern age of democracy there are so many government representatives voting for legislation. Every day they bring out a new law. But because these laws are only mental concoctions manufactured by inexperienced conditioned souls, they cannot give relief to human society. Formerly, although the kings were autocrats, they strictly followed the principles laid down by great sages and saintly persons. There were no mistakes in ruling over the country, and everything went perfectly. The citizenswere completely pious, the king levied taxes legitimately, and therefore the situation was very happy. At the present moment the so-called executive heads are more or less selected from materially ambitious persons who simply look after their own personal interests; they have no knowledge of the siistras. In other words, the executive heads are fools and rascals in the strict sense of the terms, and the people in general are siidras. This combi-

Text 15] Lord Vi�I].u ' s Appearance in the Sacrificial Arena 783
PURPORT

nation of fools and rascals and siidras cannot bringabout peace and prosperity in thisworld. Therefore we find periodic upheavals in societyin the forms of battles, communal riots and fratricidal quarrels. Under these circumstances, not only are the leaders unable tolead the people towards liberation, but they cannot even give them peace of mind. In Bhagavadgftii it is stated that anyone who lives on concocted ideas, without reference tothe siistras, never becomes successful anddoesnot attainhappiness or liberationafter death.

TEXT 16

varam ca mat kancana miinavendra vrrt"i�va te 'ham gur-a-sila-yantrita� niiham makhair vai sulabhas tapobhir yogena vii yat sama-citta-vart"i

varam-benediction; ca-also; mat-from Me; kancana-whatever you like; miinava-indra-0 chief of human beings; vrr-�sva-please request; teyour; aham-I; gu[la-sila-by elevated qualities and excellent behavior; yantrita�-being captivated; na-not; aham-1; makha*-by sacrifices;vaicertainly; su-labhaft-easily obtained; tapobhil].-by austerities; yogenaby practice of mystic yoga; va-or; yat-because of which; sama-citta-in one who isequipoised;varti-beingsituated.

TRANSLATION

My dear King, I am very captivated by your elevated qualities and excellent behavior, and thus I am very favorably inclined towards you. You may therefore ask from Me any benediction you like. One who does not possess elevated qualities and behavior cannot possibly achieve My favor simply by performance of sacrifices, severe austerities, or mystic yoga. I always remain equipoised in the heart of one who is also equipoised in all circumstances.

784 Srimad-Bhagavatam [Canto 4, Ch. 20
cri � �� ��Wf ��11��s:: � �st 1 wtrt "� ij�� en ��·�=r�tfldl II ��II

PURPORT

Lord Vigm was very pleased with Maharaja Prthu's good character and behavior and offered him a benediction. The Lord openly says that performing great sacrifices or undergoing the austerities of mystic yoga practice cannot satisfy Him. He is only pleased by elevated character and behavior. But these cannot develop unless one becomes a pure devotee ofthe Lord. Anyone who has developed unalloyed, unflinching devotional service unto the Lord develops his original good qualities as spirit soul. The spirit soul, as part and parcel of the Supreme Personality of Godhead, has all the good qualities of the Lord. When the spirit soul is contaminated by the material modes of nature, one is considered good or bad with reference to the material qualities. But when one is transcendental to all material qualities, all the good qualities come out. These qualities of a devotee, twenty-six in number, are listed as follows: (1) kind to everyone, (2) does not quarrelwith anyone,(3) fixed inthe AbsoluteTruth,(4) equal to everyone, (5) faultless, (6) charitable, (7) mild, (8) clean, (9) simple, (10) benevolent, (ll) peaceful, (12) completely attached to Kr�va, (13) has no material hankering, (14) meek, (15) steady, (16) self-controlled, (17) does not eat more than required, (18) sane, (19) respectful, (20) humble, (21) grave, (22) compassionate, (23) friendly, (24) poetic, (25) expert, (26) silent. The Lord is satisfied by development of the transcendental qualities of the living entity and not by artificial performance of sacrifices and mystic yoga. In other words, unless one is fully qualified to become a pure devotee of the Lord one cannot expect to be liberated from material entanglement.

Text
Lord Vi�r;tu's Appearance in
Sacrificial
785
17)
the
Arena
TEXT 17 iN� i3<1T"f � ���anfcr�� fer�� 1 ' �6(1' 31� fm:m � �: 11 �\911 maitreya uviica sa ittham loka-guru[tii vi§vaksenena visva-jit anusiisita iiddam sirasii jagrhe hare{!.

maitreya� uvaca-Maitreya said; sa�-he; ittham-thus; loka-guru[ta- by the supreme master of all people; visvak-senena-by the Personality of Godhead; visva-jit-the conqueror of the world (Maharaja Prthu ); anusasita[l. -being ordered;adesam-instructions; sirasa-on the head;jagrhe- accepted; hare[!.-of the Personality of Godhead.

TRANSLATION

The great saint Maitreya continued: My dear Vidura, in this way Maharaja ptthu, the conqueror of the entire world, accepted the instructions of the Supreme Personality of Godhead on his head.

PURPORT

One should accept the instructions of the Supreme Personality of Godhead by bowing down at the lotus feet of the Lord. This means that anything spoken by the Personality of Godhead should be taken as it is, with great care and attention and with great respect. It is not our business to amend the words of the Supreme Personality of Godhead or make additions or alterations, as it has become a custom for many so-called scholars and svamis who comment on the words of Bhagavad-gita. Here the practical example of how to accept the instruction of the Supreme Personality of Godhead is shown by Prthu Maharaja.This is the way to receive knowledge through the paramparii system.

sprsantam piidayo[l. premrtii

vr"i{litam svena karma{lii sata-kratum pari�vajya

vidve�am visasarja ha

sprsantam-touching ; padayo�-the feet; premra-in ecstasy; vri{litamashamed; svena-his own; karma[la-by activities; sata-kratum-King Indra; pari_svajya- embracing; vidve§am-envy;visasarja-gave up; ha-of course.

786 Srimad-Bhagavatam [Canto 4, Ch. 20
TEXT 18 ��:��"����I fiifi� qf\��q fqi:; ffi:m� � II Z <.:II

As King Indra was standing by, he became ashamed of his own activities and fell down before King Prthu to touch his lotus feet. But Prthu Maharaja immediately embraced him in great ecstasy and gave up all his envy against him because of his stealing the horse meant for the sacrifice.

PURPORT

There are many cases in which a person becomes an offender to the lotus feet of a Vai�l}ava and later becomes repentant. Here also we find that although the King of heaven, lndra, is so powerful that he accompanied Lord Vi�J;lu, he felt himself a great offender for stealing Prthu Maharaja's horse that was meant for sacrifice. An offender at the lotus feet of a Vai�l}ava is never excused by the Supreme Personality of Godhead. There are many instances illustrating this fact. Ambari�a Maharaja was offended by Durvasa Muni, a great sage and mystic yogi, and Durvasa also had to fall down at the lotus feet of Ambari�a Maharaja. Indra decided to fall down at the lotus feet of King Prthu, but the King was so magnanimous a Vai�l}ava that he did not want Maharaja lndra to fall down at his feet. He immediately picked him up and embraced him, and both of them forgot all the past incidents. Both King lndra and Maharaja Prthu were envious and angry with each other, but since both of them were Vai�Q.avas, or servants of Lord Vi�Q.U, it was their duty to adjust the cause of their envy. This is also a first-class example of cooperative behavior between Vai�Q.avas. In the present days, however, because people are not Vai�Q.avas, they fight perpetuallyamong one another and are vanquished without finishing the mission of human life. There is a great need to propagate the K{�J;la consciousness movement in the world so that even though sometimes people become angry and malicious towards one another, because of their being Kr�Q.a conscious such rivalry, competition and envy could be adjusted without difficulty. TEXT

Text 19] Lord Vi�I]u's Appearance in the Sacrificial Arena 787
TRANSLATION
19 '�·'�';cq w� ��: 1 ('IQNf6VI�I itef� �'Tt(OII'ilil! II��It bhagaviinathavisviitmii prthunopahrtiirha!lafl

bhagaviin-the Supreme Personality of Godhead; atha-thereupon; visva-iitma-the Supersoul; prthunii-by KingPrthu; upahrta-beingoffered; arhar-a�-all the paraphernalia for worship; sam ujjihanayii- gradually increased; bhaktya- whose devotional service; grhita- taken; cara[la-ambuja� -His lotus feet_

TRANSLATION

King }\thu abundantly worshiped the lotus feet of the Supreme Personality of Godhead, who was so merciful to him. While worshiping the lotus feet of the Lord, }\thu Maharaja gradually increased his ecstasy in devotional service.

PURPORT

When various ecstasies appearin the body ofa devotee, it is to be understood that his devotional service has become perfect. There are many types of transcendental ecstasies in the forms of crying, laughing, perspiring,falling down, and crying like a madman. Allthese symptoms are sometimes visible on the body of a devotee. They are called afi.ta-siittvika-vikara, which means eight kinds of transt::endental transformations. They are never to be imitated, but when a devotee actually becomes perfect, these symptoms arevisible on his body. The Lord is bhakta-vatsala. which means that He is inclined towards His pure devotee (bhakta). Therefore the transcendental ecstatic transaction between the Supreme Lord and His devotee is never like the activities of this material world.

TEXT 20

prasthiiniibhimukho 'py enam anugraha-vilambita[l, pasyan padma-paliis"iik§o na pratasthe suhrt satiim

prasthtina-to leave; abhimukha[l-ready; api-although; enam-him (Prthu); anugraha-by kindness; vilambita[l-detained; pasyan-seeing;

788 Srimad-Bhagavatam samujjihiinayii bhaktya grhita-cara[l"iimbuja� [Canto 4, Ch. 20
st(tl1Wfllil�sc4W�l{�!Rf'�f�: qw-r_ qqq�������� �'(1{ II �oil

padma-paliisa-ak.sa[l-the Lord, whose eyes are like the petals of a lotus flower; na-not; pratasthe-departed; suhrt- the well-wisher; satiim-of the devotees.

TRANSLATION

The Lord was just about to leave, but because He was so greatly inclined towards the behavior of King Prthu, He did not depart. Seeing the behavior of Maharaja frthu with His lotus eyes, He was detained because He is always the well-wisher of His devotees.

PURPORT

Herethe words suhrt satiim are very significant. The Supreme Personality of Godhead is always very inclined towards His devotee and is always thinking of his well-being. This is not partiality. As stated in Bhagavad-gitii, the Lord is equal to everyone (samo 'ham sarva-bhuteflU ) , but to one who particularly engages in His service, He is very much inclined. In another place, the Lord says that a devotee always exists in His heart, and He also exists always in the heart of the devotee.

The special inclination of the Supreme Personality of Godhead for His pure devotee is not unnatural, nor is it partiality. For example, sometimes a father has several children, but he has special affection for one child who is very much inclined towards him. This is explained in Bhagavad-gitii (10.10):

tefiiim satata-yuktiiniim bhajatiim priti-purvakam

dadiimi buddhi-yogam tam

yena mam upayiinti te

Those who constantly engage in the devotional service of the Lord in love and affection are directly in C(\ntact with the Supreme Personality of Godhead sitting as the Supersoul in everyone's heart. The Lord is not far away from the devotee. He is always in everyone's heart, but only the devotee can realize the Lord's presence, and thus he is directly connected, and he takes instruction from the Lord at every moment. Therefore, there is no chance of a devotee's being in error, nor is there any partiality on the part of the Lord for His pure devotees. TEXT

Text 21) Lord Vi�r;tu's Appearance in the Sacrificial Arena 789
21 � 3T�l� d�1t�f� f�� wt��:l

WI r��� « 'lltqf� ���T«JN�CJm�n

sa iidi-riijo racitiinjalir harim vilokitum niisakad asru-locana�

na kincanoviica sa bii�pa-viklavo hrdopaguhyiimum adhiid avasthita�

sa�-he; adi-raja�-the original King; racita-afijali�-with folded hands; harim-the Supreme Personality of Godhead; vilokitum-to look upon; na-not; asakat-was able; asru-locanaft-his eyes full of tears; na-nor; kiiicana-anything; uviica-spoke; saft-he; bii�pa-viklavaft-his voice being choked up; hrdii-with his heart; upaguhya-embracing; amum-the Lord; adhiit-he remained; avasthita�-standing.

TRANSLATION

The original King, Maharaja Prthu, his eyes full of tears and his voice faltering and choked up, could neither see the Lord very distinctly nor speak to address the Lord in any way. He simply embraced the Lord within his heart and remained standing in that way with folded hands.

PURPORT

Just as KwJa is addressed in the Brahma-samhita as adi-puru§a, the original personality, so King Prthu, being an empowered incarnation of the Lord, is referred to in this verse as iidi-riija�, the original or ideal King. He was a great devotee and at the same time a great hero who conquered over all undesirable elements in his kingdom. He was so powerful that he was equal to fighting with Indra, the King of heaven. He gave protection to his citizens, keeping them engaged in pious activities and devotion to the Lord. He did not collect a single cent of taxes from the citizens without being able to give them protection from all calamities. The greatest calamity in life is to become godless and therefore sinful. If the state head or king allows the citizens to become sinful by indulging in illicit sex life, intoxication, meat-eating and gambling, then the king is responsible, and he has to suffer the resultant sequence of reactions for the sinful lives of the citizens because he levies taxes on them unnecessarily. These are the principles for a ruling power, and because Maharaja Prthu observed all the principles for a ruling chief, he is referred to here as iidi-riija�.

Even a responsible king like Maharaja Prthu can become a pure devotee

790 Srimad-Bhagavatam
[Canto 4, Ch. 20

of the first order. We can distinctly see from his behavior how he became ecstatic, both externally and internally, in pure devotional service.

Just today we have seen in the newspapers of Bombay that the government is going to repeal its prohibition laws. Ever since Gandhi's noncooperation movement, Bombay has been kept dry and has not allowed its citizens to drink. But unfortunately the citizens are so clever that they have increased illicit distillation of liquor, and although not being sold publicly in shops, liquor is being sold in public lavatories and similar abnormal places. Unable to check such illicit smuggling, the government has decided to manufacture the liquor at cheaper prices so that people can have their supply of intoxication directly from the government instead of purchasing it in public lavatories. The government failed to change the hearts of the citizens from indulging in sinful life, so instead of losing the taxes they collect toinflate the treasury, they have decided to manufacture liquor to supply to the citizens who hanker after it.

This kind of government cannot check the resultant actions of sinful life, namely, war, pestilence, famine, earthquakes and similar other disturbances. Nature's law is that as soon as there are discrepancies in the laws of God (which are described in Bhagavad-gitii as dharmasya gliin*, or disobediencetothe laws ofnature of God), at once there will be heavy punishment in the form of sudden outbreak of war. We have recently experienced a war between India and Pakistan. Within fourteen days there have been immense losses of men and money, and there have been disturbances to the entire world. These are the reactions of sinful life. The Kp�rya consciousness movement is meant to make people pure and perfect. If we become even partially pure, as described in the Bhiigavatam (naHa-praye§v abhadre§u), by development of Kr�rya consciousness, then lust and greed, the material diseases of the citizens, will be reduced. This can be made possible simply by broadcasting the pure message of Srimad-Bhagavatam or Kr�11a consciousness_ Big commercial and industrial firms have contributed many thousands of rupees to a Defense Fund that burns the money in the form of gunpowder, but unfortunately if they are asked to contribute liberally to advance the Kr�qa consciousness movement, they are reluctant. Under the circumstances, the world will periodically suffer from such upsurges and outbreaks of war, which are the consequences of not being Kp�qa conscious.

Text 22] Lord Vi�Q.u's Appearance in the Sacrificial Arena 791
TEXT 22 31��T�� ��;nr�HTl=T.R:'Ol �� I

athiivamrjyiisru-kalii vilokayann atrpta-drg-gocaram iiha pilruftam

padii sprsantarh kftitim arhsa unnate vinyasta-hastiigram uranga-vidvifta!t

atka-thereupon; avamrjya-wiping; asru-kalii{l,-the tears in his eyes; vilokaya n-observing; atrpta-not satisfied; drk-gocaram-visible to his naked eyes; iiha-he said; puru . sam-unto the Supreme Personality of Godhead; padii-with His lotus feet; sprsan tam-just touching; k . sitim-the ground; arhse-on the shoulder; unnate-raised; vinyasta-rested; hasta-of this hand; agra m- the front part; urmiga-vidvi§a{l,-of Garu9-a, the enemy of the snakes.

TRANSLATION

The Supreme Personality of Godhead stood with His lotus feet almost touching the ground while He rested the front of His hand on the raised shoulder of Garu(,ia, the enemy of the snakes. Maharaja P�;thu, wiping the tears from his eyes, tried to look upon the Lord, but it appeared that he was not fully satisfied by looking at Him. Thus he offered the following prayers.

PURPORT

The significant point in this verse is that the Lord was standing above the ground, almost touching it. The residents of the upper planetary systems,beginning from Brahmaloka (the planet where Lord Brahma lives) down to Svargaloka (the heavenly planet of lndra), are so advanced in spiritual life that when they come to visit this or similar other lower planetarysystems, they keep their weightlessness. This means that they can stand without touching the ground. Lord Vi�11u is the Supreme Personality of Godhead, but because He lives in one of the planetary systems within this universe, He sometimes plays as if one of the demigods of this universe. When He first appeared before P�;thu Maharaja, He was nottouching the ground of this earth, but when He was fully satisfied with the behavior and character of Maharaja P�;thu, He immediately acted as the Supreme Personality of Godhead Naraya_r:la from Vaikurytha. Out of affection for Prthu Maharaja, He touched the earth, but He rested the front of His hand on the raised shoulder of Garu<;la, His carrier, as if to prevent Himself from falling down, since the Lord is not accustomed to stand on earthly ground.

792
Srimad-Bhagavatam q�T �ij f?.J� �� ftJr�������ffi�:
[Canto 4, Ch. 20

These are all symptoms of His great affection for Prthu Maharaja. Perceiving his fortunate position, Prthu Maharaja could not fully look upon the Lord due to ecstasy, but still, in a faltering voice, he began to offer prayers.

prthur uviica variin vibho tvad varadesvariid budhaft katham vrrt"ite gu[ta-vikriyiitmaniim ye niirakiirtiim api santi dehiniim tiin "isa kaivalya-pate vrrte na ca

prthu/1. uviica- Prthu Maharaja said; variin-benedictions; vibho-my dear Supreme Lord; tvat-from You; vara-da-iSvariit-from the Supreme Personality of Godhead, the highest of the bestowers of benediction; budha[la learned person; katham-how; V[[l ite-could ask for; gu r;w-vikriyii-bewildered by the modes of material nature; iitmaniim- of the living entities; ye- which; niirakii{l-iim-of the living entities living in hell; api-also; santiexist; dehiniim-of the embodied; tiin-all those; isa-0 Supreme Lord; kaivalya-pate-0 bestower of merging in the existence of the Lord; vr�eI ask for; na-not; ca-also.

TRANSLATION

My dear Lord, You are the best of the demigods who can offer benedictions. Why therefore should any learned person ask You for benedictions that are meant for living entities who are bewildered by the modes of nature? Such benedictions are available automatically, even in the lives of living entities who are suffering in hellish conditions. My dear Lord, You can certainly bestow merging into Your existence, but I do not wish to have such a benediction.

PURPORT

There are different kinds of benedictions according to a person's demands. For karmis the best benediction is promotion to the higher plane-

Text 23] Lord Vi!JQ.U's Appearance in the Sacrificial Arena 793
�Y,?J</R �� A+lt ���� �: �� � �tfiQI�+t'11'( I � wn�qfq m� �� ijl;tm �qtf � � :q II ��II
TEXT 23

tary systems where the duration of life is very long and the standard of living and happiness is very high. There are others, namely jiiiinis and yogis, who wantthe benediction ofmerging into the existence of the Lord. This is called kaivalya. The Lord is therefore addressed as kaivalya-pati, the master or Lord of the benediction known as kaivalya. But devotees receive adifferent type of benedictionfrom the Lord. Devotees are anxious neither for the heavenly planets nor for merging into the existence of the Lord. According to devotees, kaivalya, or merging into the existence of the Lord, is considered as good as hell. The word niiraka means hell. Similarly, everyone who exists in this material world is called niiraka because this material existence itselfis known as a hellish condition of life. Prthu Maharaja, however, expressed that he was interested neither in the benediction desired by the karm"is nor that desired by the jiiiin"is and yogis. Srila Prabodhimanda Sarasvati Prabhu, a great devotee of Lord Caitanya, described that kaivalya is no better than a hellish condition of life, and as for the delights of the heavenly planets, they are factually will-o'-the-wisps or phantasmagoria. They are not wanted by devotees. Devotees do not even care for the positions held by Lord Brahma or Lord Siva, nor does a devotee desire to become equal with Lord Vi�I)U. As a pure devotee of the Lord, Prthu Maharaja made his position very clear.

TEXT 24 WI �� WIN �'liRol-

�'Wd't(\4irfl(f4�

1t CR:: 11�\111

na kiimaye niitha tad apy aharit kvacin

na yatra yufimac-carartiimbujasava{t mahattamiintar-hrdayiin mukha-cyuto

vidhatsva karrtiiyutam e§a me vara[l,

na-not ; kiimaye-do I desire; natha-0 master; tat-that; api-even; aham-1; kvacit-at any time; na-not ; yatra-where; yufimat-Your; carartaambuja-of the lotus feet; iisavalz-the nectarean beverage; mahattama-of the great devotees; anta[l.-hrdayat-from the core of the heart; mukhafrom the mouths; cyuta[l.-being delivered; vidhatsva-give; karrta-ears; ayutam-one million;e§a[l,-this; me-my; varaft-benediction.

794 Srimad-Bhagavatam [Canto 4, Ch. 20
�
('
�
�iij(Uil�i:ill(1�:
"'
�� �on�ttittt

My dear Lord, I therefore do not wish to have the benediction of merging into Your existence because in that position there is no existence of the nectarean beverage of Your lotus feet. I want the benediction of at least one million ears, for thus I may be able to hear about the glories of Your lotus feet from the mouths of Your pure devotees.

PURPORT

In the previous verseMaharaja Prthu addressed the Lord as kaivalya-pati, the master of the liberation of merging into His existence. This does not mean that he was anxious for kaivalya liberation. That is made clear in this verse: "My dear Lord, I do not want such a benediction." Maharaja Prthu wanted to have a million ears to hear the glories of the lotus feet of the Lord. He specificallymentionedthat the glories of the Lordshouldemanate from the mouths of pure devotees who speak from the cores of their hearts. It is stated in the beginning of Snmad-Bhagavatam, suka-mukhad amrta-drava-samyutam: the nectar of Srimad-Bhasavatam became more relishable because it emanated from the mouth of Srila Sukadeva Gosvami (Bhii.g. 1.1.3). One might think that these glories of the Lord can be heard from anywhere, from the mouths of either devotees or nondevotees, but here it is specifically mentioned that the glories of the Lord must emanate from the mouths of pure devotees. Sri Sanatana Gosvami has strictly prohibited hearing from �he mouth of a nondevotee. There are many professional reciters of Snmad-Bhagavatam who speak the narrations very ornamentally, but a pure devotee does not like to hear from them because such glorification of the Lord is simply a vibration of material sound.When it is heard from the mouth of a pure devotee, glorification of the Lord is immediately effective.

The words satam prasanglin mama virya-samvida� mean that glorification of the Lord is potent when uttered from the mouthof a pure devotee. The Lord has innumerable devotees all over the universe, and they have been glorifying the Lord since time immemorial and for an unlimited time. But still they cannot completely finish enumerating the glories of the Lord. Prthu Maharaja therefore wanted innumerable ears, as Rupa Gosvami also desired to have millions of ears and millions of tongues to chant and hear the glorification of the Lord. In other words, if our ears are always engaged in hearing the glorification of the Lord, therewill be no scope for hearing the Mayavada philosophy, which is doom to spiritual progress. Sri Caitanya Mahaprabhu said that if anyone hearsfrom a Mayavadi philosopher preach-

Text 24] Lord Vi!JQU's Appearance in the Sacrificial Arena 795
TRANSLATION

ing about the activities of the Lord, even if it is a description from the Vedic literature, he is ultimately doomed. By hearing such Mayavadaphilosophy one cannot come to the destination of spiritualperfection of life.

TEXT 25

sa uttamasloka mahan-mukha-cyuto bhavat-padiimbhoja-sudhii-kartiinila� smrtim punar vismrta-tattva-vartmaniim kuyoginiim no vitaraty alam vara*

sa[!.- that; uttama-Sloka-0 Lord,who is praised byselected verses; mahat -of great devotees; mukha-cyuta[l. -delivered from the mouths; bhavatYour; pada-ambhoja-from the lotus feet; sudha-of nectar; kartiiparticles; an ila[l. -soothing breeze; smrtim-remembrance; pu n a[l. -again; vismrta-forgotten; tattva-to the truth; vartmaniim-of persons whose path; ku-yoginiim-of persons not in the line of devotional service; na�of us; vitarati-restores; alam-unnecessary; varai[l-other benedictions.

TRANSLATION

My dear Lord, You are glorified by the selected verses uttered by great personalities. Such glorification of Your lotus feet is just like saffron particles. When the transcendental vibration from the mouths of great devotees carries the aroma of the saffron dust of Your lotus feet, the forgetful living entity gradually remembers his eternal relationship with You. Devotees thus gradually come to the right conclusion about the value of life. My dear Lord, I therefore do not need any other benediction but the opportunity to hear from the mouth of Your pure devotee.

PURPORT

It is explained in the previous verse that one has to hear glorification of the Lord from the mouth of a pure devotee. This is further explained here. The transcendental vibration from the mouth of a pure devotee is so powerful that it can revive the living entity's memory of his eternal rela-

796 Srimad-Bhagavatam [Canto 4, Ch. 20
� �� 'ii{.-ij(if�� lt��qa:•·���: �� �f.i�Jtddi'4€l� ft{tftr.:rt
.U ftta<�tt� tR: '"�II

tionship with the Supreme Personality of Godhead. In our material existence, under the influence of illusory miiyii, we have almost forgotten our eternal relationship with the Lord, exactly like a man sleeping very deeply who forgets his duties. In the Vedas it is said that every one of us is sleeping under the influence of miiyii. We must get up from this slumber and engage in the right service, for thus we can properly utilize the facility of this human form of life. As expressed in a songby Thakura Bhaktivinoda, Lord Caitanya says, ']tva jiigo, jiva jiigo." The Lord asks every sleeping living entity to get up and engage in devotional service so that his mission in this human form of life may be fulfilled. This awakening voice comes through the mouth of a pure devotee.

A pure devotee always engages in the service of the Lord, taking shelter of His lotus feet, and therefore he has direct connection with the saffron mercy particles that are strewn over the lotus feet of the Lord. Although when a pure devotee speaks the articulation of his voice may resemble the sound of this material sky, because the voice touches the particles of saffron dust on the lotus feet of the Lord, the voice is spiritually very powerful. As soon as a sleeping living entity hears the powerful voice emanating from the mouth of a pure devotee, he immediately remembers his eternal relationship with the Lord, although up until that moment he had forgotten everything.

For a conditioned soul, therefore, it is very important to hear from the mouth of a pure devotee who is fully surrendered to the lotus feet of the Lord without any material desire, speculative knowledge or contamination ofthe modes ofmaterial nature. Every one of us is kuyogt because we have engagedin the service ofthis materialworld,forgetting our eternalrelationshipwith the Lord as His eternal loving servants. It is our duty to rise from the kuyoga platform to become suyogts, perfect mystics. The process of hearing from a pure devotee is recommended in all Vedic scriptures, especially by Lord Caitanya Mahaprabhu. One may stay in his position of life-it doesn't matterwhat it is-butif one hears from the mouth ofa pure devotee, he gradually comes to the understanding of his relationship with the Lord and thus engages in His loving service, and his life becomes completely perfect. Therefore, this process of hearing from the mouth of a pure devotee is very important for making progress in the line of spiritual understanding.

Text 26] Lord Vi��u's Appearance in the Sacrificial Arena 797
TEXT 26 ·�: ftFi ij�Cf �� �)q�aftRJ ij �R I

yasa"{l. sivarh susrava iirya-sangame yadrcchayii copasnwti te sakrt katharh gurw-jno viramed vinii pasurh srir yat pravavre gur-a-sangrahecchayii

yasa[l-glorification; sivam-all-auspicious; su-srava"{l.-0 highly glorified Lord; iirya-sangame-in the association of advanced devotees; yadrcchayiisomehow or other; ca-also; upasnwti-hears; te- Your; sakrt-even once; katham-how; gur-a-jna"{l.- one who appreciates good qualities; virametcan cease; vinii-unless; pasum-an animal; sri"{l.-the goddess of fortune; yat-which; pravavre-accepted; gur-a-Your qualities; sangraha- to receive; icchayii-with a desire.

TRANSLATION

My dear highly glorified Lord, if one, in the association of pure devotees, hears even once the glories of Your activities, he does not, unless he is nothing but an animal, give up the association of devotees, for no intelligent person would be so careless as to leave their association. The perfectio.n of chanting and hearing about Your glories was even accepted by the goddess of fortune, who desired to hear of Your unlimited activities and transcendental glories.

PURPORT

The association of devotees (iirya-sangama) is the most important factor in this world. The word iirya refers to those who are advancing spiritually. In the history of the human race, the Aryan family is considered to be the most elevated community in the world because it adopts the Vedic civilization.TheAryan familyis distributed all over the world and isknown as Indo-Aryan. In prehistoric days all of the members of the Aryan family followed the Vedic principles, and therefore they became spiritually advanced. The kings, known as riijar�is, were so perfectly educated as k�atriyas, or protectors of the citizens, and so greatly advanced in spiritual life, that there was not a bit of trouble for the citizens.

The glorification of the Supreme Lord can be very much appreciated by the Aryan family. Although there isno bar for others, the members of the Aryan family very quickly catch the essence of spiritual life. How is it we

798 Srimad-Bhagavatam [Canto 4, Ch. 20 � !XU'�
��sr�
f?c<ttfuWit �
�IJf��� II� �II

are findingitvery easy to spread J<r�Qaconsciousness amongst the Europeans and Americans? History reports that the Americans and Europeans proved their capability when they were anxious to expand colonization, but at the present time, being contaminated by the advancement of material science, their sons and grandsons are turning into reprobates. This is due to their having lost their original spiritual culture, which is Vedic civilization. Presently these descendants of the Aryan family are taking this Kr�Qa consciousness movement very seriously. Others also who are associating with them and hearing the chanting of the Hare Kt�l).a mahiimantra from the lips of pure devotees are also becoming captivated by the transcendentalvibration.Transcendental vibrations are very much effective when chanted amongst Aryans, but even though one does not belong to the Aryan family, he will become a Vai�Qava simply by hearing the mantra because the vibration has great influence over everyone.

Maharaja Prthu points out that even the goddess of fortune, who is the constant companion of Lord NarayaQa, specifically wanted to hear about the Lord's glories, and for the association of the gopi:s, who are pure devotees,the goddess of fortune, Lak�mi, underwent severe austerities.The impersonalist may ask why one should bother chanting the Hare Kr�Qa mahii-mantra continually for so many years instead of stopping and trying for kaivalya, liberation, or merging into the existence of the Lord. In answer, Maharaja Prthu maintains that the attraction of this chanting is so great that one cannot give up the process unless he is an animal. This is the case even if one comes in contact with this transcendental vibration by chance. Prthu Maharaja isveryemphatic in this connection-only an animal can give up the practice of chanting Hare Kr�Qa. Those who are not animals, who are actually intelligent, advanced, human, civilized men, cannot give upthis practice of continually chanting Hare Kn>Qa, Hare Kt�Qa, Km1a Kr�Qa, Hare Hare I Hare Rama, Hare Rama, Rama Rama, Hare Hare.

Text 27) Lord Vi�Qu's Appearance in the Sacrificial Arena 799
27 � ���� gond4 q"w �: 3CQfl'4����qRt�«NT: mef ����<11'1�: ����II athiibhaje tviikhila-pum§ottamam guf!.alayam padma-kareva liilasal}
TEXT

apy avayor eka-pati-sprdho� kalir na syiit lqta-tvac-carar-aika-tiinayo�

atha-therefore; iibhaje-1 shall engage in devotional service; tvii-unto You; akhila-all-inclusive; pii,ru§a-uttamam-the Supreme Personality of Godhead;gur-a-iilayam-the reservoir of all transcendental qualities; padmakarii-the goddess of fortune, who carries a lotus flower in her hand; ivalike; liilasa�-being desirous; api-indeed; avayo�-of Lak�mi and me; ekapati-one master; sprdho�-competing; kali� - quar rel; na- not; syiit-may take place; krta-having done; tvat-cararJa-unto Your lotus feet; ekatiinayo�-one attention.

TRANSLATION

Now I wish to engage in the service of the lotus feet of the Supreme Personality of Godhead and to serve just as the goddess of fortune who carries a lotus flower in her hand because His Lordship, the Supreme Personality of Godhead, is the reservoir of all transcendental qualities. I am afraid that the goddess of fortune and I will quarrel because both of us would be attentively engaged in the same service.

PURPORT

The Lord is here addressed as akhila-piiru§ottama, the Supreme Personality of Godhead who is Lord of the entire creation. Puru§a means the enjoyer, and uttama means the best. There are different kinds of puru§aS or enjoyers within the universe. Generally they can be divided into three classes-those who are conditioned, thosewho are liberated, and those who are eternal. In the Vedas the Supreme Lord is called the supreme eternal of alleternals (nityo nityiiniim). Both the Supreme Personality of Godhead and the living entities are eternal. The supreme eternals are the vi§[Lutattva or Lord Vi�l)U and His expansions. So nitya refers to the Personality of Godhead beginning frofu Kr�f.la up to Maha-Vi�l)u, Narayal)a and other expansions of Lord Kr�f.la. As stated in the Brahma-samhitii (riimiidimurti§u) there are millions and trillions of expansions of Lord Vi�l)U as Riima, Nrsimha, Variiha and other incarnations. All of them are called eternals.

The word mukta refers to the living entities who never come within this material world. The baddhas are those living entities who are almost eternally living within this material world. The baddhas are struggling very hard within this material world to become free from the threefold miseries of material nature and to enjoy life, whereas the muktas are

800 Srimad-Bhagavatam [Canto 4, Ch. 20

already liberated. They never come into this material world. Lord Vi�Q.U is the master of this material world, and there is no question of His being controlled by material nature. Consequently, Lord Vi�Q.U is addressed here as pii.ru§ottama, the best of all living entities-namely vi§r-u-tattvas and jiva-tattvas. It is a great offense, therefore, to compare Lord Vi�Q.U and the jiva-tattva or consider them on an equal level. The Mayavadi philosophers equalize the jivas and the Supreme Lord and consider them to be one, but that is the greatest offense to the lotus feet of Lord Vi�Q.u.

Here in the material world we have practical experience that a superior person is worshiped by an inferior one. Similarly, piiru§ottama, the greatest, the Supreme Personality of Godhead Kr�Q.a or Lord Vi�Q.U, is always worshiped by others. Prthu Maharaja therefore decided to engage in the service of the lotus feet of Lord Vi�Q.u. Prthu Maharaja is considered to be an incarnation of Lord Vi�Q.U, but he is called a saktyiivesa incarnation. Another significant word in this verse is guruilayam, which refers to Vi�Q.U as the reservoir of all transcendental qualities. The Mayavadi philosophers take the Absolute Truth to be nirgur-a (without qualities), in accordance with the impersonalistic view, but actually the Lord is the reservoir of all good qualities. One of the most important qualities of the Lord is His inclination to His devotees, called bhakta-vatsala. The devotees are always very much inclined to render service to the lotus feet of the Lord, and the Lord is also very much inclined to accept loving service from His devotees. In that exchange of service there are so many transcendental transactions which are called transcendental qualitative activities. Some of the transcendental qualities of the Lord are that He is omniscient, omnipresent, allpervasive, all-powerful, the cause of all causes, the Absolute Truth, the reservoir of all pleasures, the reservoir of all knowledge, the all-auspicious and so on.

Prthu Maharaja desired to serve the Lord with the goddess of fortune, but this desire does not mean that he was situated on the platform of miidhurya-rasa. The goddess of fortune is engaged in the service of the Lord in the miidhurya-rasa of conjugal love. Although her position is on the chest of the Lord, the goddess of fortune, in her position as a devotee, takes pleasure in serving the lotus feet of the Lord. Prthu Maharaja was thinking only of the lotus feet of the Lord because he is on the platform of diisya-rasa or servitorship of the Lord. From the next verse we learn that Prthu Maharaja was thinking of the goddess of fortune as the universal mother, jagan-miitii. Consequently there was no question of his competing with her on the platform of miidhurya-rasa. Nonetheless he feared that she might take offense at his engaging in the service of the Lord. This suggests that in the absolute world there is sometimes competitionbetween servitors

Text 27] Lord
's
in
801
Vi�Q.U
Appearance
the Sacrificial Arena

in the service of the Lord, but such competition is without malice. In the VaikuJ;ttha worlds if a devotee excels in the service of the Lord, others do not become envious of his excellentservicebut rather aspireto cometo the platform of that service.

jagaj-jananyiirh jagad-isa vaisasarh syiid eva yat-karmarti nalJ, samihitam karo$i phalgv apy uru dina-vatsala[l, sva eva dhi��ye 'bhiratasya kim taya

jagat-jananyiim-in the mother of the universe (Lak�mi:); jagat-isa-0 Lord of the universe; vaisasam-anger; syiit-may arise; eva-certainly; yatkarmap.i-in whose activity; na{t-my;samihitarn-desire; karo.si-You consider; phalgu-insignificant service;api-even; uru-verygreat; d'ina-vatsalaft -favorablyinclined to the poor;sve-own;eva-certainly; dhifirtye- in Your opulence; abhiratasya-of one who is fully satisfied; kim-what need is there; tayii-with her.

TRANSLATION

My dear Lord of the universe, the goddess of fortune L�mi is the mother of the universe, and yet I think that she may be angry with me because of my intruding on her service and my acting on that very platform to which she is so much attached. Yet I am hopeful that, even though there is some misunderstanding, You will take my part because You are very much inclined to the poor, and You always magnify even insignificant service unto You. Therefore even though she becomes angry, I think that there is no harm for You, because You are so self-sufficient that You can do without her.

PURPORT

Mother Lak�miji, the goddess of fortune, is well known for always massaging the lotus feet of Lord NarayaJ;ta. She is an ideal wife because she takes care of Lord Narayar;ta in every detail. She not only takes care of His lotus feet but of the household affairs of the Lord as well. She cooks nice foods for Him, fans Him while He eats, smoothes sandalwood pulp

802 Srimad-Bhagavatam [Canto 4, Ch. 20
i;l�� �� � �IJf ;r: ��I � <h�"et'i(i ��: � �Nf>O�SflHij�� � ������
TEXT 28

on His face, and sets His bed and sitting places in the right order. Inthis way she is always engaged in the service of the Lord, and there is hardly anyopportunityforanyother devotee to intrudeupon His dailyactivities. PrthuMaharaja istherefore almostcertainthathisintrusioninto the service ofthe goddess of fortunewould irritateherandcauseherto become angry with him. But why should mother Lalq;mi, the mother of the universe, be angrywith an insignificant devotee like Prthu Maharaja?All this is notvery likely. Yet Prthu Maharaja, just for his personal protection, appealed to the Lord to take his part. Prthu Maharaja was engaged in performing the ordinary Vedic rituals and in performing sacrifices according to karmakiirtt;la, orfruitive activities,but the Lord, being so kind and magnanimous, was ready to award Prthu Maharaja the highest perfectional stage of life, namelydevotional service.

When a person performs Vedic rituals and sacrifices, he does so to elevate himself to the heavenly planets. No one can become qualified to go back home, back to Godhead, by means of such sacrifices. But the Lord is so kind that He accepts a littleinsignificant service, and therefore it is stated in the Vi�[lu Puriirta that by following the principles of varrtiisrama-dharma one can satisfy the Supreme Lord. When the Lord is satisfied, the performer of sacrifices is elevated to the platform of devotional service. Prthu Maharaja therefore expected that his insignificant serviceto theLord would be accepted by Him as being greater than that of Lak�miji. The goddess of fortune is called caiicalii (restless) because sheis very restless and is always coming and going. So Prthu Maharaja indicates that even though she might go awayoutof anger, there would be noharm forLord Vi�r;tu,because He is self-sufficient and cando anything andeverything without the help of Lak�miji. For example, when Garbhodakasayi Vi�r;tu begot Lord Brahma from His navel, He didn't take any help from Lak�mi, who was just sitting by Him and massaging His lotus feet. Generally if a son is to be begotten, the husband impregnates the wife, and in due course of time the sonis born. But in the case of Lord Brahma's birth, Garbhodakasayi Vi�r;tu did not impregnate Lak�m1p. Being self-sufficient, the Lord begot Brahma from His own navel. Therefore, Prthu Maharaja is confident that even if the goddess of fortunebecame angry with him there would be noharm,neitherto the Lordnortohimself.

Text29] Lord Vi�Qu'sAppearanceintheSacrificialArena 803
TEXT29 l(S{� ffi1RI � � �(ij¥\lqlgulNR¥4�

bhajanty atha tvam ata eva sadhavo vyudasta-maya-gur-a-vibhramodayam bhavat-padiinusmarariid rte satiirh nimittam anyad bhagavan na vidmahe

bhajanti-they worship; atha- therefore; tvam-You; ata eva-therefore; sadhava[l.- all saintlypersons; vyudasta-who dispel; maya-gura-the modes of material nature; vibhrama-misconceptions; udayam- produced; bhavat -Your; pada-lotus feet; anusmarar-at-constantly remembering; rteexcept; satam-of great saintly persons; nimittam-reason; anyat-other; bhagavan-0 Supreme Personality of Godhead; na-not ; vidmahe-I can understand.

TRANSLATION

Great saintly persons who are always liberated take to Your devotional service because only by devotional service can one be relieved from the illusions of material existence. 0 my Lord, there is no other reason for the liberated souls to take shelter at Your lotus feet except for the fact that they are constantly thinking of them.

PURPORT

The karm!s are generallyengaged infruitive activities for material bodily comforts. The jniin!s, however, are disgusted with searching after material comforts. They understand that they have nothing to do with this material world, being spirit souls. After self-realization, the piiin!s who are actually matured in their knowledge must surrender unto the lotusfeet of the Lord, as is stated in Bhagavad-g!tii (bahiiniim janmaniim ante). Self-realization is not complete unless one comes to the devotional platform. Therefore it is stated in the Sr!mad-Bhiigavatam that those who are iitmiiriima, selfsatisfied, arefreed from all contaminations of the material modes ofnature. As long as one is affected by the modes of material nature, especially by raja[!. and tama[l., he will be very greedyand lusty and will therefore engage in hard tasks, laboring all day and night. Such false egoism carries one from one species of life into another perpetually, and there is no rest in any species of life. The jiiiin! understands this fact and therefore ceases to work and takes to karma-sannyiisa.

804 Srimad-Bhagavatam fi::C�qaJ��(Uilt� ��qt:qi(4i'it"it [Canto 4, Ch. 20

Yet thisis not actually the platform of satisfaction. After self-realization, the material wisdom of the jniin"i leads him to the shelter of the lotus feet of the Lord. Then he is only satisfied in contemplating the lotus feet of the Lord constantly. J>rthu Maharaja therefore concludes that liberated persons taking to the devotional path have acquired the ultimate goal of life. If liberation were the end in itself, there would be no question of a liberated person's taking to devotional service. In other words, the transcendental bliss derived from self-realization, known as iitmiinanda, is very insignificant in the presence of the bliss derived from devotional service to the lotus feet of the Lord. Prthu Maharaja therefore concluded that he would simply hear of the glories of the Lord constantly and thus engage his mind upon the lotus feet of the Lord. That is the highest perfection of life.

TEXT

manye girarh te jagatiirh vimohin"irh varam VfTJl§Veti bhajantam iittha yat viicii nu tantyii yadi te jano 'sital). katham puna�). karma karoti mohitafl

manye-I consider; giram-words; te-Your; jagatiim-to the material world; vimohinim- bewildering; varam-benediction; VJ[t�sva- just accept; iti-in this way; bhajantam-unto Your devotee; iittha- You spoke; yatbecause; viicii-by the statements of the Vedas; nu-certainly ; tantyii-by the ropes; yadi-if; te- Your; jana[t-the people in general; asita[t-not bound; katham-how; puna[t-again and again; karma-fruitive activities; karoti- perform; mohita[t-being enamored.

TRANSLATION

Mydear Lord,what You have said to Your unalloyed devotee is certainly very much bewildering. The allurements which You offer in the Vedas are certainly not suitable for pure devotees. People in general are bound

Text 30] Lord Vi�Qu's Appearance in the Sacrificial Arena 805
�fiR �� f?..{t�;(f tR'{Oft��RJ +l<:lr6'41� � I �������tsfQQ: ��: � �Rr mf{�: ll�oll
30

by the sweet words of the Vedas, and they engage themselves again and again in fruitive activities, enamored by the results of their actions.

PURPORT

Srila Narottama dasa Thakura, a great acarya of the Gau�iya-sampradaya, has said that persons who are very much attached to the fruitive activities of the Vedas, namely karma-kiir{ia and jniina-kiir{ia, are certainly doomed. In the Vedas there are three categories of activities known as karma-kiir{ia, fruitive activities, jniina-kiir{ia, philosophical research, and upiisana-kiir{ia, worship of different demigods for receiving material benefits. Those who are engaged in karma-kti[!{ia and jnana-kii[!{ia are doomed in the sense that everyone is doomed who is entrapped by this material body, whether it is a body of a demigod, a king, a lower animal or whatever. The sufferings of the threefold miseries of material nature are the same for all. Cultivation of knowledge to understand one's spiritual position is also, to a certain extent, a waste of time. Because he is an eternal part and parcel of the Supreme Lord, the immediate business of the living entity is to engage himself in devotional service. Prthu Maharaja therefore says that the allurement of material benedictions is another trap to entangle one in this material world. He therefore frankly tells the Lord that the Lord's offerings of benedictions in the form of material facilities are certainly causes for bewilderment. A pure devotee is not at all interested in bhukti or mukti.

The Lord sometimes offers benedictions to the neophyte devotees who have not yet understood that material facilities will not make them happy. In the Caitanya-caritiimrta the Lord therefore says that a sincere devotee who is not very intelligent may ask some material benefit from the Lord, but the Lord, being omniscient, does not generally give material rewards but, on the contrary, takes away whatever material facilities are being enjoyed by His devotee so that ultimately the devotee will completely surrender unto Him. In other words, the offering of benedictions in the form of material profit is never auspicious for the devotee. The statements of the Vedas which offer elevation to heavenly planets in exchange for great sacrifices are simply bewildering.Therefore in Bhagavad-g'itii the Lord says: yiim imiirh pufipitiirh vacarh pravadanty avipascita� (Bg. 2.42). The less intelligent class of men (avipascita�) are attracted by the flowery language of the Vedas and therefore engage in fruitive activities to become materially benefited. Thus they continue life after life, in different bodily forms, to search very, very hard.

806 Srimad-Bhagavatam [Canto 4, Ch. 20

�1�'4;11�: I

�' 'ii4'U::R�fl6 m. �

���fttwt: II��I

tvan-mayayaddha jana isa khar-flito yad anyad asasta rtatmano 'budhafi. yathii cared biila-hitam pita svayam tatha tvam evarhasi nafi. samihitum

tvat- Your; miiyayii-by illusory energy; addhii-certainly; janal;t- the people in general; isa-0 my Lord; k har4itafi.- separated; yat- because ; anyat- other; iisiiste- they desire; rta-real; iitmana[l.-from the self; abudhafi.- without proper understanding; yathii-as; caret-would engage in; biila-hitam-the welfare of one's child; pitii-the father; svayampersonally; tatha-similarly; tvam-Your Lordship eva - certainly; arhasi nafi. samihitum-pleaseactonmybehalf.

TRANSLATION

My Lord, due to Your illusory energy, all living beings in this material world have forgotten their real constitutional position, and out of ignorance they are always desirous of material happiness in the form of society, friendship and love. Therefore, please do not ask me to take some material benefits from You, but as the father, not waiting for the son's demand, does everything for the benefit of the son, please bestow upon me whatever You think best for me.

PURPORT

It is the duty of the sontodependuponhis father without asking anything from him. Thegood son has faiththat thefather knowsbest how to benefit him. Similarly, a pure devotee does not ask anything from the Lord for material benefit. Nor does he ask anything for spiritual benefit. The pure devotee is fully surrendered unto the lotus feet of the Lord, andthe Lordtakescharge of him, asstatedin Bhagavadg1tii: aharh tviim sarva-piipebhy.o mok�ay.i�yiimi (Bg. 18.66). The father

Text 31]
Lord Vi�J]u's Appearance in the Sacrificial Arena TEXT 31 �fllltltll(l�;r���� tl�rit�l\lltt'l
807

knows the necessities of the son and supplies them, and the Supreme Lord knows the necessities of the living entities and supplies them sumptuously. Therefore the Isopani�ad states that everything in this material world is complete (piirrtam idam). The difficulty is that due to forgetfulness the living entities create unnecessary demands and entangle themselves in material activities. The result is that there is no end to material activities life after life.

Before us there are varieties of living entities, and everyone is entangled in transmigrations and activities. Our duty is simply to surrender unto the Supreme Personality of Godhead and let Him take charge, for He knows what is good for us.

P�thu Maharaja therefore tells the Lord that as the Supreme Father He may elect to bestow whatever He considers beneficial for Prthu Maharaja. That is the perfect position of the living entity. Therefore Sri Caitanya Mahaprabhu teaches us in His $ik.sii�_taka:

na dhanam na janam na sundar"im kavitiim vii jagad-iSa ktimaye mama janmani janman"isvare bhavattid bhaktir ahaitukitvayi

"0 Almighty Lord! I have no desire to accumulate wealth, nor have I any desire to enjoy beautiful women, nor do I want any number of followers. I only want Your causeless devotional service in my life, birth after birth."

The conclusion is that the pure devotee should not aspire after any material benefit from devotional service, nor should he be enamored by fruitive activities or philosophical speculation. He should always be engaged favorably in the service of the Lord. That is the highest perfection of life.

TEXT 32 ...... �57<1 �

�R(I�wt �: ij' ��.....

� m'{ � liRfi<� ij 1

�m � � t;m lftn

maitreya uviica

ity tidi-rajena nuta� sa visva-drk

tam iiha riijan mayi bhaktir astu te

di§tyedrsi dhir mayi te krtii yayii

miiyiim madiyiim tarati sma dustyajiim

808 Srimad-Bhagavatam [Canto 4, Ch. 20
�����������II

maitreya�-Maitreya, thegreat sage;uvaca-spoke;iti-thus;adi-rajenaby the original King (Prthu); nuta�-being worshiped; sa�-He (the Supreme Personality of Godhead); vi.Sva-drk-the seer of the whole universe; tam-unto him; aha-said; rii.jan-my dear King; mayi-unto Me; bhakt*-devotional service; astu-let it be; te-your; d�.tya-by good fortune; idrsi-like this; dhi�-intelligence; mayi-unto Me; te-by you; krta-having been performed; yaya-by which; mayam-illusory energy; madiyam-My; tarati-crosses over; sma-certainly; dustyajam-very difficult togive up.

TRANSLATION

The great sage Maitreya continued to speak: The Lord, the seer of the universe, after hearing Prthu Maharaja's prayer, addressed the King: My dear King,may you always be blessed by engaging in My devotional service. Only by such purity of purpose, as you yourself very intelligently express, can one cross over the insurmountable illusory energy of maya.

PURPORT

This isalso confirmedinBhagavad-gitii whereintheLordalso claimsthat the illusory energy is insurmountable. No one can transcend the illusory energyofmiiyii byfruitiveactivity,speculativephilosophyor mysticyoga. The only means for transcending illusory energy is devotional service, as the Lord Himself states.

miimevayeprapadyante miiyametarh tarantite (Bg. 7.14)

If one wants to cross over the ocean of material existence, there is no alternative thantotaketodevotionalservice. A devotee, therefore, should not care for any material position, whether in heaven or in hell. A pure devotee should always engage in the service of the Lord, for that is his real occupation. Simply by sticking to that position one can overcome thestringentlaws ofmaterialnature.

Text 33] Lord Vi�l'}.u's Appearance in the Sacrificial Arena 809
TEXT 33 " � 'ATSsfG:e+tst+t�: �m 1 +tGX,.u �: mmTRr �� 11��11 tattvarh kurumayad�.tam apramatta� prajapate

tat-therefore; tvam-you; kuru-do; maya- by Me; iidi§. tam-what is ordered; apramattafl-without being misguided; prajii-pate-0 master of the citizens; mat-of Me; iidesa-karafl-who executes the order; lokafl-any person; sarvatra-everywhere; iipnoti-achieves; sobhanam-all good fortune.

TRANSLATION

My dear King, 0 protector of the citizens, henceforward be very careful to execute My orders and not be misled by anything. Anyone who lives in that way, simply carrying out My orders faithfully, will always find good fortune all over the world.

PURPORT

The sum and substance of religious life is to execute the orders of the Supreme Personality of Godhead, and one who does so is perfectly religious. In Bhagavad-g"itii the Supreme Lord Kr�Q.a says, man-manii bhava mad-bhakta}_!,: "Just think of Mealwaysand become Mydevotee." (Bg. 18.65) Furthermore, the Lord says, sarva-dharmiin parityajya miim ekarh saraparh vraja: "Give up all kinds of material engagement and simply surrender unto Me." (Bg. 18.66) This is the primary principle of religion. Anyone who directly executes such an order from the Personality of Godhead is actually a religious person. Others are described as pretenders, for there are many activities going on throughout the world in the name of religion which are not actually religious. For one who executes the order of the Supreme Personality of Godhead, however, there is only good fortune throughout the world. TEXT

810 Srimad-Bhagavatam mad-iidesa-karo lokafl sarvatriipnoti sobhanam [Canto 4, Ch. 20
34 �� �� �: S(��:l
�������II
uviica iti
riijar§e[l
�dtS!4lt\�;iq;ij
maitreya
vainyasya
pratinandyiirthavad vacafl

pujito 'nugrhitvainam

gantum cakre 'cyuto matim

maitreya� uvaca-the great sage Maitreya continued to speak; iti-thus; vainyasya-of the son of King Vena (Prthu Maharaja); raja-rfie �-of the saintly King; pratinandya- appreciating; artha-vat vaca�-the prayers, which were full of meaning; piijita�-being worshiped; anugrhitvasufficiently benedicting; enam-King J>rthu; gantum-to go from that place;cakre-made up; acyuta�-the infallible Lord; matim-His mind.

TRANSLATION

The great saint Maitreya told Vidura: The Supreme Personality of Godhead amply appreciated the meaningful prayers of Maharaja J»tthu. Thus, after being properly worshiped by the King, the Lord benedicted him and decided to depart.

PURPORT

Most important in this verse are the words pratinandyiirthavad vaca�, which indicate that the Lord appreciated the very meaningful prayers of the King. When a devotee prays to the Lord, it is not to ask for material benefits but to askthe Lord forHis favor;he prays that he may beengaged in the service of the Lord's lotus feet birth after birth. Lord Caitanya therefore uses the words mama janmani janmani, which mean "birth after birth," because a devotee is not even interested in stopping the repetition of birth.The Lord and the devotee appear in this materialworld birth after birth, but such births are transcendental. In the Fourth Chapter of Bhagavad-gTtii the Lord informed Arjuna that both He and Arjuna had undergonemany,many births previously, but the Lord remembered everything about them whereas Arjuna had forgotten. The Lord and His confidential devotees appear many times to fulfill the Lord's mission, but since such births are transcendental, they are not accompanied by the miserable conditions of material birth, and they are therefore called divya, transcendental.

One must understand thetranscendental birth of the Lord and the devotee. The purpose of the Lord's taking birth is to establish devotional service, which is the perfect system of religion, and the purpose of the birth ofa devotee isto broadcast the same system of religion,or the bhakti cult, all over the world. Prthu Maharaja was an incarnation of the power of the Lord to spread the bhakti cult, and the Lord blessed him to remain

Text 34) Lord Vi�Qu's Appearance in the Sacrificial Arena 811

fixed in his position. Thus when the King refused to accept any material benediction, the Lord appreciated that refusal very much. Another significant word in this verse is acyuta, which means "infallible." Although the Lord appears in this material world, He is never to be considered one of the conditioned souls, who are all fallible. When the Lord appears, He remains in His spiritual position, uncontaminated by the modes ofmaterial nature, and therefore in Bhagavad-g"itii the Lord expresses the quality of His appearance as iitma-miiyayii, "performed by internal potency." The Lord, being infallible, is not forced by material nature to take birth in this material world. He appears in order to reestablish the perfect order of religious principles and to vanquish the demoniac influence in human society.

TEXTS 35-36

devarfli-pitr-gandharvasiddha-ciirar-a-pannagiift kinnariipsaraso martyiift

khagii bhiitiiny anekasaft

yajnesvara-dhiyii riijnii

viig-vittiiJijali-bhaktita{t sabhiijitii yayuft sarve

vaikur-.thiinugatiis tataft

deva-the demigods; [fli-the great sages; pitr-inhabitants of Pitrloka; gandharva- inhabitants of Gandharvaloka; siddha- inhabitants of Siddhaloka; cara!'la-inhabitants of the Cliral)aloka; pannaga�-inhabitants of the planets where serpents live; kinnara-inhabitants of the Kinnara planets; apsarasaft-inhabitants of the Apsaroloka; martya[l.-inhabitants of the earthly planets; khaga[l.-birds; bhiitani-other living entities; anekasa[l.many; yaj iia-iSvara-dhiya-with perfect intelligence of thinking as part and parcel of the Supreme Lord; riijiiii-by the King; vak-with sweet words; vitta-wealth; aiijali-with folded hands; bhaktitaft-in a spirit of

812 Srimad-Bhagavatam [Canto 4, Ch. 20
1
�41' i{ffl;:m�n������ q� � cnP�'EII��+ri'�i�r: I � �: � qto61?!•tcrnmr: ������
1\41(1"(1®�:

devotional service; sabhajitiift-being properly worshiped; yayu�-went; sarve-ali; vaiku[l_tha-of the Supreme Personality of Godhead , Vigm; anugatiift-followers; tataft-from that place.

TRANSLATION

King P{thu worshiped the demigods, the great sages, the inhabitants of Pitrloka, the inhabitants of Gandharvaloka, and those of Siddhaloka, OiraQaloka, Pannagaloka, Kinnaraloka, Apsaroloka, the earthly planets and the planets of the birds. He also worshiped many other living entities who presented themselves in the sacrificial arena. With folded hands he worshiped all these, as well as the Supreme Personality of Godhead and the personal associates of the Lord, by offering sweet words and as much wealth as possible.Afterthisfunction,they all went back to their respective abodes, following in the footsteps of �rd Vi�QU.

PURPORT

In modern so-called scientific society the idea is very prevalent that thereis no life on other planets but that only on this earth do living entities with intelligence and scientific knowledge exist. The Vedic literatures, however, do not accept this foolish theory. The followers of Vedic wisdom are fully aware of various planets inhabited by varieties of living entities such as the demigods, the sages, the Pitas, the Gandharvas, the Pannagas, the Kinnaras, the CaraQas, the Siddhas and the Apsarii.s. The Vedas give information that in all planets-not only within this material sky but also in the spiritual sky-there are varieties of living entities. Although all these living entities are of one spiritual nature, in quality the same as the Supreme Personality of Godhead, they have varieties of bodies due to the embodiment of the spirit soul by the eight material elements, namely, earth, water, fire, air, sky, mind, intelligence and false ego. In the spiritual world, however, there is no such distinction between the body and the embodied. In the material world, distinctive features are manifested in different types of bodies in the various planets. We have full information from the Vedic literature that in each and every planet, both material and spiritual, there are living entities of varied intelligence. The earth is one of the planets of the Bhurloka planetary system. There are six planetary systems above Bhurloka and seven planetary systems below it. Therefore the entire universe is known as caturdasa-bhuvana, indicating that it has fourteen different planetary systems. Beyond the planetary systems in the material sky, there is another sky, which is known as paravyoma, or the

Texts 35-36] Lord Vi�Qu's Appearance in the Sacrificial Arena 813

spiritual sky, where there are spiritual planets. The inhabitants of those planets engage in varieties of loving service unto the Supreme Personality of Godhead, which include different rasas or relationships known as diisyarasa, sakhya-rasa, viitsalya-rasa, miidhurya-rasa and, above all, parakiyarasa. This parakiya-rasa, or paramour love, is prevalent in Kr�f.laloka, where Lord Kr�t:ta lives. This planet is also called Goloka Vrndavana, and although Lord Kr�t:ta lives there perpetually, He also expands Himself in millions and trillions of forms. In one of such forms He appears on this material planet in a particular placeknown as Vrndavana-dhama, where He displays His original pastimes of Goloka Vrndavana-dhama in the spiritual sky in order to attract the conditioned souls back home, back to Godhead.

TEXT 37 fliiCCiwtN�: �)

bhagaviin api riijarfle[l sopiidhyiiyasya ciicyuta[l harann iva mano 'muflya sva-dhiima pratyapadyata

bhagaviin-the Supreme Personality of Godhead; api-also; riija-rfle{l-of the saintly King; sa-upiidhyiiyasya-along with all the priests; ca-also; acyuta[l-the infallible Lord; haran-captivating; iva-indeed; manatt-the mind; amu§ya-of him; sva-dhiima-to His abode;pratyapadyata-returned.

TRANSLATION

The infallible Supreme Personality of Godhead, having captivated the minds of the King and the priests who were present, returned to His abode in the spiritual sky.

PURPORT

Because the Supreme Personality of Godhead is all-spiritual, He can descend from the spiritual sky without changing His body, and thus He is known as acyuta, or infallible. When a living entity falls down to the material world, however, he has to accept a material body, and therefore, in his material embodiment, he cannot be called acyuta. Because he falls down from his real engagement in the service of the Lord, the living

814 Srimad-Bhagavatam [Canto 4, Ch. 20
I � ...tl� � SRqqQ<tll�\911
qiQtPt� �:

entity gets a material body to suffer or try to enjoy in the miserable material conditions of life. Therefore the fallen living entity is cyuta, whereas the Lord is called acyuta. The Lord was attractive for everyone-not only the King but also the priestly order, who were very much addicted to the performance of Vedic rituals. Because the Lord is all-attractive, He is called Kf�J}.a, or "one who attracts everyone." As will be explained in the next verse, the Lord appeared in the sacrificial arena of Maharaja Prthu as K�irodakasayi Vigm, who is a plenary expansion of Lord Kr�J].a. He is the second incarnationfrom Karar:1.0dakasayi Vigm, who is the origin of material creation and who expands as Garbhodakasayi Vi�QU, who then enters into each and every universe. K�irodakasayi Vi�QU is one of the puru�as whocontrol thematerialmodes ofnature.

TEXT 38

awttw4 :rt'4\tfl4 ert:

3totl'ffiP4 :;:r

adrfl.tiiya namas-krtya

nrpa� sandarsitiitmane avyaktiiya ca deviiniirh deviiya sva-purarh yayau

1

adrfl .tiiya-unto onewho isbeyond the purviewofmaterial vision; nama�krtya-offering obeisances; nrpa�-theKing; sandarsita-revealed; iitmaneunto the Supreme Soul; avyaktiiya-who is beyond the manifestation of the material world; ca-also; deviiniim-of the demigods; deviiya-unto the Supreme Lord;sva-puram-to his own house; yayau-returned.

TRANSLATION

King Prthu then offered his respectful obeisances unto the Supreme Personality of Godhead, who is the Supreme Lord of all demigods. Although not an object of material vision, the Lordrevealed Himself to the sight of Maharaja Prthu. After offering obeisances to the Lord, the King returnedto hishome.

PURPORT

The Supreme Lord is not visible tomaterial eyes, but when the material senses are inclined to the transcendental loving service of the Lord andare

Text 38] Lord Vi�J].U's Appearance in the Sacrificial Arena 815
(i;:((f{ttti€¥4'Z:l
� � �t�������

thus purified, the Lord reveals Himself to the VISIOn of the devotee. Avyakta means "unmanifested." Although the material world is thecreation of the- Supreme Personality of Godhead, He is unmanifested to material eyes. Maharaja Prthu, however, developed spiritual eyes by his pure devotional service. Here, therefore, the Lord is described as sandarsitiitma, for He reveals Himself to the vision of the devotee, although He is not visible to ordinaryeyes.

Thus end the Bhaktivedanta purports of the Fourth Canto, Twentieth Chapter, of the Srimad-Bhagavatam, entitled "Lord Vi§[tU 's Appearance in the Sacrificial Arena of Maharaja Prthu."

816 Srimad-Bhagavatam [Canto 4, Ch. 20 ;

CHAPTER TWENTY- ONE

Instructions bV Maharaja Prthu

TEXT I

maitreya uvaca mauktikai{l. kusuma-sragbhir dukulai{l. svan;w-tora[lail) mahii-surabhibhir dhiipair ma[l�itam tatra tatra vai

maitreyal) uvaca- the great sage Maitreya continued to speak; mauktika*- with pearls; kusuma-of flowers;sragbhi�-with garlands; dukiilai�cloth; svar[la-golden; tora[lail)-by gates; maha-surabhibhi{l. -highly perfumed; dhiipai{l. -by incense; ma[l�itam-decorated; tatra tatra- here and there; vai- certainly.

TRANSLATION

The great sage Maitreya told Vidura: When the King entered his city, it was very beautifully decorated to receive him with pearls, flower garlands, beautiful cloth and golden gates, and the entire city was perfumed with highly fragrant incense.

PURPORT

Real opulence is supplied by natural gifts such as gold, silver, pearls, valuable stones, fresh flowers, trees and silken cloth. Thus the Vedic civilization recommends opulence and decoration with these natural gifts of the Supreme Personality of Godhead. Such opulence immediately

��� iJ<t'T'f �:�:��:1 'f���fori
� � � II � II
817

changes the condition of the mind, and the entire atmosphere becomes spiritualized. King Prthu's capital was decorated with such highly opulent decorations.

TEXT2

I II

�II

candanaguru-toyiirdrarathya-catvara-margavat pu§pak§ata-phalais tokmair liijair arcirbhir arcitam

candana-sandalwood; aguru-a kind of fragrant herb; toya-the water of; iirdra-sprinkled with; rathya-a path for driving a chariot; catvarasmall parks; margavat-lanes; pu�pa-flowers; ak�ata-unbroken; phalail)by the fruits; tokmai�-minerals; liija*-wetted grains-; arcirbh*-by lamps; arcitam-decorated.

TRANSLATION

Fragrant water distilled from sandalwood and aguru herb was sprinkled everywhere on the lanes, roads and small parks throughout the city, and everywhere were decorations of unbroken fruits, flowers, wetted grains, varied minerals, and lamps, all presented as auspicious paraphernalia.

savrnda* kadali-stambhai� puga-pota* pari§krtam taru-pallava-maliibhil) sarvata[l samalankrtam

sa-vrndaifl-along with fruits and flowers; kadau-stambhaifl-by the pillars of banana trees; piiga-potail)-by collections of young animals and by processions of elephants; pa�krtam-very nicely cleansed; tamyoung plants;pallava-new leaves of mango trees; maliibhifl-by garlands; sarva tafl-everywhere ; samalankrtam-nicely decorated.

818 Srimad-Bhagavatam [Canto 4, Ch. 21

TRANSLATION

At the street crossings there were bunches of fruits and flowers, as well as pillars of banana trees and betel nut branches. All these combined decorations everywhere looked very attractive.

TEXT 4

prajas tarh dipa-balibhi� sambhrtase§a-mangalai�

abhiyur mnta-kanyas ca mnta-kur!fala-maru)ita�

praja�-citizens; tam-to him; dipa-balibh*-with lamps; sambhrtaequipped with; ase§a-unlimited; mangala*-auspicious articles; abhiyu�cameforward to welcome; mnta-with beautiful bodily luster; kanya� caand unmarried girls; mnta - colliding with; kur!fala-earrings; mar!fita�being bedecked with.

TRANSLATION

As the King entered the gate of the city, all the citizens received him with manyauspicious articles like lamps,flowers and yogurt. The King was also received by many beautiful unmarried girls whose bodies were bedecked with various ornaments, especially with earrings which collided with one another.

PURPORT

Offerings of natural products such as betel nuts, bananas, newly grown wheat, paddy, yogurt and vermillion, carried by the citizens and scattered throughout the city, are all auspicious paraphernalia, according to Vedic civilization, for receiving a prominent guest like a bridegroom, king or spiritual master. Similarly, a welcome offered by unmarried girls who are internally and externally clean and are dressed in nice garments and ornaments is also auspicious. Kumiiri, or unmarried girls untouched by the hand of any member of the opposite sex, are auspicious members of society. Even today in Hindu society the most conservative families do not allow unmarried girls to go out freely or mix with boys. They are very carefully protected by their parents while unmarried; after marriage they areprotected by theiryounghusbands,and whenelderly they are protected

Text 4) Instructions
819
by Maharaja J>rthu
� �t�ll: �ijl�tt+tw�: I 3l��l� lif!t��qf�: II \lll

by their children. When thus protected, women as a class remain an always auspicious source of energy to man.

TEXTS

���fllq1�1Jf �l� :qff�1� I

fel�� +rer.:i ·eft�: �4+tl�l if({��: II � II

sankha-dundubhi-gho§erza brahma-gho§erza cartvijam vivesa bhavanarh vira[t stuyamano gatasmaya[t

sankha-conchshells;dundubhi-kettledrums;gho§e(la-by the sound of; brahma-Vedic;gho�e(la-chanting;ca-also;_rtvijiim-of the priests;vivesaentered; bhavanam-the palace; vira[t-the King; stuyamana�-being worshiped;gata-smaya[t- without pride.

TRANSLATION

When the King entered the palace, conchshells and kettledrums were sounded, priests chanted Vedic mantras, and professional reciters offered different prayers. But in spite of all this ceremony to welcome him, the King was not the least bit affected.

PURPORT

The reception given to the King was full of opulence, yet he did not become proud. It is said, therefore, that great personalities of power and opulence neverbecome proud,and the example is giventhat a treewhich is full of fruits and flowers does not stand erect in pride but instead bends downwards to show submissiveness. This is a sign of the wonderful character of great personalities.

TEXT6

��Q: \iii�+trn � (l;r �1�: I

q''h:m�ka� sfrn: fSrl;_r�: II� II

pujita[t pujayamasa tatra tatra maha-yasa[t pauraii janapadarhs tarhs tan prita[t priyavara-prada[t

820 Srimad-Bhagavatam [Canto 4, Ch. 21

pujita�-beingworshiped;pujayamasa-offered worship;tatra tatra-here and there;maha-yasa�-with a background of great activities;pauran-the noble men of the city;jana-padan-common citizens; tan tan-in that way; prita�-being satisfied; priya-vara-pradaJ:t-was ready to offer them all benediction.

TRANSLATION

Both the important citizens and the common citizens welcomed the Kingvery heartily, and he also benedicted them with their desired blessings.

PURPORT

A responsible king was always approachable by his citizens. Generally the citizens, great and common, all had an aspiration to ee the king and take benediction from him. The king knew this, and therefore when· ever he met the citizens he immediately fulfilled their desires or mitigated their grievances. In such dealings, a responsible monarchy is better than a so-called democratic government in which no one is responsible to mitigate the grievances of the citizens, who are unable to personally meet the supreme executive head. In a responsible monarchy the citizens had no grievances against the government, and even if they did, they could approach the king directly for immediate satisfaction.

�tfur

�H:n�RilU� ;;ro:

�1ihi Wfl��t q� q�� II � II

sa evam adi'ny anavadya-ce§titalt karmaf!i bhuyarhsi mahan mahattamalz.

kurvan sasasavani-mart{lalarh yasa{l sphi'tarh nidhayaruruhe pararh padam

sal;t-King Prthu;evam-thus;iidi"ni-from the very beginning;anavadyamagnanimous; ce§tita�-performing various works; karmaf!i-work; bhiiyiirhsi-repeatedly; mahan-great; mahattamaJ:t-greater than the greatest; kurvan-performing; sasiisa-ruled; avani-maf!{lalam-the surface of the earth;yasaft-reputation;sphitam-widespread;nidhaya-achieving;iiruruhe -was elevated; param padam-to the lotus feet of the Supreme Lord.

Text7] Instructions by Maharaja Pp:hu 821
TEXT7 ij' ���tRf!ij:
��if«
�{1��: 1 ���

King J>tthu was greater than the greatest soul and was therefore worshipable by everyone. He performed many glorious activities in ruling over the surface of the world and was always magnanimous. After achieving such great success and a reputation which spread throughout the universe, he at last obtained the lotus feet of the Supreme Personality of Godhead.

PURPORT

A responsible king or chief executive has many responsible duties to attend to in ruling over the citizens. The most important duty of the monarch or the government is to perform various sacrifices as enjoined in the Vedic literatures. The next duty of the king is to see that every citizen executesthe prescribed duties for his particular community. It is the king's duty to see that everyone perfectly executes the duties prescribed for the var(la and iisrama divisions of society. Besides that, as exemplified by King P�thu, he must develop the earth for the greatest possible production of food grains.

There are different types of great personalities-some are positive great personalities, some comparative and some superlative-but King Prthu exceeded all of them. He is therefore described here as mahattama�, "greater than the greatest." Maharaja P�thu was a k�atriya, and he discharged his k�atriya duties perfectly. Similarly, briihma(laS, vaisyas and sudras can discharge their respective duties perfectly and thus at the ultimate end of life be promoted to the transcendental world, which is called pararh padam. Pararh padam, or the Vaikut;�tha planets, can be achieved only by devotional service. The impersonal Brahman region is also called pararh padam, but unless one is attached to the Personality of Godhead one must again fall down to the material world from the impersonal pararh padam situation.It is said,therefore, iiruhya krcchreQ.a pararh padarh tata�: the impersonalists endeavor very strenuously to achieve the pararh padam or impersonal brahmajyoti, but unfortunately, being bereft of a relationship with the Supreme Personality of Godhead, they come down again to the material world. If one flies in outer space, he can go very high up, but unless he reaches a planet he must come down again to earth. Similarly, because the impersonalists who reach the pararh padam of the impersonal brahmajyoti do not enter into the Vaikut;�tha planets, they come down again to this material world and are given shelter in one of the material planets. Although they may attain Brahmaloka or Satyaloka, all such planets are situated in the material world.

822 Srimad-Bhagavatam [Canto 4, Ch. 21
TRANSLATION

TEXTS

gormd�J�CR����f;mt ij�

<:' tad adi-rajasya yaso vijrmbhitarh

siita uvaca

guT}air ase�air gw:wvat-sabhiijitam k§atta mahiibhagavata� sadaspate kau§iiravirh priiha grTJantam arcayan

suta� uviica- Su ta Gosvami said; tat-that; iidi-riijasya-of the original king; yasa�-reputation; vijrmbhitam- highly qualified; g u T}ai�-by qualities; ase�a*-unlimited; guT}avat-fittingly; sabhiijitam-being praised; k�attii-Vidura; mahii-bhiigavata�-the great saintly devotee; sadaspateleader of the great sages; kau�iiravim-unto Maitreya; priiha-said; g[T}antam-while talking; arcayan-offering all respectful obeisances.

TRANSLATION

Suta Gosvami continued: 0 Saunaka, leader of the great sages, after hearing Maitreya speak about the various activities of King Prthu, the original King, who was fully qualified, glorified and widely praised all over the world, Vidura, the great devotee, very submissively worshiped Maitreya J.t�i and asked him the following question.

TEXT9

msf�: 'l��i\:f�'f���: I

f� ij"aliiJl���)iO@l��� iff�II�II

vidura uviica so 'bhi§ikta� prthur viprair labdhiise§a-suriirha[!a�

bibhrat sa vai§!wvarh tejo biihvor yiibhyarh dudoha gam

Text 9]
Instructions
�n� �r��� ttm
823
�f�rf

viduraJ:l, uvaca-Vidura said; sa�- he (King Prthu); abhi�ikta�-when enthroned;prthu�-King Prthu; vipra* -bythe great sages and brahmap.as; labdha-achieved; ase�a-innumerable; sura-arha(la� - presentations by the demigods; bibh rat- expanding ; sa�-he; vai�p.avam- who has received through Lord Vi�1�u; teja�- strength ; biihvo�- arms; yabhyiim-by which; dudoha- exploited ; giim-the earth.

TRANSLATION

Vidura said: My dear brahmar,ta Maitreya, it is very enlightening to understand that King Prthu was enthroned by the great sages and brahmar,tas. All the demigods presented him with innumerable gifts, and he also expanded his influence upon personally receiving strength from Lord Vi�r,tu. Thus he greatly developed the earth.

PURPORT

Because Prthu Maharaja was an empowered incarnation of Lord Vigm and was naturally a great Vai�r,tava devotee of the Lord, all the demigods were pleased with him and presented different gifts to help him in exercising his royal power, and the great sages and saintly personsalso joined in his coronation. Thus blessed by them, he ruled over the earth and exploited its resources for the greatest satisfaction of the people in general. This has already been explained in the previous chapters regarding the activities of King Prthu. As will be apparent from the next verse, every executive head of state should follow in the footsteps of Maharaja Prthu in ruling over his kingdom. Regardless of whether the chief executive is a king or president, or whether the government is monarchical or democratic, this processis so perfect that if itisfollowed, everyone will become happy, and thusit will be very easy for all toexecute devotional service to the Supreme PersonalityofGodhead.

824 Srimad-Bhagavatam [Canto 4, Ch. 21
10 � � �"tfij ;r �� q�q)��n it�: ��· iJ�m� �Jmtfq � � � ��II� oil ko nv asya kirtirh na srrwty abhijno yad-vikramocchi§tam ase§abhupafl,
TEXT

loka� sapala upajivanti kiimam

adyapi tan me vada karma suddham

ka�-who; nu- but; asya-King Prthu; kirtim-glorious activities; na srrwti-does not hear; abhijiia�-intelligent ; yat-his; vikrama- chivalry; ucchi�tam- remnants; ase�a-innumerable; bhii.pii�-kings; Zokii�-planets; sa-piilii� - with their demigods; upafivanti-execute livelihood; kiimamdesired objects; adyiipi- up to that; tat-that; me-unto me; vada-please speak; karma-activities; suddham-auspicious.

TRANSLATION

Prthu Maharaja was so great in his activities and magnanimous in his method of ruling that all the kings and demigods on thevarious planets still follow in his footsteps. Who is there who will not try to hear about his glorious activities? I wish to hear more and more about Prthu Maharaja because his activities are so pious and auspicious.

PURPORT

Saint Vidura's purpose in hearing about Prthu Maharaja over and over again was to set an example for ordinary kings and executive heads, who should all be inclined to hear repeatedly about Prthu Maharaja's activities inorder toalsobeableto ruleovertheir kingdomsor states veryfaithfully for the peace and prosperity of the people in general. Unfortunately, at the present moment no one cares to hear about Prthu Maharaja or to follow in hisfootsteps;thereforenonationintheworldiseitherhappy or progressive in spiritual understanding, although that is the sole aim and objectiveofhumanlife.

TEXT11

�?,q i3<ffif

maitreya uvaca

garigii-yamunayor nadyor

antarii ksetram avasan

arabdhan e� bubhuje

bhogan pur]ya-jihiisaya

Text11] fustructionsbyMaharajaPp:hu 825
4ifi·itfij'1qy�QI��U�'I+U�e� I �;r��� �Ill'{�M{Iettl II��II

maitreya� uvaca-the greatsaintMaitreya said; ganga-the River Ganges; yamunayo�-of the River Yamuna; nadyo�-of the two rivers; antarahetween; k�etram-the land; iivasan-living there; iirabdhan-destined; evalike; bubhuje-enjoyed; bhogan-fortunes; pu(lya-pious activities; jihasaya-forthe purpose of diminishing.

TRANSLATION

The great saintly sage Maitreya told Vidura: My dear Vidura, King J»rthu lived in the tract of land between the two great rivers Ganges and Yamuna. Because he was very opulent, it appeared that he was enjoying his destined fortune in order to diminish the results of his past pious activities.

PURPORT

The terms "pious" and "impious" are applicable only in reference to the activitiesof an ordinary living being. ButMaharaja Prthu was a directly empowered incarnation of Lord Vi�I).U; therefore he was not subject to the reactions of pious or impious activities. As we have already explained previously, when a living being is specifically empoweredby the Supreme Lord to act for a particular purpose, he is called a saktyavesa-avatara. PrthuMaharaja wasnot only a saktyave5a-avatara hut also a great devotee. A devotee is not subjected to the reactions resulting from past deeds. In the Brahma-samhita it is said, karmari nirdahati kintu ca bhakti-bhajam: for devotees the results of past pious and impious activities are nullified by the Supreme Personality of Godhead. The words arabdhan eva mean "as if achievedby past deeds," hutin the case of PrthuMaharaja there was no question of reaction to past deeds, and thus the word eva is used here toindicate comparisonto ordinarypersons.In Bhagavad-gfta the Lordsays, avajananti mam miit)ha!J. This means thatsometimes people misunderstand an incarnation of the Supreme Personality of Godhead to he an ordinary man. The Supreme Godhead, His incarnations or His devotees may pose themselves as ordinary men, but they are never to he consideredassuch. Nor should an ordinary man not supported by authorized statements of the sastras and acaryas he accepted as an incarnation or devotee. By the evidence of sastra, Sanatana Gosvamidetected Lord CaitanyaMahaprahhu to he a direct incarnation of Kr�l).a, the Supreme Personality of Godhead, although Lord Caitanya never disclosed the fact. It is therefore generally recommended that the acarya or guru should not he accepted as an ordinary man.

826 Srimad-Bhagavatam [Canto 4, Ch. 21

TEXT 12 ���m.qf��: 6llifN� I ...

3fw:tl� ifliR�����<n II��II

sarvatriiskhalitiidesa�

sapta-dvipaika-da[tpadhrk anyatra briihma[ta-kuliid anyatriicyuta-gotrata�

sarvatra-everywhere; askhalita-irrevocable; iidesa�-order; sapta-dvipaseven islands; eka-one; dart!la-dhrk-the ruler who holds the scepter; anyatra- except ; briihmarta-kuliit-briihmartas and saintly persons; anyatraexcept; acyuta-gotrata� -descendants of the Supreme Personality of Godhead (Vai�l).avas).

TRANSLATION

Maharaja Prthu was an unrivalled king and possessed the scepter for ruling all the seven islands on the surface of the globe. No one could disobey his irrevocable orders but the saintly persons, the brahmal).as and the descendants of the Supreme Personality of Godhead [the Vai!!l).avas) .

PURPORT

Sapta-dv"ipa refers to the seven great islands or continents on the surface of the globe: (l) Asia,(2) Europe, (3) Africa, (4) North America,(5) South America, (6) Australia, and (7) Oceania. In the modern age people are under the impression that during the Vedic period or the prehistoric ages America and many other parts of the world had not been discovered, but that is not a fact. Prthu Maharaja ruled over the world many thousands of years before the so-called prehistoric age, and it is clearly mentioned here that in those days not onlywere all thedifferent parts of the world known, but they were ruled by one king, Maharaja Prthu. The country where Prthu Maharaja resided must have been India because it is stated in the eleventh verse of this chapter that he lived in the tract of land called Brahmiivarta, which consists of what is known in the modern age as portions of Punjab and northern India. It is clear that the kings of India once ruled all the world and that their culture was Vedic.

Text 12]
Instructions
827

The word askhalita indicates that orders by the king could not be disobeyed by anyone in the entire world. Such orders, however, were never issued to control saintly persons or the descendants of the Supreme Personality of Godhead,Vi�l)U. The Supreme Lord is known as acyuta, and Lord Kt�l}a is addressed as such by Arjuna in Bhagavad-gztii (senayor ubhayor madhye ratham sthiipaya me 'cyuta). Acyuta refers to one who does not fall because -He is never influenced by the modes of material nature. When a living entity falls down to the material world from his original position, he becomes cyuta, which means that he forgets his relationship with acyuta. Actually every living entity is a part and parcel or a son of the Supreme Personality of Godhead. When influenced by the modes ofmaterial nature,a living entity forgets this relationship and thinks in terms of different species of life; but when he again comes to his original consciousness, he does not observe such bodily designations. This is indicated in Bhagavad-gztii by the words par-{iitiil;t sama-darsinal;t (Bg. 5.18).

Material designations create differentiation in terms of caste, color, creed, nationality, etc. Different gotras or family designations are distinctions in terms of the material body, but when one comes to Kr�J;la consciousness he immediately becomes transcendental to all considerations of caste, creed, color and nationality.

Prthu Maharaja had no control over the briihmar-a-kula, which refers to the learned scholars in Vedic knowledge, nor over the Vai�l)avas, who are above the considerations of Vedic knowledge. It is therefore said:

arcye vi§[WU siladhir guru§u nara-matir vai§r-ave jiiti-buddhir

vi�1Jor vii vaiHwviiniim kali-mala-mathane pada-tirthe 'mbu-buddhi{t

sn-vi�r-or niimni mantre sakala-kalu�a-he sabda-siimiinya-buddhir

V�TJU U sarvesvarese tad-itara-sama-dhtr yasya Vii niirakt sal;t

"One who thinks the Deity in the temple to be made of wood or stone, who thinks of the spiritualmaster in the disciplic succession as an ordinary man, who thinks the Vai�l)ava in the acyuta-gotra to belong to a certain caste or creed, or who thinks of carar-iimrta or Ganges water as ordinary water, is taken to be a resident of hell." (Padma

From the facts presented in this verse, it appears that people in general should be controlled by a king until they come to the platform of Vai�l)avas and briihmar-as, who are not under the control of anyone. Briihmarta refers to one who knows Brahman, or the impersonal feature of the Absolute Truth, and a Vai�l)ava is one who serves the Supreme Personality of Godhead.

828 Srimad-Bhagavatam [Canto 4, Ch. 21

�� i4t��tffarr � m�1ffalt � �+I IIZ�II

ekadiisin mahiisatradik.sii tatra divaukasiim samiijo brahmar�"irtiirh ca riijar�"irtiirh ca sattama

ekadii-once upon a time; iis"it-took a vow; mahii-satra-great sacrifice; dik�ii-initiation; tatra-in that function; divaukasiim-of the demigods; samiija�-assembly; brahmar�"ir-iim-of great saintly briihmaras; ca-also; riijar�"if!iim-of great saintly kings; ca-also; sattama-the greatest of devotees.

TRANSLATION

Once upon a time King Prthu Maharaja initiated the performance of a very great sacrifice in which great saintly sages, brahmru:tas, demigods from higher planetary systems and great saintly kings known as rajarf?is all assembled together.

PURPORT

In this verse the most significant point is that although King Prthu's residential quarters were in India, between the rivers Ganges and Yamuna, the demigods also participated in the great sacrifice he performed. This indicates that formerly the demigods used to come to this planet. Similarly, great personalities like Arjuna, Yudhi�thira and many others used to visit higher planetary systems. Thus there was interplanetary communication via suitable airplanes and space vehicles.

tasminn arhatsu sarvefiu sv-arcite.su yathiirhata{t utthita{t sadaso madhye tiiriiriim upuriip iva

Text 14]
Instructions
TEXT 13 �ssmr�tij;ra:Ten � Rilitiel'( 1
829
��!! ��
1 �:
ijl(iii11Uiffl«IIZ\111
TEXT ::.4 ��?l�<:ij
m:
� +l\if

tasmin-inthatgreat meeting; arhatsu-of all those who are worshipable; sarve� u-all of them; su-ar cite�u-being worshiped according to their respective positions; yathiirhata�-as they deserved; utthita�-stood up; sadasa�-amongst the assembly members; madhye-within the midst; tiiriirtiim-of the stars; u�u-riit-the moon; iva-like.

TRANSLATION

In that great assembly, Maharaja Prthu first of all worshiped all the respectable visitors according to their respective positions. After this, he stood up in the midst of the assembly, and it appeared that the full moon had arisen amongst the stars.

PURPORT

According to the Vedic system, the reception of great, exalted personalities, as arranged by Prthu Maharaja in that great sacrificial arena, is very important. The first procedure in receiving guests is to wash their feet, and it is learned from Vedic literature that one time when Maharaja Yudhi��hira performed a riijasuya-yaj iia, Kr�1.1a look charge of washing the feet of the visitors. Similarly, Maharaja Prthu also arranged for the proper reception of the demigods, the saintly sages, the briihmartas and the great kings.

TEXT 15

�: q'hnlfij��it ill�: tfi�Ri�aJor: 1

ijon�: ffi!�: ij'f�: qy;ri«:ijf�f�ij!ll ��II

prarhsu[! pl:nayata-bhujo

gauraft kanjiirur-ek�arwft

sunasaft sumukhaft saumyaft

pTnarhsaft su-dvija-smitaft

priirhs'u�-very tall; pTniiyata-full and broad; bhujaft-arms; gauraftfair complexioned; kanja-lotuslike; arurta-Tk�aiJa�-with bright eyes like a morning sunrise; su-nasa[t-straight nose; su-mu khaft-with a beautiful face; saumya�-of a grave bodily stature; pTna-arhsa�-shoulders raised; subeautiful;dvija-teeth; smita�-smiling.

TRANSLATION

King Pl;thu's body was tall and sturdy, and his complexion was fair. His arms were full and broad and his eyes as bright as the rising sun. His nose

830 Srimad-Bhagavatam [Canto 4, Ch. 21

was straight, his face very beautiful and his personality grave. His teeth were set beautifully in his smiling face.

PURPORT

Amongst the four social orders (briihmatJaS, k§atriyas, vaisyas and sudras), the k§atriyas, both men and women, are generally very beautiful. As will be apparent from the following verses, it is to be concluded that not only were Maharaja Prthu's bodily features attractive, as described here, but he had specific all-auspicious signs in his bodily construction.

As it is said, "The face is the index of the mind." One's mental constitution is exhibited by his facial features. The bodily features of a particular person are exhibited in accordance with his past deeds, for according to one's past deeds, his next bodily features-whether in human society, animal society or demigod society-are determined. This is proof of the transmigration of the soul through different types of bodies.

TEXT 16

vyu!lha-vakfiii brhac-chro[tir vali-valgu-dalodara� iivarta-niibhir ojasv"i kiiiicanorur udagra-piit

vyu!iha- broad ; vakfia� - chest; brhat-sro[t* - thick waist; vali-wrinkles; valgu- very beautiful; dala-like a leaf of a banyan tree; udara{l. - abdomen; iivarta-coiled ; niibh* -navel ; ojasvi-lustrous ; kiincana- golden; uru{l.thighs; udagra-piit- arched instep.

TRANSLATION

The chest of Maharaja Prthu was very broad, his waist was very thick, and his abdomen, wrinkled by lines of skin, resembled in construction a banyan tree. His navel was coiled and deep, his thighs were of a golden hue, and his instep was arched.

TEXT 17

Text 17] Instructions
831
by Maharaja Prthu
o�� . �f0Te1f���: I 3lf.Hiwttf�� ��;fl�W�TI{_II� G.II
���lft.Hrf���;:r: ���:I � ��� '{R�Tittftft� � II�\SII

Srimad-Bhagavatam

suk�ma-vakrasita-snigdha­

murdhajafi, kambu-kandharaft maha-dhane dukuliigrye paridhayopavzya ca

suk�ma- very fine; vakra- curly; asita-black; snigdha-greasy; miirdhaja�-hairs on the head; kambu-like a conch; kandhara�- neck; mahiidhane-very valuable; dukula-agrye -dressed with a dhoti; paridhiiya-on the upper portion of the body; upav"iya-placed like a sacred thread; ca-also.

TRANSLATION

The black, slick hair on his head was very fine and curly, and his neck, like a conchshell, was decorated with auspicious lines. He wore a very valuable dhoti, and there was a nice wrapper on the upper part of his body.

TEXT 18

vyaiijitase�a-gatra-ftir niyame nyasta-bhu�ar-aft kr�r-ajina-dharaft srzman kusa-par-ift krtocitafi, vyaiijita-indicating; ase�a-innumerable; giitra-bodily; sri'/;1-beauty; niyame-regulated; nyasta-given up; bhii§a(lafi,-garments; k[§(la- blac k; ajina-skin; dharalt-putting on; stiman- beautiful; kusa-paf!ilt-having kusa grass on the fingers; krta-performed; ucitaft-as it is required.

TRANSLATION

As Maharaja �thu was being initiated to perform the sacrifice, he had to leave aside his valuable dress, and therefore his natural bodily beauty was visible. It was very pleasing to see him put on a black deerskin and wear a ring of kusa grass on his finger, for this increased the natural beauty of his body. It appears that Maharaja Prthu observed all the regulative principles before he performed the sacrifice.

TEXT 19

832
[Canto 4, Ch. 21
�ffi�'l•ll=st�'lf.itfir ���tJH I
���'llfl1l:�:q�nll ��II
�t1Ttf$tt��:
r��rw��reJ: ij'aaJij ijlf.=(JQ: 1 ��tt�«41�u �: eriqf1acq ������

sisira-snigdha-tiiriikfiafl. samaikfiata samantata�

uciviin idam urv""isa�

sada� sarhharfiayann iva

siSira-dew; snigdha-wet; tiirii-stars; akfia�-eyes; samaikfiata-glanced over; samantata�- all around;uciviin-began to speak; idam-this; urv""isa�highly elevated; sada�-amongst the members of the assembly; sarhharfiayan -enhancing their pleasure;iva-like.

TRANSLATION

Just to encourage the members of the assembly and to enhance their pleasure, King Ptthu glanced over them with eyes that seemed like stars in a sky wet with dew. He then spoke to them in a great voice.

TEXT 20

ciiru citra-padam slakfir-am mrfitam gtipham aviklavam sarvefiiim upakiiriirtharh

tada anuvadann iva

ciiru- beautiful; citra-padam- flowery; slakfir-am- very clear; mrfitamverygreat;gupham-meaningful;aviklavam- without anydoubt;sarvefiamfor all; upakiira-artham-just to benefit them; tadii-at that time; anuvadan-began to repeat;iva-like.

TRANSLATION

Maharaja Ptthu's speech was very beautiful, full of metaphorical language, clearly understandable and very pleasing to hear. His words were all grave and certain. It appears that when he spoke, he expressed his personal realization of the Absolute Truth in order to benefit all who were present.

PURPORT

Maharaj a Prthu was beautiful in his external bodily features, and his speech was also very glorious in all respects. His words, which were nicely composed in highly metaphorical ornamental language, were pleasing to hear and were not only mellow but also very clearly understandable and without doubt or ambiguity.

Text 20]
833
��I
�� f�;J� �-of �
��'fl'lq� � 3(�t4c:J�AA ll�oll

TEXT 21 {�

�t:��q:���: I

Wij ���� �q•OA6�������

rajovaca

sabhyaft srrmta bhadrarh vafl sadhavo ya ihiigataft satsu jijiiiisubhir dharmam avedyarh sva-manz�itam

raja uvaca-the King beganto speak;sabhya[t-addressing the ladies and gentlemen; snmta-kindly hear; bhadram-good fortune; va�-your; siidhavafi--all great souls; ye-who; iha-here; iigatiift-present; satsuunto the noble men; jijnasubh*-one who is inquisitive; dharmamreligious principles; iivedyam-must he presented; sva-man"i�itam-concluded by someone.

TRANSLATION

King Prthu said: 0 gentle members of the assembly, may all good fortune be upon you! May all of you great souls who have come to attend this meeting kindly hear my prayer attentively. A person who is actually inquisitive must present his decision before an assembly of noble souls.

PURPORT

In this verse the word sadhava/;1. ("all great souls") is very significant. When a person is very great and famous, many unscrupulous persons become his enemies, for envy is the nature of materialists. In any meeting there are different classes of men, and it is to he supposed, therefore, that because Prthu Maharaja was very great, he must havehad several enemies present in the assembly, although they could not express themselves. Maharaja Prthu, however, was concerned with persons who were gentle, and therefore he first addressed all the honest persons, not caring for the envious. He did not, however, present himself as a royal authority empowered to command everyone because he wanted to present his statement in humble submission before the assembly of great sages and saintly persons. As a great king of the entire world, he could have given them orders,but he was so humble, meek and honest that he presented his statement for approval in order to clarify his mature decision. Everyone within this material world is conditioned by the modes of material nature and

834 Srimad-Bhagavatam
4, Ch. 21
[Canto

therefore has four defects. But although Prthu Maharaja was above all these, still, like an ordinary conditioned soul, he presented his statements to the great souls, sages and saintly persons present there.

TEXT 22

����T �T� �:1 oottf�: ���!I �em�,����''

aharh dar-!ia-dharo rajii prajiiniim iha yojita� rakfiita vrtti-da� SV€fiU setufiu sthiipita prthak

aham-l; dar-(ia-dhara�-carrier of the scepter; riijii-king; prajiinam-of the citizens; iha-in this world; yojita�-engaged ; rakfiita-protector; vrtti-da�-employer; svefiu-in their own; setufiu-respective social orders; sthapita-established; prthak- differently.

TRANSLATION

King Prthu continued: By the grace of the Supreme Lord I have been appointed the King of this planet, and I carry the scepter to rule the citizens, protect them from all danger and give them employment according to their respective positions in the social order established by Vedic injunction.

PURPORT

A king is supposed to be appointed by the Supreme Personality of Godhead to look after the interests of his particular planet. On every planet there is a predominating person, just as we now see that in every co.untry there is a president. If one is president or king, it should be understood that this opportunity has been given to him by the Supreme Lord. According to theVedic system, the king is considered a representative of Godhead and is offered respects by the citizens as God in the human form of life. Actually, according to Vedic information, the Supreme Lord maintains all living entities, and especially human beings, to elevate them to the highest perfection. After many, many births in lower species, when a living entity evolves to the human form of life and in particular to the civilized human form of life, his society must be divided into four gradations, as ordered by the Supreme Personality of Godhead in Bhagavad-gita (ciitur-varrtyam maya sr�tam, etc.). The four social orders-the brahma!las, kfiatriyas, vaisyas and sudras-are natural divisions of human society, and, as declared

Text 22) Instructions
835
by Maharaja Prthu

by

Maharaja, every man in his respective social order must have proper employment for his livelihood. It is the duty of the king or the government toinsure that the people observe the social order and that they are also employed in their respective occupational duties. In modern times, since the protection of the government or the king has been withdrawn, social order has practically collapsed. No . one knows who is a briihma!La, who is a k�atriya, who is a vaisya or who is a sudra, and people claim to belong to a particular social order by birthright only. It is the duty of the government to reestablish social order in terms of occupational duties and the modes of material nature, for that will make the entire world population actually civilized. If it does not observe the institutional functions of the four social orders, human society is no better than animal society in which there is never tranquility, peace and prosperity but only chaos and confusion. Maharaja Prthu, as an ideal king, strictly observed the maintenance of the Vedic social order.

Prajiiyate iti prafo.. The word prafo. refers to one who takes birth. Therefore Prthu Maharaja guaranteed protection for prajiiniim-all living en�ities who took birth in his kingdom. Prajii refers not only to human beings but also to animals, trees and every other living entity. It is the duty of the king to give all living entities protection and food. The fools and rascals of modern society have no knowledge of the extent of the responsibility of the government. Animals are also citizens of the land in which they happen to be born, and they also have the right to continue their existence at the cost of the Supreme Lord. The disturbance of the animal population by wholesale slaughter produces a catastrophic futurereaction for the butcher, his land and his government.

TEXT 23

ij� if

�n �?!: �J{(l�l$:1tl���II�� II ....

tasya me tad-anu�thaniid

yan ahur brahma-vadinah

lokii[l syu[l kiima-sandohii

yasya tu�yati di�ta-drk

tasya - his; me -mine ; tat-that; anu�thiinat- by executing; yiin-that which; iihu�-is spoken; brahma-viidina�-by the experts in Vedic knowledge; loka�- planets ; syu� - become; kiima-sandohii�- fulfilling one's desirable objectives; yasya-whose; tu�yati - becomes satisfied; di�ta-drk- the seer of all destiny. ·

836 Srimad-Bhagavatam [Canto 4, Ch. 21
��fWtltll�l�ifm;;crlt.n 1

Maharaja Prthu said: I think that upon the execution of my duties as king, I shall be able to achieve the desirable objectives described by experts in Vedic knowledge. This destination is certainly achieved by the pleasure of the Supreme Personality of Godhead, who is the seer of all destiny.

PURPORT

Maharaja Prthu gives special stress to the word brahma-viidinafi. ("by the experts in the Vedic knowledge"). Brahma refers to the Vedas, which are also known as sabda-brahma, or transcendental sound. Transcendental sound is not ordinary language, although it appears to be written in ordinary language. Evidence from the Vedic literature should be accepted as final authority. In the Vedic literature there is much information, and of course there is information about the execution of a king's duty. A responsible king who executes his appointed duty by giving proper protection to all living entities on his planet is promoted to the heavenly planetary system. This is also dependent upon the pleasure of theSupreme Lord. It is not that if one executes his duty properly he is automatically promoted, for promotion depends upon the satisfaction of the Supreme Personality of Godhead. It must ultimately be concluded that one can achieve the desired result of his activities upon satisfying the Supreme Lord. This is also confirmed in the Second Chapter, First Canto, of Srimad-Bhagavatam:

atafi. pumbhi(dvija-sre�thii van:ziisrama-vibhiigasafi. svanu�thitasya dharmasya sarhsiddhir hari-to�ar-am.

The perfection of one'sexecution of his appointedduties is the ultimate satisfaction of the Supreme Lord. The word kiima-sandohiifi. means "achievement of the desired result." Everyone desires to achieve the ultimate goal of life, but in modern civilization the great scientists think that man's life has no plan. This gross ignorance is very dangerous and makes civilization very risky. People do not know the laws of nature, which are the rulings of the Supreme Personality of Godhead. Because they are atheists of the first order, they have no faith in theexistence of God and His rulings and therefore do not know how nature is working. This gross ignorance of the mass of people, including even the so-called scientists

Text 23] Instructions by Maharaja
837
Prthu
TRANSLATION

and philosophers, makes life a risky situation in which human beings do not know whether they are making progress in life. According to Srl.madBhagavatam, they are simply progressing to the darkest region of material existence. Adanta-gobhir visatarh tamisram (Bhag. 7.5.30). The Kr�qa consciousness movement has therefore been started to give philosophers, scientists and people in general the proper knowledge about the destiny of life. Everyone should take advantage of this movement and learn the real goal of life.

TEXT 24

;;r ��� U\llT �1 ��� I sr\llRt m �+Iff����: ���'cl"

ya uddharet karam raja

praja dharme�v asik�ayan

prajanarh samalam bhunkte

bhagarh ca svarh jahati salt

ya!J,-anyone (king or governor); uddharet- exact; karam-taxes; rajaking; prajii!J,-the citizens; dharme�u-in executing their respective duties;. asik§aran -without teaching them how to execute their respective duties; prajanam-of the citizens; samalam- imp ious; bhunkte-enjoys; bhagamfortune; ca-also; svam-own; jahati- gives up; sa�-that king.

TRANSLATION

Any king who does not teach his citizens about their respective duties in terms of vaqta and asrama but who simply exacts tolls and taxes from them is liable to suffer for the impious activities which have been performed by the citizens. In addition to such degradation, the king also loses his own fortune.

PURPORT

A king, governor or president should not take the opportunity to occupy his post without also discharging his duty. He must teach the people within the state how to observe the divisions of vaqw and asrama. If a king neglects to give such instructions and is simply satisfied with levying taxes, then those who share in the collection-namely, all the government servants and the head of the state-are liable to share in the impious activities of the general masses. The laws of nature are very subtle. For example, if one eats in a place which is very sinful, he shares in the resultant reaction of the sinful activities performed there. (It is a Vedic

838 Srimad-Bhagavatam [Canto 4, Ch. 21

system, therefore, for a householder to call briihmar-as and Vai�l).avas to eat at ceremonial performances in his house because the briihmar-as and Vai�l).avas can immunize himfrom sinful activities. But it is not theduty of rigid briihmar-as and Vai�l).avas to accept invitations everywhere. There is, of course, no objection to taking part in feasts in which prasiida is distributed.) There are many subtle laws which are practically unknown to people in general, but the Kr�q.a consciousness movement is very scientifically distributing all this Vedic knowledge for the benefit of the people of the world.

TEXT 25

ij� �l �f�w�:, �m�f1:1�� ��: �: ������

tat prajii bhartr-pir-!liirtham sviirtham evanasuyava{l. kurutiidhok�aja-dhiyas tarhi me 'nugraha{l. krta{l.

tat-therefore; prajii{l.- my dear citizens; bhartr-of the master; pir!laartham-welfare after death; sva-artham-own interest; eva-certainly; an.asuyava{l.-without being envious; kuruta-just execute; adhok�aja-the Supreme Personality of Godhead; dhiya{l.- thinking of Him; tarhi-therefore; me-unto me; anugraha{l. - mercy; krta{l.-being done.

TRANSLATION

P�thu Maharaja continued: Therefore, my dear citizens, for the welfare of your king after his death, you should execute your duties properly in terms of your positions of varl).a and asrama and should always think of the Supreme Personality of Godhead within your hearts. By doing so, your interests will be protected, and you will bestow mercy upon your king for his welfare after death.

PURPORT

The words adhok�aja-dhiya{l., meaning "Kr�q.a consciousness," are very important in this verse. The king and citizens should both be Kr!?Qa conscious, otherwise both of them will be doomed to lower species of life after death. A responsible government must teach Kr�qa consciousness very vigorously for the benefit of all. Without Kr�qa consciousness,neither the state nor the citizens of the state can be responsible. Prthu Maharaja therefore specifically requested the citizens to act in Kr�qa consciousness,

Text 25] Instructions by Maharaja PJ:thu 839

and he was also very anxious to teach them how to become Kr�l)a conscious. A summary of Kr�qa consciousness is given in Bhagavad-gita:

yat karOfiiyad asnasi

yaj juhofii dadasiyat

yat tapasyasi kaunteya

tat kurufiva mad-arpar-am

"Whatever you do, whatever you eat, whatever you give in charity and whatever penances you undergo should be done in Kr�qa consciousness or for the satisfaction of the Supreme Personality of Godhead." (Bg. 9.27) If all the people of the state, including the government servants, are taught the techniques of spiritual life, then although everyone is liable to be punished in different ways by the stringent laws of material nature, they will not be implicated.

TEXT 26

� c:t�a4il�� Aa:���: I �: �ll�(®l

yuyam tad anumodadhvarh

pitr-devarfiayo 'malii� kartu� sastur anujiiatus

tulyam yat pretya tat-phalam

yuyam- all you respectable persons who are present here; tat-that; anumodadhvam-kindly approve of my proposal; pitr-persons coming from Pitrloka; deva-persons coming from the heavenly planets; rfiaya�great sages and saintly persons; ama1ii� -those who are cleansed of all sinful activities; kar t u� -the performer; sastu�-the order-giver; anujnatu�of the supporter; tulyam -equal; yat-which; pretya-after death; tatthat; phalam-result.

TRANSLATION

I request all the pure-hearted demigods, forefathers and saintly persons to support my proposal because after death the result of an action is equally shared by its doer, its director and its supporter.

PURPORT

The government of Prthu Maharaja was perfect because it was administered exactly according to the orders of the Vedic injunctions. Prthu

840 Srimad-Bhagavatam [Canto 4, Ch. 21
���tt������ll

Maharaja has alreadyexplained that the chief duty of the gove�nment is to see that everyone executes his respective duty and is elevated to the platform of Kr�qa consciousness. The government should be soconductedthat automatically one is elevated to Kr�Qa consciousness. King Prthu therefore wanted his citizens to cooperate fully with him, for if they assented, they would enjoy the same profit as him after death. If Prthu Maharaja, as a perfect king, were elevated to the heavenly planets, the citizens who cooperated by approving of his methods would also be elevated with him. Since the Kr�r1a consciousness movement which is going onat the present moment is genuine, perfect and authorized and is following in the footsteps of Prthu Maharaja, anyone who cooperates with this movement or accepts its principles will get the same result as the workers who are actively propagating Kr�qa consciousness.

TEXT 27

asti yajiiapatir na.ma keiiiiicid arha-sattamiifi, ihamutra ca lak�yante jyotsn'iivatyafi, kvacid bhuvaft

asti-there must be; yapia-pati(l -the enjoyer of all sacrifices; nama-of the name; ke�'iincit- in the opinion of some; arha-sattamii�-0 most respectable; iha-in this material world; amutra-after death; ca-also; lak�yante-it is visible; jyotsniivatya�-powerful, beautiful; kvacit-somewhere; bhu va{t - bodies .

TRANSLATION

My dear respectable ladies and gentlemen, according to the authoritative statements of sastra, there must be a supreme authority who is able to award the respective benefits of our present activities. Otherwise, why should there be persons who are unusually beautiful and powerful both in this life and in the life after death?

PURPORT

Prthu Maharaja' sole aim in ruling his kingdom was to raise the citizens to the standard of God consciousness. Since there was a great assembly in the arena of sacrifice, there were different types of men present, but he was especially interested in speaking to those who were not atheists. It has

Text 27) Instructions by Maharaja Prthu 841
��tq ����ij�+U: I
ffiRtgct: 11�\911
3tftij
�;r:q(?;��ij�tit(�l*�:

already been explained in the previous verses that Prthu Maharaja advised the citizens to become adhok§aja-dhiya�, which means God conscious or Kr�Qa conscious, and in this verse he specifically presents the authority of siistra, even though his father was a number one atheist who did not abide by the injunctions mentioned in the Vedic siistras, who practically stopped all sacrificial performances, and who so disgusted the briihmar-as that they not only dethroned him but cursed and killed him. Atheistic men do not believe in the existence of God, and thus they understand everything which is happening in our daily affairs to be due to physical arrangement and chance. Atheists believe in the atheistic Sarikhya philosophy of the combination of prakrti and puru§a. They believe only in matter and hold that matter under certain conditions of amalgamation gives rise to the living force, which then appears as puru§a, the enjoyer; then, by a combination of matter and the living force, the many varieties of material manifestation come into existence. Nor do atheists believe in the injunctions of the Vedas. According to them, all the Vedic injunctions are simply theories that have no practical application in life. Taking all this into consideration, Prthu Maharaja suggested that theistic men will solidly reject the views of the atheists on the grounds that there cannot be many varieties of existence without the plan of a superior intelligence. Atheists very vaguely explain that these varieties of existence occur simply by chance, but the theists who believe in the injunctions of the Vedas must reach all their conclusions under the direction of the Vedas.

In the Vi§rtu Purii!'-a it is said that the entire varr-iisrama institution is meant to satisfy the Supreme Personality of Godhead. The rules and regu· lations set up for the execution of the duties of briihmartas, k�atriyas, vaisyas and sudras or brahmaciir"is, grhasthas, viinaprasthas and sannyiis"is are all meant to satisfy the Supreme Lord. At the present moment, although the so-called briihma!'-as, k§atriyas, vaiSyas and sudras have lost their original culture, they claim to be briihmar-as, k§atriyas, vaisyas and sudras by birthright. yet they have rejected the proposition that such social and spiritual orders are especially meant for worship of Lord Vi�I).U. The dangerous Mayavada theory set forth by Sarikariicarya-that God is impersonal-does not tally with the injunctions of the Vedas. Sri Caitanya Mahaprabhu therefore described the Mayavadi philosophers as the greatest offenders against the Personality of Godhead. According to the Vedic system, one who does not abide by the orders of the Vedas is called a niistika, or atheist.When Lord Buddha preached his theory of nonviolence, he was obliged to deny the authority of the Vedas, and for this reason he was considered by the followers of the Vedas to be a niistika. But although

842 Srimad-Bhagavatam [Canto 4, Ch. 21

Sri Caitanya Mahaprabhu very clearly enunciated that the followers of Lord Buddha's philosophy are niistikas or atheists because of their denial of the authority of the Vedas, He considered the Sankarites, who wanted to establish Vedic authority by trickery and who actually followed the Mayavada philosophy of Buddha's school, to be more dangerous than the Buddhists themselves. The Sankarite philosophers' theory that we have to imagine a shape of God is more dangerous than denial of the existence of God. Notwithstanding all the philosophical theorizing by atheists or Mayavadis, the followers of Kr�t:la consciousness rigidly live according to the injunctions given in Bhagavad-gztii, which is accepted as the essence of all Vedic scripture. In Bhagavad-gitii it is said:

yata� pravrttir bhutiiniirh yena sarvam idarh tatam sva-karmar-ii tam abhyarcya siddhirh vindati miinava�. (Bg.l8.46)

This means that the Supreme Personality of Godhead is the original source of everything, as described in the Vediinta-sutra (janmadyasya yata�). The Lord Himself also confirms in Bhagavad-gitii, aharh sarvasya prabhavo: "I am the origin of everything." The Supreme Personality of Godhead is the original source of all emanations, and at the same time, as Paramatma, He is spread all over existence. The Absolute Truth is therefore the Supreme Personality of Godhead, and every living being is meant to satisfy the Supreme Godhead by performing his respective duty (sva-karmaru"i tam abhyarcya). Maharaja Prthu wanted to introduce this formula amongst his citizens.

The most important point in human civilization is that while one engages in different occupational duties,he must try to satisfy the Supreme Lord by the execution of such duties. That is the highest perfection of life. Svanufithitasya dharmasya sanisiddhir hari-towrwm: by discharging one's prescribed duty, one can become very successful in life if he simply satisfies the Supreme Personality of Godhead. The vivid example is Arjuna. He was a k.satriya, his duty was to fight, and by executing his prescribed dutyhe satisfied the Supreme Lord and therefore became perfect. Everyone should follow this principle. The atheists who do not are condemned in Bhagavadgitii, in the SixteenthChapter,by the following statement: tiinahani dvi�ataly, kriiran sanisare§u naradhaman (Bg. l6.19).1n thisverseit is clearly said that persons who areenviousof theSupreme Personality of Godhead are the lowest of mankind and are very mischievous. Under the regulative principles of the Supreme, such mischievous persons are thrown into the darkest region of material existence and are born of asuras or atheists. Birth after

Text 27] Instructions
843
by Maharaja Prthu

birth, such asuras go still farther down, finally to animal forms like those of tigers or similar ferocious beasts. Thus for millions of years they have to remain in darkness without knowledge of Kr�J).a.

The Supreme Personality of Godhead is known as Puru�ottama, or the best of all living entities. He is a person like all other living entities, but He is the leader or the best of all living beings. That is stated in the Vedas also. Nityo nityiiniirh cetanas cetaniiniim. He is the chief of all eternals, the chief of all living entities, and He is complete and full. He has no need to derive benefit by interfering with the affairs of other living entities, but because He is the maintainer of all, He has the right to bring them to the proper standard so that all living entities may become happy. As a father wants all of his children to become happy under his direction, similarly, God, or Kr�l).a, the Supreme Personality of Godhead, has the right to see that all living entities are happy. There is no possibility of becoming happy within this material world. The father and the sons are eternal, but if a living entity does not come to the platform of his eternal life of bliss and knowledge, there is no question of happiness. Although Puru�ottama, the best of all living entities, has no benefit to derive from the common living entities, He does have the right to discriminate between their right and wrong ways. The right way is the path of activities meant to satisfy the Supreme Personality of Godhead, as we have already discussed (svanu�{hitasya dharmasya sarhsiddhir hari-to�artam). A living entity may engage in any occupational duty, but if he wants to have perfection inhis duties, he must satisfy the Supreme Lord. As such, one who pleases Him gets better facilities for living, but one who displeases Him gets involved in undesirable situations.

It is therefore concluded that there are two kinds of duties-mundane duty and duty performed for the sake of yajita or sacrifice (yajiiiirthiit karma). Any karma or activity one performs which is not for the purpose of yajria is a cause of bondage. Yajiiiirthiit karmarto 'nyatra loko 'yam karma-bandhanaft: "Work done as a sacrifice for Vi9J;J.U has to be performed, otherwise work binds one to this material world." (Bg. 3. 9) Karma-bandhanaJ:t, or the bondage of karma, is administered under the regulations of the stringent laws of material nature. Material existence is a struggle to conquer the impediments put forth by material nature. The asuras are always fighting to overcome these impediments, and by the illusory power of material nature the foolish living entities work very hard within this material world and take this to be happiness. This is called miiyii. In that hard struggle for existence, they deny the existence of the supreme authority, Puru9ottama, the Supreme Personality of Godhead.

844 Srimad-Bhagavatam [Canto 4, Ch. 21

In order to regulate the activities of the living entities, God has given us codes, just as a king gives codes of law in a state, and whoever breaks the law is punished. Similarly, the Lord has given the infallible knowledge of the Vedas, which are not contaminated by the four defects of human life-namely, the tendency to commit mistakes, to be illusioned, to cheat and to have imperfect senses. If we do not take direction from the Vedas but act whimsically according to our own choice, we are sure to be punished by the laws of the Lord, who offers different types of bodies in the 8,400,000 species of forms. Material existence, or the sense gratification process, is conducted according to the type of body we are given by prakrti, or material nature. As such, there must be divisions of pious and impious activities (pu[tya and papa). In Bhagavad-gTtii it is clearly stated:

ye§arh tv anta-gatarh paparh jananarh pu[tya-karma[tam te dvandva-moha-nirmuktii bhajante miirh dp;lha-vratii�

"One who has completely surpassed the resultant activities of the impious path of life (this is possible only when one engages exclusively in pious activities) can understand his eternal relationship with the Supreme Personality of Godhead. Thus he engages in His transcendental loving service." (Bg. 7.28) This life of engaging always in the loving service of the Lord is called adhok�aja-dhiya�, or a life of Kr�!)a consciousness, which King Prthu meant his citizens to follow.

The different varieties of life and of material existence do not come about by chance and necessity; they are different arrangements made by the Supreme Lord in terms of the pious and impious activities of the living entities. By performing pious activities one can take birth in a good family in a good nation, one can get a beautiful body or can become very welleducated or very rich. We see, therefore, that in different places and in different planets there are different standards of life, bodily features and educational statuses, all awarded by the Supreme Personality of Godhead according to pious or impious activities. Varieties of life, therefore, do not develop by chance but by prearrangement. There is a plan, which is already outlined in the Vedic knowledge. One has to take advantage of this knowledge and mold his life in such a way that at the end, especially in the human form of life, he may go back home, back to Godhead, by practicing Kr�Da consciousness.

The theory of chance can best be explained in the Vedic literature by the words ajniita-sukrti, which refer to pious activities performed without

Text 27) Instructions by
845
Maharaja Prthu

the actor's knowledge. But these are also planned. For example, Kr�r;ta comes like an ordinary human being, He comes as a devotee like Lord Caitanya, or He sends His representative, the spiritual master or pure devotee. This is also the planned activity of the Supreme Personality of Godhead. They come to canvass and educate,and thus a person in the illusory energy of the Supreme Lord gets a chance to mix with them, talk with them, and take lessons from them, and somehow or other if a conditioned soul surrenders to such personalities and byintimate association with them chances to become Kr�l).a conscious, he is saved from the material conditions of life. Kr�r:ta therefore instructs:

sarva-dharmiin parityajya miim ekam sarar-am vraja aham tviim sarva-piipebhyo mok�ayi�yiimi mii suca�

"Abandon all varieties of religion and just surrender unto Me. I shall deliver you from all sinful reaction. Do not fear." (Bg. 18.66) The word sarva-piipebhya� means "from all sinful activities." A person who surrenders unto Him by utilizing the chance to associate with the pure devotee, spiritual master or other authorized incarnations of Godhead like Prthu Maharaja, is saved by Kr�l).a. Then his life becomes successful.

TEXTS 28-29

�Rtf� 'if�fiq . �: I -.:1

fst44�� OO(i\�141�: ftij: 11��" :q � :qI

manor uttiinapiidasya dhruvasyapi mahipate� priyavratasya riijar�er angasyasmat-pitu� pitu[l.

idrsanam athiinye�iim ajasya ca bhavasya ca prahliidasya bales capi krtyam asti gadii-bhrta

mano�-of Manu (Svayambhuva Manu); uttiinapiidasya-of Uttanapiida, the father of Dhruva Maharaja; dhruvasya-of Dhruva Maharaja; apicertainly;mahipate[1-of the greatking; priyavratasya-of Priyavrata, in the

846 Srimad-Bhagavatam [Canto 4, Ch. 21
�� �� �� �����"

family of Maharaja Dhruva; rajar�e�-of great saintly kings; arigasya-of the name Ariga; asmat-my; pitu�-of my father; pitu�-of the father; idrsiinam-of such personalities; atha-also; anye�iim-of others; ajasya-of the supreme immortal; ca-also; bhavasya-of the living entities; ca-also; prahliidasya-of Maharaja Prahlada; bale�-of Maharaja Bali; ca-also; apicertainly; krtyam-acknowledged by them; asti-there is; gada-bhrtii-the Supreme Personality of Godhead who carries a club.

TRANSLATION

This is confirmed not onlybythe evidence of the Vedas but alsobythe personal behavior ofthe greatpersonalitieslike Manu,Uttanapada, Dhruva, Priyavrata and my grandfather Ariga, as well as by many other great personalities and ordinary living entities, exemplified by Maharaja Prahlada and Bali, all of whom are theists whobelieve in the existence of the Supreme Personality of Godhead who carries a club.

PURPORT

Narottama dasa Thakura states that one has to ascertain the right path for his activities by following in the footsteps of great saintly persons and books of knowledge under the guidance of a spiritual master (siidhusiistra-guru-viikya). A saintly person is one who follows the Vedic injunctions, which are the orders of the Supreme Personality of Godhead. The word guru refers to one who gives proper direction under the authority of the Vedic injunctions and according to the examples of the lives of great personalities. The best way to mold one's life is to follow in the footsteps of the authorized personalities like those mentioned herein by Prthu Maharaja, beginning with Svayambhuva Manu. The safest path in life is to follow such great personalities, especially those mentioned in the SrimadBhiigavatam. The mahiijanas or great personalities are Brahma, Lord Siva, Narada Muni, Manu, the Kumaras, Prahlada Maharaja, Bali Maharaja, Yamaraja, Bhi�ma, Janaka, Sukadeva Gosvami and Kapila Muni.

TEXT 30

'.1�1(ii:6 �q): �fl:;ql'l���¥ftfl6F{ I

'l•�•fiq�•ttoli !ti�UkiM,(fwtl II� o II

dauhitriidin rte mrtyoft

socyan dharma-vimohitiin

varga-svargapavargarzarh

priiyerzaikiitmya-hetuna

Text 30) Instructions
847
by Maharaja Prthu

dauhitra-adin-grandsons like my father, Vena; rte-except; mrtyo�-of personified death; socyan-abominable; dharma-vimohitan-bewildered on the path of religiosity; varga-religion, economic development, sense gratification and liberation; svarga-elevation to the heavenly planets; apavargartam-being freed from material contamination; prayerta-almost always; eka-one; atmya-the Supreme Personality of Godhead; hetunaon account of.

TRANSLATION

Although abominable persons like my father, Vena, the grandson of death personified, are bewildered on the path of religion, au the great personalities like those mentioned agree that in this world the only beslower of the benedictions of religion, economic development, sense gratification, liberation or elevation to the heavenly planets is the Supreme Personality of Godhead.

PURPORT

King Vena, the father of Prthu Maharaja, was condemned by the brahmartas and saintly persons due to his denying the existence of the Supreme Personality of Godhead and rejecting the method of satisfying Him by performance of Vedic sacrifice. In other words, he was an atheist who did not believe in the existence of God andwho consequently stopped all Vedic ritualistic ceremonies in his kingdom. Prthu Maharaja considered his character abominable because he was foolish regarding the execution of religious performances. Atheists are of the opinion that there is no need to accept the authority of the Supreme Personality of Godhead to be successful in religion, economic development, sense gratification or liberation. According to them, dharma, or religious principles, are meant to establish an imaginary God to encourage one to become moral, honest and just so that the social orders may be maintained in peace and tranquility. Furthermore, they say that actually there is no need to accept God for this purpose, for if one follows the principles of morality and honesty, that is sufficient. Similarly, if one makes nice plans and works very hard for economic development, automatically the result of economic development will come. Similarly, sense gratification also does not depend on the. mercy of the Supreme Personality of Godhead, for if one earns enough money by any process, he will have sufficient opportunity for sense gratification. Insofar as liberation is concerned, they say that there is no need to talk of liberation because after death everything is finished. Prthu Maharaja, however, does not accept the authority of such atheists,

848 Srimad-Bhagavatam [Canto 4, Ch. 21

headed by his father, who was the grandson of death personified. Generally, a daughter inherits the qualities of her father, and a son gets the qualitiesof hismother.Thus Mrtyu's daughter, Sunithii, got all the qualities of her father, and Vena inherited the qualities of his mother. A person who is always subjected to the rules and regulations of repeated birth and deathcannotaccommodateanything beyond materialistic ideas. Since King Vena was such a man, he did not believe in the existence of God. Modern civilization agrees with the principles of King Vena, but factually if we scrutinizingly study all the conditions of religion, economic development, sense gratification and liberation, we must accept the principles of the authority of the Supreme Personality of Godhead. According to Vedic literature, religion consists only of the codes of law given by God.

If one does not accept the authorit-y of the Supreme Godhead in matters of religion and morality, one must explain why two persons of the same moral standard achieve different results. It is generally found that even if two men have the same moral standards of ethics, honesty and morality, their positions are stillnot the same. Similarly, in economic development it is seen that if two men work very hard day and night, still the results are not the same. One person may enjoy great opulence without even working, whereas another person, although working very hard, does not even get two sufficient meals a day. Similarly, in the matter of sense gratification, sometimes one who has sufficient food is still not happy in his family affairs or sometimes is not even married, whereas another person, even though not economically well off, has the greatest opportunity for sense gratification. Even an animal like a hog or a dog may have greater opportunities for sense gratification than a human being. Aside from liberation, even if we consider only the preliminary necessities of life-dharma, artha and kama (religion, economic development and sense gratification)-we will see that they are not the same for everyone. Therefore it must be accepted that thereis someone who determines the different standards. In conclusion, not only for liberation must one depend on the Lord, but even for ordinary necessities in this material world. Prthu Maharaja therefore indicated that in spite of having rich parents, children are sometimes not happy. Similarly, in spite of valuable medicine administered by a competent physician, sometimes a patient dies; or in spite of having a big safe boat, sometimes a man drowns. We may thus struggle to counteract impediments offered by material nature, but our attempts cannot be successful unless we are favored by the Supreme Personality of Godhead.

Text 30) Instructions by Maharaja Prthu 849

TEXT 31

4€4fta:��'�@tf(q•u­

¥t�'Ntflilq�(f itt �: I �: ftlan�;:q•"'*" m

�' �11��11

yat-piida-sevabhirucis tapasvinam

ase�a-janmopacitarh malarh dhiya� sadyafl k�irwty anvaham edhatz satz yatha padahgu�tha-vin*srta sarit

yat-pada- whose lotus feet; seva-service; abhiruc *- inclination; tapasvinam- persons undergoing severe penances; ase�a-in numerable ; janmabirth; upacitam- acquire; malam- dirtiness; dhiyatt- mind; sadya�- immediately; k�i�oti- destroys; anvaham-day after day; edhatz-increasing; sati-being; yathii-as; padiiligu�tha-the toes of His lotus feet; viniftsrtiiemanating from; sarit-water.

TRANSLATION

By the inclination to serve the lotus feet of the Supreme Personality of Godhead, suffering humanity can immediately cleanse the dirt which has accumulatedin theirminds during innumerable births. Like the Ganges water which emanates from the toes of the lotus feet of the Lord, such a process immediately cleanses the mind, and thus spiritual or Kr��a consciousness gradually increases.

PURPORT

In India, one can actually see that a person who takes a bath in the Ganges waters daily is almost free from all kinds of diseases. A very respectable brahmar-a in Calcutta never took a doctor's medicine. Even though he sometimes felt sick, he would not accept medicine from the physician but would simply drink Ganges water, and he was always cured within a very short time. The glories of Ganges water are known to Indians and to ourselves also. The River Ganges flows by Calcutta. Sometimes within the water. there are many stools and other dirty things which are washed away from neighboring mills and factories, but still thousands of men take baths in the Ganges water, and they are very healthy as well as spiritually inclined. That is the effect of Ganges water. The Ganges is glorified because it emanates from the toes of the lotus feet of the Lord.

850 Srimad-Bhagavatam
[Canto 4, Ch. 21

Similarly, if one takes to the service of the lotus feet of the Lord ortakes to Kr�IJ.a consciousness, he is immediately cleansed of the many dirty things which have accumulated in his innumerable births. We have seen that in spite of the very black record of their past lives, persons who take to Kr11IJ.a consciousness very swiftly become perfectly cleansed of all dirty things and makespiritual progress. Therefore Prthu Maharaja advises that without the benediction of the Supreme Lord, one cannot make advancement-either in so-called morality, economic development or sense gratification. One should therefore take to the service of the Lord, or Kr�!).a consciousness, and thus very soon become a perfect man, as confirmed in Bhagavad-g"ita (k�ipram bhavati dharmatma sasvac-chantim nigacchati). Being a responsible king, Prthu Maharaja recommends that everyone take shelter of the Supreme Personality of Godhead and thus be immediately purified. Lord Sri Kr�IJ.a also says in Bhagavad-gi:ta that simply by surrendering unto Him one is immediately relieved of allsinful reactions. As Kr�qa takes away all the sinful reactionsof a person immedi· ately upon his surrender unto Him, similarly the externalmanifestation of Kr�qa, the representative of Kr�IJ.a who acts as the mercy of the Supreme Personality of Godhead, takes all the resultant actions ofthe sinful life of the disciple immediately after the disciple's initiation. Thus if thedisciple follows the principles instructed by the spiritual master, he remains purified and isnotcontaminatedbythe material infection.

Sri Caitanya Mahaprabhu therefore stated thatthe spiritualmaster who plays the part of Kr�qa's representative has to consume all the sinful reactions of his disciple. Sometimes a spiritual master takes the risk of being overwhelmed by the sinful reactions of the disciples and undergoes a sort of tribulation due to their acceptance. Sri Caitanya Mahaprabhu therefore advised that one not accept many disciples.

TEXT

Text 32] Instructions by Maharaja Prthu 851
32 �f.tita��tiiwilq�: �f11ij1ffcUtU111N��tcn*'•� I i<lfMII1: �� 111' � � ������ vinirdhutiise�a-mano-mala�pumiin asaftga-vijnana-viSe§a-viryavan yad-anghri-mulekrta-ketana�punar nasamsrtimklesa-vahamprapadyate

vinirdhuta-being specifically cleansed; ase§a-unlimited; manaft-mala[lmental speculation or the dirt accumulated in the mind; puman-the person;asaitga- being disgusted; vijiiana -scientifically; vise§a- particularly; vTryavan- being strengthened in bhakti-yoga; yat-whose; anghri- lotus feet; mule-at the root of; krta-ketana l;t-taken shelter; punal;t -again; nanever; samsrtim-material existence; klesa-vaham-full of miserable conditions; prapadyate- takes to.

TRANSLATION

When a devotee takes shelter at the lotus feet of the Supreme Personality of Godhead, he is completely cleansed of all misunderstanding or mental speculation, and he manifests renunciation. This is possible only when one is strengthened by practicing bhakti-yoga. Once having taken shelter at the root of the lotus feet of the Lord, a devotee never comes back to this material existence, which is full of the threefold miseries.

PURPORT

As stated by Lord Caitanya Mahaprahhu in His Sik§ii§_taka instructions, by the chanting of the holy name of the Lord-Hare Kg;Q.a, Hare Kr�Q.a, Kr�t;ta Kr�t;ta, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare-or by the process of hearing and chanting of the glories of the Lord, one's mind is gradually cleansed of all dirt. Due to our material association since time immemorial, we have accumulated heaps of dirty things in our minds.The total effect of this takes placewhen a living entity identifies himself with his body and is thus entrapped by the stringent laws of material nature and put into the cycle of repeated birth and death under the false impression of bodily identification. When one is strengthened by practicing bhakti-yoga, his mind is cleansed of this misunderstanding, and he is no longer interested in material existence or in sense gratification.

Bhakti, or devotional service, is characterized by vairiigya and jiiana. ]iiiina refers to understanding that one is not his body, and vairagya means disinterest in sense gratification. These two primary principles of separation from material bondage can be realized on the strength of bhakti-yoga. Thus when a devotee is fixed in the loving service of the lotus feet of the Lord, he will never come back to this material existence after quitting his body, as confirmed in Bhagavad-gTta by the Lord (tyakttxi deharh punar janma naiti miim eti so 'rjuna).

In this verse the word vijiiiina is specifically important. ]iiana, the knowledge of spiritual identity that one attains when he does not consider

852 Srimad-Bhagavatam [Canto 4, Ch. 21

himself to be the body, is explained in Bhagavad-gitii as brahma-bhiita, the revival of spiritual realization. In the conditioned state of material existence one cannot be spiritually realized because he identifies himself materially. The understanding of the distinction between material existence and spiritual existence is called jniina. After coming to the platform of jniina, or the brahma-bhiita state, one ultimately comes to devotional service, in which he completely understands his own position and the position of the Supreme Personality of Godhead. This understanding is explained here as vijiiana-vise§a. The Lord says, therefore, that knowledge of Him is vijnana, science. In other words, when one is strengthened by scientific knowledge of the Supreme Personality of Godhead, his position of liberation is guaranteed. In Bhagavad-gitii also, the science of devotional service is described as pratyak§iivagamam dharmyam, direct understanding of the principles of religion by realization (Bg. 9.2).

By practicing bhakti-yoga, one can directly perceive his advancement in spiritual life. In other practices-like karma-yoga, jiiiina-yoga and dhyiinayoga- one may not be confident about his progress, but in bhakti-yoga one can become directly aware of his progress in spiritual life, just as a person who eats can understand that his hunger is satisfied. Our false appetite for enjoyment and lordship of the material world is due to a prominence of passion and ignorance. By bhakti-yoga these two qualities are diminished, and one becomes situated in the mode of goodness. Gradually surpassing the mode of goodness, one is situated in pure goodness, which is not contaminated by the material qualities. When thus situated, a devotee no longer has any doubts; he knows that he will not come back to this material world.

TEXT 33

� {4

¥NRII€44'1Mfli­

�;(lq-q:Efilttg0i: �df4\c 1

3l¥tafll;u

4il¥tlf41e.fWqt\ii

ft�IN'il(l��: II�� II

tam eva yuyam bhajatiitma-vrttibhir mano-vacal;t-kiiya-gur-aifl. sva-karmabhi[t

amiiyinal;t kiima-dughiinghri-pankajarh yathiidhikiiriivasitiirtha-siddhayal;t

tam-unto Him; eva- certainly ; yiiyam-all you citizens; bhajata-worship; iitma-own; vrttibh*-occupational duty; ma nal,t - mind; vacal;t-

Text 33] Instructions by Maharaja P�thu 853

words;kaya-body; gur-a*-by the particular qualities;sva-karmabh*-by occupational duties; amayina�-without reservation; kama-dugha-fulfilling all desires; anghri-pankajam-the lotus feet; yatha-as far as; adhikara-ability; avasita-artha-fully convinced of one's interest; siddhaya�satisfaction.

TRANSLATION

P�thu Maharaja advised his citizens: Engaging your minds, your words, your bodies and the results of your occupational duties, and being always open-minded, you should all render devotional service to the Lord. According to your abilities and the occupations in which you are situated, you should engage your service at the lotus feet of the Supreme Personality of Godhead with full confidence and without reservation. Then surely you will be successful in achieving the final objective in your lives.

PURPORT

As stated in the Eighteenth Chapter of Bhagavad-g"ita, sva-karmar-a tam abhyarcya: one has to worship the Supreme Personality of Godhead by his occupational duties. This necessitates accepting the principle of four varr-as and four asramas. Prthu Maharaja therefore says, gur-a* svakarmabh*. This phrase is explained in Bhagavad-gitli. Catur-varr-yam mayii Sf§tarh gur-a-karma-vibhiigasa�: "The four castes (the brahmar-as, k§atriyas, vaisyas and sudras) are created by the Supreme Personality of Godhead according to the material modes of nature and the particular duties discharged in those modes." A person who is situated in the mode of goodness is certainly more intelligent than others. Therefore he can practice the brahminical activities-namely, speaking the truth, controlling the senses, controlling the mind, remaining always clean, practicing tolerance, having full knowledge about one's self-identity, and understanding devotional service. In this way, if he engages himself in the loving service of the Lord as an actual brahmar-a, his aim to achieve the final interest of life is attained. Similarly, the k�atriya's duties are to give protection to the citizens, to give all his possessions in charity, to be strictly Vedic in the management of state affairs, and to be unafraid to fight whenever there is an attack by enemies. In this way, a k�atriya can satisfy the Supreme Personality of Godhead by his occupational duties. Similarly, a vaisya can satisfy the Supreme Godhead by properly executing his occupational duties-engaging himself in producing foodstuffs, giving protection to cows, and trading if necessary when there is an excess of agricultural production. Similarly, because they do not have ample

854 Srimad-Bhagavatam [Canto 4, Ch. 21

intelligence, sudras should simply engage as workers to serve the higher statuses of social life. Everyone's aim should be to satisfy the Supreme Personality of Godhead by engaging his mind in thinking always of Km1a, his words in always offering prayers to the Lord or preaching about the glories of the Lord, and his body in executing the service required to satisfy the Lord. As there are four divisions within our body-the head, the arms, the belly and the legs-similarly, human society, taken as a whole, is divided into four classes of men according to their material qualities and occupational duties. Thus the brahminical or intelligent men have to execute the duty of the head, the k�atriyas must fulfill the dutyof the arms, the vaisya class must fulfill the duty of the belly, and the sudras must fulfill the duty of the legs. In executing the prescribed duties of life, no one is higher or lower, for although there are such divisions as higher andlower,sincethereisactuallya commoninterest-to satisfy the Supreme Personality of Godhead-there are no distinctions between them.

The question may be raised that since the Lord is supposed to be worshiped by great demigods like Lord Brahma, Lord Siva and others, how can an ordinary human being on this planet serve Him? This is clearly explained byPrthuMaharaja by the use of the wordyathiidhikiira, "according to one's ability." If one sincerely executes his occupational duty, that will be sufficient. One does not need to become like Lord Brahma, Lord Siva, Indra, Lord Caitanya or Ramanujacarya, whose capabilities are certainly far above ours. Even a sudra, who is in the lowest stage of life according to the material qualities, can achieve the same success. Anyone can become successful in devotional service provided he displays no duplicity. It is explained here that one must be very 'frank and openminded (amiiyina�}. To be situated in a lower status of life is not a disqualification for success in devotional service. The only qualification is that whether one is a briihmara, k�atriya, vaisya or sudra, he must be open, frank and free from reservations. Then, by performing his particular occupational duty under the guidance of a proper spiritual master, he can achieve the highest success in life. As confirmed by the Lord Himself, striyo vaisyiis tathii sudriis te 'pi yiinti pariim gatim (Bg. 9.32). It does not matter what one is, whether a briihmara, k�atriya, vaisya, siidra or a degraded woman. If he engages himself seriously in devotional service, working with body, mind and intelligence, he is sure to be successful in going hack home, hack to Godhead. The Lord's lotus feet are described here as kiima-dughiinghri-pankajam because they have all power to fulfill the desires of everyone. A devotee is happy even in this life because-although in

Text 33] Instructions by Maharaja Prthu 855

material existence wehave many needs-all his material needs are satisfied, and when he at Last quits hisbody, he goes back home, back to Godhead, without a doubt.

TEXT 34

asiivihiineka-gu[!-O 'gu[!-o 'dhvara[l. prthag-vidha-dravya-gu[!-a-kriyoktibhi[l. sampadyate 'rthiisaya-linga-niimabhir visuddha-vijniina-ghana� svariipata�

asau-the Supreme Personality of Godhead; iha- inthismaterialworld; aneka- various; gu!La�-qualities; agu[!-a�-transcendental; adhvara�-yajna; prthak -vidha - varieties; dravya - physical elements; gurta- ingredients; kriyii-performances; uktibhi[l.-by chanting different mantras; sampadyate-isworshiped; artha-interest; iisaya-purpose; lih ga-form ; niimabhi[tname; visuddha-without contamination; vijiiiina- science; ghana[l.- co ncentrated; svariipatal1 -in His own form.

TRANSLATION

The Supreme Personality of Godhead is transcendental and not contaminated by this material world. But although He is concentrated spirit soul without material variety, for the benefit of the conditioned soul He nevertheless accepts different types of sacrifice performed with various material elements, ritual and mantras and offered to the demigods under different names according to the interests and purposes of the performers.

PURPORT

For material prosperity there are recommendations in the Vedas for various types of yajna (sacrifice). In Bhagavad-gitii (3.10) it is confirmed that Lord Brahma created all living entities, including human beings and demigods, and advised them to perform yajna according to their material desires (saha-yajTiii[l. prajii[l. mtvii). These performances are called yajnas because their ultimate goal is to satisfy the Supreme Personality of Godhead Vi�.I).U. The purpose of performing yajnas is to get material benefit, but because the aim is to simultaneously satisfy the Supreme Lord, such yajnas have been recommended in the Vedas. Such performances are, of

856 Srimad-Bhagavatam [Canto 4, Ch. 21
I
31(11Feiiilit·sguft�: �Pi414J:Q4Y"Ifili�RI�:
f4ii:N�·--I:f-.: �: 11�\lU

course, known as karma-kiiru)a or material activities, and all material activities are certainly contaminated by the three modes of material nature. Generally the karma-kiirt!Ia ritualistic ceremonies are performed in the mode of passion, yet the conditioned souls, both human beings and demigods, are obliged to perform these yajiias because without them one cannot be happy at all.

Srna Visvanatha Cakravarti Thakura comments that these karma-kiirt!Ia ritualistic ceremonies, although contaminated, contain touches of devotional service because whenever there is a performance of any yajiia Lord Vi�I).U is given a central position. This is very important because even a little endeavor to please Lord Vi�I).U is bhakti and is of great value. A tinge of bhakti purifies the material nature of the performances, which by devotional service gradually come to the transcendental position. Therefore although such yajiias are superficially material activities, the results are transcendental. Such yajiias as Surya-yajfia, Indra-yajfia, Candra-yajfia, etc., are performed in the names of the demigods, but these demigods are bodily parts of the Supreme Personality of Godhead. The demigods cannot accept sacrificial offerings for themselves, but they can accept them for the Supreme Personality of Godhead, just as a departmental tax collector of a government cannot collect taxes for his personal account but can realize them for the government. Any yajiia performed with this complete knowledge and understanding is described in Bhagavad-g"ltii as brahmiirpar-am, or a sacrifice offered to the Supreme Personality of Godhead. Since no one but the Supreme Lord can enjoy the results of sacrifice, the Lord says that He is the actual enjoyer of all sacrifices (bhoktiiram yajiia-tapasiim sarva-loka-mahesvaram). Sacrificesshouldbeperformed with this view in mind. As stated in Bhagavad-gitii:

brahmiirpar-am brahma havir

brahmiignau brahmartii hutam

brahmaiva tena gantavyam

brahma-karma-samiidhinii

"A person who is fully absorbed in K,r,sp.a consciousness is sure to attain the spiritual kingdom because of his full contribution to spiritual activities in which the consummation is absolute and that which is offered is of the same spiritual nature." (Bg. 4.24) The performer of sacrifices must always keep in view that the sacrifices mentioned in the Vedas are meant to satisfy the Supreme Personality of Godhead. Vi�r-ur iiriidhyate panthii ( V�r-u Puriirta 3.8.9). Anything material or spiritual done for the satisfaction of the Supreme Lord is understood to be an actual yajiia, and by performing

Text 34] Instructions by Maharaja Prthu 857

such yajiias one gets liberation from material bondage. The direct method of getting liberation from material bondage is devotional service, comprising the nine following methods:

srava(lam kirtanam Vifi[IO� smarararh piida-sevanam

arcanam vandanam diisyam sakhyam iitma-nivedanam (Bhiig. 7.5.23)

This ninefold process is described in this verse as visuddha-vijiiiina-ghana�, or satisfying the Supreme Personality of Godhead directly by transcendental knowledge concentrated on the form of the Supreme Lord Vigm. This is the best method for satisfying the Supreme Lord. One who cannot take to this direct process, however, should take the indirect process of performing yajiias for the satisfaction of Vigm or Yajiia. Vi��u is therefore called yajiia-pati. Sriya� patim yajfi.a-patim jagat-patim. (Bhiig. 2.9.15)

The Supreme Personality of Godhead's deep scientific knowledge is concentrated to the supreme point. For example, medical science knows some things superficially, but the doctors do not know exactly how things happen in the body. Lord Kr��a, however, knows everything in detail. Therefore His knowledge is vijfi.iina-ghana because it does not have any of the defects of material science. The Supreme Personality of Godhead is visuddha-vijfiiina-ghana, concentrated transcendental knowledge; therefore, even though He accepts karma-kiir!Iiya materialistic yajfias, He always remainsin atranscendental position. Therefore, the mention of aneka-gura refers to the Supreme Personality of Godhead's many transcendental qualities; for He is not affected by the material qualities. The different kinds of material paraphernalia or physical elements are also gradually transformed into spiritual understanding because ultimately there is no difference between materialand spiritual qualities, for everything emanates from the Supreme Spirit. This is realized by a gradual process of realization and purification. One vivid example of this is Dhruva Maharaja, who took to meditation in the forest to achieve material benefit but ultimately became spiritually advanced and did not want any benediction for material profit. He was simply satisfied with the association of the Supreme Lord. Asaya means determination. Generally a conditioned soul has the determination for material profit, but when these desires for material profit are satisfied through performance of yajfi.a, one gradually achieves the spiritual platform. Then his life becomes perfect. Sr"imad-Bhiigavatam therefore recommends:

akiima� sarva-kiimo vii mokfia-kiima udiiradhi{l

t"ivrera bhakti-yogena yajeta purufiarh param. (Bhiig. 2.3.10)

858 Srimad-Bhagavatam [Canto 4, Ch. 21

Everyone-whether akama (a devotee), sarva-kama (a karmi), or mok§akama (a jnanT or yogi)-is encouraged to worship the Supreme Personality of Godhead by the direct method of devotional service. In this way one can get both material and spiritual profit simultaneously.

TEXT 35

�,; �tWJIR""': II�'-\11

pradhana-kalasaya-dharma-sahgrahe sanra e§a pratipadya cetanam

kriya-phalatvena vibhur vibhavyate

yathanalo daru§u tad-gur-atmaka�

pradhana- material nature; kala-time; asaya-desire; dharma-OCCU· pational duties; sangrahe-aggregate; sa nre-body; e§a�-this; pratipadyaaccepting; cetanam-consciousness; kriya-activities; phalatvena-by the result of; vibhu�-the Supreme Personality of Godhead; vibhavyatemanifested; yathii-as much as; anala�-fire; daru§u -in the wood; tat-gurtaatmaka�-according to shape and quality.

TRANSLATION

The Supreme Personality of Godhead is all-pervading, but He is also manifested in different types of bodies which arise from a combination of material nature, time, desires and occupational duties. Thus different types of consciousness develop, just as fire, which is always basically the same, blazes in different ways according to the shape and dimension of firewood.

PURPORT

The Supreme Personalityof Godheadconstantly liveswith the individual soul as Paramatma. The individual soul has awareness in accord with his material body, which he attainsby virtue of prakrti or material nature. The material ingredients are activated by force of time, and thus the three material modes of nature are manifested. According to his association with the three modes of nature, the living entity develops a particular type of body. In animal life, the material mode of ignorance is so prominent that there is very little chance of realizing the Paramatma, who

Text 35] Instructions
859
by Maharaja Prthu
��
���Q: �����I fitittiCfi���;( �¥tl6ttij

is also present within the heart of the animal; but in the human form of life, because of developed consciousness (cetanam), one can be transferred from ignorance and passion to goodness by the results of his activities (kriyii-phalatvena). A human being is therefore advised to associate with spiritually advanced personalities. The Vedas give the direction tadvijn,iiniirthamsa gu,rum eviibhigacchet: in order to reach the perfection of life or to understand the real constitutional position of the living entity, one must approach the spiritual master. (MurJ4aka Up. 1.2.12) Gurum evabhigacchet-onemust; it is not optional. It is imperative that one approach the spiritual master, for by such association one proportionately develops his consciousness towards the Supreme Personality of Godhead. The highest perfection of such consciousness is called Kr�IJ.a consciousness. According to the body given by prakrti, or nature, one's consciousness is present; according to the development of consciousness, one's activities are performed; and according to the purity of such activities, one realizes the Supreme Personality of Godhead, who is present in everyone's heart. The example given herein is very appropriate. Fire is always the same, but according to the size of the fuel or burning wood, the fire appears to be straight, curved, small, big, etc.

According to the development of consciousness, God realization is present. In the human form of life it is recommended, therefore, that one undergo the different types of penances and austerities described in Bhagavad-g'ita (karma-yoga, jiiana-yoga, dhyana-yoga and bhakti-yoga). Like a staircase, yoga has different steps for reaching the topmost floor, and according to one's position upon the staircase, he is understood to be situated in karma-yoga, jiiana-yoga, dhyana-yoga or bhakti-yoga. Of course, bhakti-yoga is the topmost step on the staircase of realization of the Supreme Personality of Godhead. In other words, according to one's development in consciousness, one realizes spiritual identity, and thus when one's existential position is purified fully, he becomes situated in brahmananda, which is ultimately unlimited. Therefore the sank'irtana movement contributed by the Supreme Personality of Godhead as Lord Caitanya is the direct and easiest process for coming to the purest form of consciousness-Kr�qa consciousness, the platform on which the Supreme Personality is fully realized. Directions for performing different types of yajiias are specifically arranged for the highest realization of the Supreme Lord, as confirmed in Bhagavad-g'ita by the Lord Himself. Yeyathamarh pradadyante tams tathaiva bhajamy aham (Bg. 4.11). The Supreme Personality of Godhead is realized according to the proportion of one's surrender. Full surrender, however, occurs when a man is perfectly in knowledge. Bahiiniirhjanmaniimantejiiiinaviinmiirhprapadyate (Bg. 7.19).

860 Srimad-Bhagavatam [Canto 4, Ch. 21

TEXT 36

� �ij(*4ijl( tft ��I alir.f � �

�t �fUR'I� t��m: ������

aho mamiimi: vitaranty anugraham

harim gurum yajiia-bhujiim adhi:svaram

sva-dharma-yogena yajanti miimakii

nirantaram k§or-i-tale dnlha-vratii[l

aho-0 all of you; mama-unto me; ami-all of them; vitaranti-distributing; anugraham-mercy; harim-the Supreme Personality of Godhead; gurum- the supreme spiritual master; yajiia-bhujiim-all the demigods eligible to accept yajna offering; adhisvaram-the supreme master; svadharma-occupational duties ; yogena-by dint of ; yajanti- worship; miimakafl-having a relationship with me; nirantaram-incessantly; k.so[ti-taleon the surface of the globe; dnlha-vratii� - with firm determination.

TRANSLATION

The Supreme Personality of Godhead is the master and enjoyer of the results of all sacrifices, and He is the supreme spiritual master as well. All of you citizens on the surface of the globe who have a relationship with me and are worshiping Him by dint of your occupational dutiesare bestowing your mercy upon me. Therefore, 0 my citizens, I thank you.

PURPORT

Maharaja Prthu's advice to his citizens to take to devotional service is now concluded in two ways. He has repeatedly advised persons who are neophytes to engage themselves in devotional service according to the capacities of the different orders of social and spiritual life, but here he specifically thanks those who are already engaged in such devotional service to the Supreme Personality of Godhead, who is actually the enjoyer of all sacrificial ceremonies and who is also the supreme teacher as antaryiimi or Paramatma. There is specific mention of the word gurum, which indicates the Supreme Personality as citta-guru. The Supreme Godhead in His Paramatma feature is present in everyone's heart, and He is always trying to induce the individual soul to surrender unto Him and to engage in devotional service; therefore He is the original spiritual master. He manifests Himself as spiritual master both internally and externally to

Text 36]
Instructions
861

help the conditioned soul both ways. Therefore He has been mentioned herein as gurum. It appears, however, that in the time of Maharaja Prthu all the people on the surface of the globewere his subjects. Most of themin fact, almost all of them-were engaged in devotional service. Therefore he thanked them in a humble way for engaging in devotional service and thus bestowing their mercy upon him. ln other words, in a state where the citizens and the head of state are engaged in devotional service unto the Supreme Personality of Godhead, they help one another and are mutually benefited.

TEXT 37

1n � �: Sl¥1-""'lfifll­

mii. fotu teja� prabhaven maharddhibhis titik�aya tapasii vidyaya ca dedipyamiine 'jita-devatanarh kule svayarh raja-kulii.d dvi[anam

mii-never do it; jiitu-at any time; teja�-supreme power; prabhavetexhibit; mahii-great; rddhibhi�- by opulence; titik�ayii-by tolerance; tapasii-penance; vidyaya-by education; ca-also; dedipyamiine-upon those who are already glorified ; ajita-devatiiniim-Vai�J;Javas, or the devotees of the Supreme Personality of Godhead; kule-in the society; svayampersonally; riija-kuliit-greater than the royal family; dvijiiniim-of the briihmartas.

TRANSLATION

The brahmru;tas and Vai�t:tavas are personally glorified by their characteristic powers of tolerance, penance, knowledge and education. By dint of all these spiritual assets, Vai�t:tavas are more powerful than royalty. It is therefore advised that the princely order not exhibit its material prowessbefore these two communities and should avoid offending them.

PURPORT

Prthu Maharaja has explained in the previous verse the importance of devotional service for both the rulers and the citizens of the state. Now he explains how one can be steadily fixed in devotional service. Sri

862 Srimad-Bhagavatam [Canto 4, Ch. 21
� f%tAT � I
MRt�
4:G.1tt�+tRSMi1�i11wti �� (l�telt �IWII'(11�\911

Caitanya Mahiiprabhu,while instructingSrila Rupa Gosviimi,has compared the devotional service of the Lord with a creeper. A creeper has a feeble stem and requires the support of another tree to grow, and while growing, it requires sufficient protection so that it maynot be lost. While describing the system of protection for the creeper ofdevotional service, Sri Caitanya Mahaprabhu has especially stressed protection from offenses unto the lotus feet of Vai�r:tavas. This is called vaiHwviipariidha. Apariidha means offense. If one commits vai�r;taviipariidha, all of his progress in devotional service will be checked. Even though one is very much advanced in devotional service, if he commits offenses at the feet of a Vai�r:tava, his advancement is all spoiled. In the siistras it is found that a very great yogi, Durvasa Muni, committed va�[taviipariidha, and thus for one full year had to travel all over the universe, even to Vaikul).thaloka, to defend himself from the offense. At last, even when he approached the Supreme PersonalityofGodhead inVaikur:ttha, he was refused protection. Therefore one should be very careful about committing offenses at the feet of a Vai�r:tava. The most grievous type of vai§[taviipariidha is called gurvapariidha, which refers to offenses atthe lotus feet of the spiritual master. In the chanting of the holy name of the Supreme Personality of Godhead, this gurv-apariidha is considered the most grievous offense. Guror avajiiii sruti-siistra-nindanam (Padma Puriir:aJ. Among the ten offenses committed against the chanting of the holy name, the first offenses are disobedience of the spiritual master and blasphemy of the Vedic literature.

The simple definition of "Vai�r:tava" is given by Sri Caitanya Mahaprabhu: a person who immediately reminds one of the Supreme Personality of Godhead, Kr�r:ta, is a Vair;;Qava. In this verse, both Vair;;r:tavas and brtihmartas are mentioned. A Vai�r:tava is a learned brahma[ta and is therefore designated as briihma[ta-vai§r;tava, briihmar;ta-pa[t{iita or as a Vai�r:tava and briihma[ta. In other words, a Vair;;l).ava is supposed to be a brahmarta already, but a brahmarta may not be a pure Vai;;I;J.ava. When a person understands his pure identity, brahma jiinati, he immediately becomes a briihma[ta. In the briihmara stage, one's understanding of the AbsoluteTruth is mainly based on the impersonal view. When a briihmara, however, rises to the platform of personal understanding of the Supreme Godhead, he becomes a Vair;;r:tava. A Vair;;l).ava is transcendental even to a briihmara. In the material conception, the position of a briihma[ta is the highest in human society, but a Vair;;r:tava is transcendental even to a briihmara. Both the briihmara and Vai�l).ava are spiritually advanced. A briihma[ta's qualifications are mentioned in Bhagavad-g"ita as truthfulness, mental equanimity, control of the senses, the power of tolerance, sim-

Text 37] Instructions by Maharaja Prthu 863

plicity, knowledge of the AbsoluteTruth, firm faith in the scriptures, and practical application of the brahminical qualities in life. In addition to all these qualifications, when one fully engages in the transcendental loving service of the Lord, he becomes a Vai§!l)ava. Prthu Maharaja warns his citizens who are actually engaged in the devotionalserviceof the Lord to take care against offenses to the briihmm:ws and Vai§!l)avas. Offenses at their lotus feet are so destructive that even the descendants of Yadu who were born in the family of Lord K{§!l)a were destroyed due to offenses at their feet. The Supreme Personality of Godhead cannot tolerate any offense at the lotus feet of briihmar;tas and Vai§!l)avas. Sometimes, due to their powerful positions, princes or government servants neglect the positions of briihmaras and Vai§!l)avas, not knowing that because of their offense they willbe ruined.

TEXT 38

brahmar;tya-deva� purufiali puriitano nityarh harir yac-carar;tiibhivandaniit aviipa lak�m1m anapiiyin1rh ya.So jagat-pavitrarh ca mahattamiigrar;tl{l

brahmar;tya-deva�-the Lord of the brahminical culture; purufia�-the Supreme Personality; puriitana�-the oldest; nityam-eternal; har*Personality of Godhead; yat-whose ; cara�J-a-lotus feet; abhivandaniit-by means of worshiping; auiipa-obtained; lak�m1m- opulences; anapiiyin""imperpetually; yasa�-reputation; jagat-universal ; pauitram-purified ; caalso; mahat- great; tama- supreme; agrar"i?I-foremost.

TRANSLATION

The Supreme Personalityof Godhead, the ancient, eternal Godhead who is foremost amongst all great personalities, obtained the opulence of His staunch reputation, which purifies the entire universe, by worshiping the lotus feet of those brahmru:tas and Vai�1,1avas.

PURPORT

The Supreme Person is described herein as brahmarya-deva. Brahmar-ya refers to the briihmar;tas, the Vai�l)avas or the brahminical culture,

864 Srimad-Bhagavatam [Canto 4, Ch. 21
jitiiiHO(�: �: � � ��111\tt�Wll( I � �q;cq.�;ft � ii141€1if« � +ifij+ilttaft:II��II

and deva means "worshipable Lord." Therefore unless one is on the transcendental platform of being a Vai�I).ava, or on the highest platform of material goodness (as a briihma[la ), he cannot appreciate the Supreme Personality of Godhead. In the lower stages of ignorance and passion, it is difficult to appreciate or understand the Supreme Lord. Therefore the Lordis described herein astheworshipableDeityfor personsinbrahminical and Vai�I).avaculture.

nama brahma[tya-devaya go-brahma[la-hitaya ca jagad-dhitiiya kr§rtiiya govindiiya namo nama[!.

(Vi§flU Puriirta 1.19.65)

Lord K{�I).a, the Supreme Personality of Godhead, is the prime protector of brahminical culture and the cow. Without knowing and respecting these, one cannot realize the science of God, and without this knowledge, any welfare activities or humanitarian propaganda cannot be successful. The Lord is puru�a, or the supreme enjoyer. Not only is He the enjoyerwhen He appears as a manifested incarnation,but He is the enjoyer since time immemorial, from the very beginning (puriitana), and eternally (nityam). Yac-cara[liibhivandanat: Prthu Maharaja said that the Supreme Personality of Godhead attained this opulence of eternal fame simply by worshiping the lotus feet of the briihmartas. In Bhagavad-gitii it is said that the Lord does not need to work to achieve material gain. Since He is perpetually supremely perfect, He does not need to obtain anything, but still it is said that He obtained His opulences by worshiping the lotus feet of the brahma[laS. These are His exemplary actions. When Lord Sri Kr�I.la was in Dvaraka, He offered His respects by bowing down at the lotus feet of Narada. When Sudiima Vipra came to His house, Lord Kr�I).a personally washed his feet and gave him a seat on His personal bed. Although He is the Supreme Personality of Godhead, Lord Sri Kr�I).a offered His respects to Maharaja Yudhi�thira and Kunti. The Lord's exemplary behavior is to teach us. We should learn from His personal behavior how to give protection to the cow, how to cultivate brahminical qualities, and how to respect the briihmartas and the Vai�I).avas. The Lord says in Bhagavad-gitii, yad yad acarati sre§thas tat tad evetaro jana�: "If the leading personalities behave in a certain manner, others follow them automatically." (Bg. 3.21) Who can be more of aleading personality than the Supreme Personality of Godhead, and whose behavior could be more exemplary? It is not that He needed to do all these things to acquire material gain, but all of these acts were performed just to teach us how to behave in this material world.

Text 38] Instructions
865
by Maharaja Prthu

The Supreme PersonalityofGodheadisdescribedhereinas mahattamaagrar-lJ:l. Within this material world, the mahattamas orgreatpersonalities are Lord Brahmii and Lord Siva, but He is above them all. Niirayar-a� paro 'vyaktiit: the Supreme Personality of Godhead is in a transcendental position, above everything that is created within this material world. His opulence, His riches, His beauty, His wisdom, His knowledge, His renunciation andHisreputationareall jagat-pavitram, universallypurifying. The more we discuss His opulences, the moretheuniversebecomespurer and purer. In the material worid, the opulencespossessedby a material person are never fixed. Today onemaybeaveryrichman,buttomorrow he may become poor;todayoneisveryfamous,buttomorrowhemaybe infamous. Materially obtained opulences are never fixed, but all six opulences perpetually exist in the Supreme Personality of Godhead, not only in the spiritual world but also in this material world. Lord Kr�t:ta's reputationisfixed,andHisbookofwisdom, Bhagavad-g"ita, isstillhonored. Everything pertaining to the Supreme PersonalityofGodheadiseternally existing.

TEXT 39

yat-sevayiise�a-guhasaya� sva-rap

vipra-priyas tu§yati kiimam "isvara"{l

tad eva tad-dharma-parair vin"itai"{l

sarviitmana brahma-kulam ni§evyatam

yat- whose; sevayii-by serving;ase§a-unlimited;guha-asaya�-dwelling within the heart of everyone; sva-rii(-but still fully independent; viprapriya�-very dear to the briihma!las andVai�t;J.avas; tu�yati-becomes satisfied; kiimam-of desires;i"svara� -theSupremePersonalityofGodhead; tatthat; eva-certainly; tat-dharma-para*-by following in the footsteps of the Lord; vini"ta*- by humbleness; sarviitmanii-in all respects; brahmakulam- the descendants of briihma!las and Vai�t;J.avas; ni�evyatiim-always beingengagedintheirservice.

TRANSLATION

The Supreme Personality of Godhead, who is everlastingly independent and who exis ts in everyone's heart, is very pleased with those who follow

866 Srimad-Bhagavatam [Canto 4, Ch. 21
if�i!4ifi�Ng'I��H
NSdStif�Rt ��: I � ���: � f.t1ottijl'( ������

in His footsteps and engage without reservation in the servtce of the descendants of brahma1,1as and Vai�I;tavas. For He is always dear to brahmai;tas and Vai�I;tavas, and they are always dear to Him.

PURPORT

It is said that the Lord is most pleased when He sees one engage in the service of His devotee. He does not need any service from anyone because He is complete, but it is in our own interest to offer all kinds of services to the Supreme Personality of Godhead. These services can be offered to the Supreme Person not directly but through the service of briihmarws and Vai�I;tavas. Srila Narottama dasa Thakura sings, chiilj.iyii vai�rava-sevii nistiira payeche kebii, which means that unless one serves the Vai�I;tavas and briihmaras, one cannot get liberation from the material clutches. Srila Visvanatha Cakravarti Thakura also says, yasya prasiidiid bhagavatprasiida�: by satisfying the senses of the spiritual master one can satisfy the senses of the Supreme Personality of Godhead. Thus this behavior is not only mentioned in scriptures but also followed by iiciiryas. Prthu Maharaja advised his citizens to follow the exemplary behavior of the Lord Himself and thus engage in the service of briihmaf!aS and Vaig1avas.

Sl(i1G;fflS�;:ij�i+f

t«Ntfi4ij+i(or�Fw\1ctttl mr: �r%¥i?IIM

pumiillabhetiinativelam iitmana� prasidato 'tyanta-samarh svata� svayam

yan-nitya-sambandha-ni§evayii tata"{l • pararh kim atrasti mukham havir-bhu]am

puman-a person; labheta-can achieve; anativelam-without delay; iitmana�-of his soul; prasidata� -being satisfied; atyanta-the greatest; samam-peacefulness; svata� -automatically; svayam-personally; yatwhose; nitya-regular; sambandha- relationship; ni§evayii-by dint of service; tata� -after that; param-superior; kim-what; atra-here; astithere is; mukham-happiness; hav*-clarified butter; bhujiim- those who drink.

TRANSLATION

By regular service to the brahmai;tas and Vai�Q.avas, one can clear the dirt from his heart and thus enjoy supreme peace and liberation from

Text40] Instructions
867
by Maharaja Prthu
TEXT40 -:
�:� I
�� 11\loll "'

material attachment and be satisfied. In this world there is no fruitive activity superior to serving the brahmal).a class, for this can bring pleasure to the demigods for whom the many sacrifices are recommended.

PURPORT

In Bhagavad-gitii it is said: prasiide sarva-du�khiiniirh hiinir asyopajiiyate (Bg. 2.65). Unless one is self-satisfied, he cannot be free from the miserable conditions of material existence. Therefore it is essential to render service to the briihmal)as and V ai�l)avas to achieve the perfection of selfsatisfaction. Srila Narottama dasa Thakura therefore says:

taridera caral)a sevi bhakta-sane viisa janame janame haya, ei abhilii�a

"Birth after birth I desire to serve the Lotus feet of the iiciiryas and live in a society of devotees." A spiritual atmosphere can be maintained only by living in a society of devotees and by serving the orders of the iiciiryas. The spiritual master is the best briihmal)a. At present, in the age of Kali, it is very difficult to render service to the briihmal)a-kula or the briihmal)a class.The difficulty, according to the Variiha Puriil)a, is that demons,taking advantage of Kali-yuga, have taken birth in briihmarta families. Riik�asii� kalim iisritya jayante brahma-yoni�u (Variiha Puriirta). In other words, in this age there are many so-called caste briihma!las and caste Gosvamis who, taking advantage of the siistra and of the innocence of people in general, claim to be briihma!£aS and Vai�l)avas by hereditary right. One will not derive any benefit by rendering service to such false briihmap.a-kulas. One must therefore take shelter ofabona fide spiritualmaster and his associates and should also render service to them, for such activity will greatly help the neophyte !n .ttaining full satisfaction. This has been very clearly explained by Srila Visvanatha Cakravarti Thii.kura in his explanation of the verse vyavasiiyiitmikii buddhir ekeha kuru-nandana (Bg. 2.41). By actually following the regulated principles of bhakti-yoga as recommended by Srila Narottama dasa Thii.kura, one can very quickly come to the transcendental platform of liberation, as explained in this verse (atyantasamam). The particular use of the word anativelam ("without delay") is very significant because simply by serving briihmartas and Vai�Q.avas one can get liberation. There is no need to undergo severe penances and austerities. The vivid example of this is Narada Muni himself. In his previous birth, he was simply a maidservant's son, but he got the opportunity to serve exalted briihmartas and Vai�Q.avas, and thus in his

868 Srimad-Bhagavatam [Canto 4, Ch. 21

next life he not only became liberated but became famous as the supreme spiritual master of the entire Vai�l)ava disciplic succession. According to the Vedic system, therefore, it is customarily recommended that after performing a ritualistic ceremony, one should feed the brahmaT;laS.

TEXT41

31�1�'1'kU� c:�+ECEtilf€4�:

a.Sniity anantaft khalu tattva-kovidaifl sraddha-hutarh yan-mukha ijya-niimabhift

na vai tatha cetanaya bahi�krte

hutasane paramahamsya-paryagu[l

asnati- eats; ananta[t-the Supreme Personality of Godhead; khalunevertheless; tattva-kovidaift-persons who are in knowledge of the Absolute Truth; sraddha-faith; hutam-offering fire sacrifices; yat-mukhewhose mouth; ijya-namabhift-by different names of demigods; na-never; vai-certainly; tatha-as much; cetanaya-by living force; bahi�krte-being bereft of; huta-asane-in the fire sacrifice; paramahamsya-regarding devotees; paryagu[l-never goes away.

TRANSLATION

Although the Supreme Personality of Godhead, Ananta, eats through the fire sacrifices offered in the names of the different demigods, He does not take as much pleasure in eating through fire as He does in accepting offerings through the mouths of learned sages and devotees, for then He does not leave the association of devotees.

PURPORT

According to Vedic injunctions, a fire sacrifice is held in order to give food to the Supreme Personality of Godhead in the names of the different demigods. While performing a firesacrifice,one pronounces the word sviihii in mantras such as indriiya sviihii and iidityiiya sviihii. These mantras are uttered to satisfy the Supreme Personality of Godhead through demigods such as Indra and Aditya, for the Supreme Personality of Godhead says:

niiham ti§thiimi vaiku[tthe yoginiim hrdaye§u va tattat ti§{hiimi narada yatra gayanti mad-bhakta[L

Text41) Instructions by Maharaja Prthu 869
� tf� (litl"'l'if'l: I
�� ql('i�q�g:
WI � ij'f(
����II

"I am not in Vaikul).�ha nor in the hearts of the yogis. I remain where My devotees engage in glorifying My activities." It is to be understood that the Supreme Personality of Godhead does not leave the company of His devotees.

Fire is certainly devoid of life, but devotees and briihma[l.aS are the living representatives of the Supreme Lord. Therefore to feed briihma[i.as and VaipQ.avas is to feed the Supreme Personality of Godhead directly. It may be concluded that instead of offering fire sacrifices, one should offer foodstuffs to briihma[l.aS and Vai?J).avas, for that process is more effective than fire yajiia. The vivid example of this principle in action was given by Advaita Prabhu. When he performed the sriiddha ceremony for his father, he first of all called Haridasa Thakura and offered him food. It is the practice that after finishing the sriiddha ceremony, one should offer food to an elevated briihma[l.a. But Advaita Prabhu offered food first to Haridasa 'fhakura, who had taken his birth in a Mohammedan family. Therefore Haridasa 'fhakura asked Advaita Prabhu why he was doing something which might jeopardize his position in briihma[l.a society. Advaita Prabhu replied that he was feeding millions of first-class briihma[las by offering the food to Haridasa 'fhakura. He was prepared to talk with any learned briihma[la on this point arid prove definitely that by offering food to a pure devotee like Haridasa Thakura, he was equally as blessed as he would have been by offering food to thousands of learned briihma[laS. When performing sacrifices, one offers oblations to the sacrificial fire, but when such oblations are offered to Vai?Q.avas, they are certainly more effective.

yad brahma nityarh virajarh sanatanarh

sraddha-tapo-mahgala-mauna-sarhyamaift

samadhina bibhrati hiirtha-dr§taye

yatredam adarsa iviivabhasate

yat-that which; brahma-the brahminical culture; nityam- eternally; virajam- without contamination; saniitanam-without beginning; sraddhiifaith; tapa�-austerity; mmigala-auspicious; mauna-silence; sarhyama*controlling the mind and senses; samiidhinii-with full concentration;

870 Srimad- Bhagavatam [Canto 4, Ch . 21

bibhrati-illuminates; ha-as he did it; artha-the real purpose of the Vedas; dr�taye- for the purpose of finding out; yatra-wherein; idam-all this; iidarse-in a mirror; iva-like; avabhiisate-manifests.

TRANSLATION

In brahminical culture a brahmaQ.a's transcendental position is eternally maintained because the injunctions of the Vedas are accepted with faith, austerity, scriptural conclusions, full sense and mind control and meditation. In this way the real goal of life is illuminated, just as one's face in a clear mirror is fully reflected.

PURPORT

Since it is described in the previous verse that feeding a living briihmaT}a is more effective than offering oblations in a fire sacrifice, in this verse it is now clearly described what brahminism is and who a briihma�w is. In the age of Kali, taking advantage of the fact that by feeding a briihmaT}a one obtains a more effective result than by performing sacrifices, a class of men with no brahminical qualifications claim the eating privilege known as briihmaT}a-bhojana simply on the basis of their births in briihmaT}a families. In order to distinguish this class of men from the real briihmaT}aS, Maharaja Prthu is giving an exact description of a briihmaT}a and brahminical culture. One should not take advantage of his position simply to live like a fire without light. A briihmaT}a must be fully conversant with the Vedic conclusion, which is described in Bhagavad-g"itii. Vedais ca sarvair aham eva vedya�. (Bg. 15.15) The Vedic conclusion-the ultimate understanding, or Vedanta understanding-is knowledge of Kr�Q.a. Actually that is a fact because simply by understanding Kr�Q.a as He is; as described in Bhagavad-g"itii (janma karma ca me divyam evarh yo vetti tattvatal}), one becomes a perfect briihmaf}a. The briihmaT}a who knows Kr�qa perfectly well is always in a transcendental position. This is also confirmed in Bhagavad-g"itii:

miirh ca yo 'vyabhiciireT)a bhakti-yogena sevate sa guT}iin samatztyaitiin brahma-bhuyiiya kalpate

"One who engages in full devotional service and who does not fall down in any circumstance at once transcends the modes of material nature and thus comes to the level of Brahman." (Bg. 14.26)

Therefore a devotee of Lord Kr�r;ta is actually a perfect briihmara. His situation is transcendental, for he is free from the four defects of condi-

Text 42] Instructions
871
by Maharaja Prthu

tional life, which are the tendencies to commit mistakes, to be iUusioned, to cheat and to possess imperfect senses. A perfect Vai�l).ava or Kr�t:J.a conscious person is always in this transcendental position because he speaks according to Kr�t:J.a and His representative. Because Vai�l).avas speak exactly according to the tune of Kr�t:J.a, whatever they say is free from these four defects. For example, Kr�t:J.a says in Bhagavad-g"itii that everyone should always think of Him, everyone should become His devotee, offer Him obeisances and worship Him, andultimatelyeveryone should surrender unto Him.These devotional activities are transcendental and free from mistakes, illusion,cheating and imperfection. Thereforeanyone whois a sincere devotee of Lord Kr�t:J.a and who preaches this cult, speaking only on the basis of Kr�l).a's instructions, is understood to be virajam, orfreefrom the defects of material contamination. A genuine briihmar;w or Vai�l).ava therefore depends eternally on the conclusion of the Vedas or Vedic versions presented by the Supreme Personality of Godhead Himself. Only from Vedic knowledge can we understand the actual position of the Absolute Truth, who, as described in Siimad-Bhiigavatam, is manifested in three features-namely, impersonal Brahman, localized Paramatma and at last the Supreme Personality of Godhead. This knowledge is perfect from time immemorial, and the brahminical or Vai�l).ava culture depends on this principle eternally. One should therefore study the Vedas with faith, not only for one's personal knowledge, but for the sake of spreading this knowledge and these activities through real faith in the words of the Supreme Personality of Godhead and the Vedas.

The word mangala ("auspicious") in this verse is very significant. Srila Sridhara Svami quotes that to do what is good and to reject what is not good is called mm1.gala, or auspicious. To do what is good means to accept everything which is favorable to the discharge of devotional service, and to reject what is not good means to reject everything not favorable for discharging devotional service. In our Kr�t:J.a consciousness movement, we accept this principleby rejectingfour prohibiteditems-namely, illicit sexlife, intoxication, gambling and flesh-eating-andaccepting the daily chanting of atleastsixteenrounds ofthe Hare Kr�l,la mahii-mantra and daily meditation threetimes a daybychanting the Gayatri mantra. In this way one can keep his brahminical culture and spiritual strength intact. By following these principles of devotional service strictly, chanting twenty-four hours a day the mahii-mantra-H.are Kr�t:J.a, Hare Kr�1�a, Kr�l,la Kr�l,la, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare-one makes positive progress in spiritual life and ultimately becomes completely fit to see the Supreme Personality of Godhead face to face. Because the ultimate goal of studying

872 Srimad-Bhagavatam [Canto 4, Ch. 21

or understanding the Vedic knowledge is to find Kr�J;!a, one who follows the Vedic principles as described above can from the very beginning see all the features of Lord Kr�J;!a, the Absolute Truth, very distinctly, as one can see his own face completely reflected in a clear mirror. The conclusion is, therefore, that a briihmarta does not become a briihmarta simply because he is a living entity or is born in a briihmm:w family; he must possess all the qualities mentioned in the siistras and practice the brahminical principles in his life. Thus he ultimately becomes a fully Kr�J;la conscious person and can understand what Kr�J;la is. How a devotee continuously sees Kr�J;la face to face within his heart is described in the Brahma-sarhhitii as follows:

premiiiijana-cchurita-bhakti-vilocanena santalt sadaiva hrdaye�u vilokayanti yarh syiimasundaram acintya-gur-a-svaruparh govindam iidi-puru�arh tam aharh bhajiimi

The devotee, by development of pure love for Kr�J;la, constantly sees the Supreme Personality of Godhead, who is known as Syamasundara, within his heart. That is the perfectional stage of brahminical culture.

TEXT43

q fwt�i(1 Rn � Wf� dgun

te�iim aharh piida-saroja-rertum iiryii vaheyiidhikintam iiyult yarh nityadii bibhrata asu paparit nasyaty amurh sarva-gur-ii bhajanti

te�iim-of all of them; aham-1; piida-feet; saroja-lotus; re(lum-dust; iiryiib--0 respectable persons; vaheya - shall bear; adhi-up to; kirztamhelmet; iiyu� - up to the end of life; yam-which; nityadii-always ; bibhrata�-carrying; iisu-very soon; piipam-sinful activities; nasyati-are vanquished; amum-all those; sarva-gu(lii�- fully qualified; bhajanti-worship. TRANSLATION

0 respectable personalities present here, I beg the blessings of all of you that I may perpetually carry on my crown the dust of the lotus feet of such

Text43] Instructions by Maharaja Pr:thu 873
qai((1U�:t�«�•Nfctiul+la!: 1

brahma1,1as and Vai�1,1avas until the end of my life_ He who can carry such dust on his head is very soon relieved of all the reactions which arise from sinful life, and eventually he develops all good and desirable qualities.

PURPORT

It is said that one who has unflinching faith in the Supreme Personality of Godhead, which means unflinching faith in the Vai�Q.ava or the pure devotee of the Supreme Lord, develops all the good qualities of the demigods.

yasyiisti bhaktir bhagavaty akincanii sarvair gurais tatra samiisate surii[l (Bhiig. 5.18.12)

Prahlada Maharaja also said, na�iirh matis tiivad urukramiinghrim. (Bhiig. 7.5.32) Unless one takes the dust of the lotus feet of a pure Vai�Q.ava on one's head, one cannot understand what the Supreme Personality of Godhead is, and unless one knows the Supreme Personality of Godhead, one's life remains imperfect. A great soul who has fully surrendered to the Supreme Lord after understanding Him fully and after repeatedly undergoing austerities and penances for many, many lives is very rare. The crown of a king is simply a big load if the king or head of the state does not actually bear the dust of the lotus feet of briihma[�-as and Vai�l,lavas. In other words, if a liberal king like Prthu Maharaja does not follow the instructions of briihmar-as and Vai�Q.avas or does not follow the brahminical culture, he is simply a burden on the state, for he cannot benefit the citizens. Maharaja Prthu is the perfect example of an ideal chief executive.

TEXT44

gur-iiyanarh sila-dhanarh krta-jnarh

vrddhiiSrayarh sarhvrf!-ate 'nu sampada[l

prasi:datiirh brahma-kularh gaviirh ca janiirdana[l siinucara5 ca mahyam

gu'!a-ayanam-one who has acquired all the good qualities; sila-dhanamone whose wealth is good behavior; krta-jnam-one who is grateful; vrddha­

iiSrayam-one who takes shelter of the learned; sarhvrr-ate- achieves ; anu-

874 Srimad-Bhagavatam [Canto 4, Ch_ 21

certainly;sampada� - all opulences;prasi"datam-be pleased upon; brahmakulam-the brahmar-a class; gavam-the cows; ca-and; janiirdana�-the Supreme Personality of Godhead; sa-with; anucara� -along with His devotee; ca-and; mahyam-upon me.

TRANSLATION

Whoever acquires the brahminical qualifications-whose only wealth is good behavior, who is grateful and who takes shelter of experienced persons-gets all the opulence of the world. I therefore wish that the Supreme Personality of Godhead and His associates will be pleased with the brahma�a class, with the cows and with me.

PURPORT

The Supreme Personality of Godhead is worshiped with the prayer nama brahmar-ya-devaya go-brahma!!a-hitaya ca. Thus it is clear that the Supreme Personality of Godhead respects and protects the brahmarws and brahminical culture as well as the cows;in other words, wherever there are briihmar-as and brahminical culture, there are cows and cow protection. In a society or civilization in which there are no brahma[Las or brahminical culture, cows are treated as ordinary animals and slaughtered at the sacrifice of human civilization. The specific mention of the word gavam by Prthu Maharaja is significant because the Lord is always associated with cows and His devotees. In pictures Lord Kp§l)ais always seen with cows and His associates such as the cowherd boys and the gopis. Kr�Da, the Supreme Personality of Godhead, cannot be alone. Therefore Prthu Maharaja said, sanucaras ca, indicating that the Supreme Personalityof Godhead is always associated with His followers and devotees.

A devotee acquires all the good qualities of the demigods; he is gu!!tiyanam, the reservoir of all good qualities. His only asset is good behavior, and he is grateful. Gratitude for the mercy of the Supreme Personality of Godhead is one of the qualities of brahmartas and Vai�I;tavas. Everyone should feel grateful to the Supreme Personality of Godhead because He is maintaining all living entities and supplying all their necessities. As stated in the Vedas, eko bahunam yo vidadhati kiimiin: the Supreme One is supplying all necessities to tht; living entities (Katha Up. 2.2.13). The living entity who is therefore grateful to the Supreme Personality of Godhead is certainly qualified with good characteristics.

The word vrddhasrayam is very significant in this verse. Vrddha refers to one who is advanced in knowledge. There are two kinds of old men-he who is advanced in years and he who is experienced in knowledge. One

Text 44] Instructions by Maharaja Prthu 875

who is advanced in knowledge is actually vrddha (jiiiina-vrddha); one does not become vrddha simply by advancing in age. Vrddhiisrayam, a person who takes shelter of a superior person who is advanced in knowledge, can acquire all the good qualities of a briihmar-a and be trained in good behavior. When one actually attains good qualities, becomes grateful for the mercy of the Supreme Personality of Godhead and takes shelter of a bona fide spiritual master, he is endowed with all opulence. Such a person is a briihmar-a or Vai�l).ava. Therefore Prthu Maharaja invokes the blessings and mercy of the Supreme Personality of Godhead, with His associates, devotees, Vai�l).avas, briihmar-as and cows. TEXT45

maitreya uviica iti bmviir-am nr-patim pitr-deva-dvijiitaya� tu�tuvur hr�ta-manasa� siidhu-viidena siidhava�

maitreya� uviica-the great sage Maitreya continued tO'speak; iti-thus; bruviir-am- while speaking; nr-patim-the King; pitr-the denizens of Pitrloka; deva-the demigods; dvijiitaya�- and the twice-born (the briihmar-as and the Vai�l).avas); tu�tuvu�-satisfied; hr� ta-manasa�-greatly pacified in mind; siidhu-viidena-by expressing congratulations; siidhava[t-all the saintly persons present.

TRANSLATION

The great sage Maitreya said: Mter hearing King Prthu speak so nicely, all the demigods, the denizens of Pitrloka, the brahmal).as and the saintly persons present at the meeting congratulated him by expressing their good will.

PURPORT

When a person speaks very nicely at a meeting, he is congratulated by the audience, who express their good will with the words siidhu, siidhu. This is called siidhu-viida. All the saintlypersons-Pitas, denizens of Pitrloka and demigods-who were present in the meeting and heard Prthu Maharaja expressed their good will with the words siidhu, siidhu. They all accepted the good mission of Prthu Maharaja, and they were fully satisfied.

876 Srimad- Bhagavatam [Canto4, Ch. 21
ij� iffl'il � iA1Uf � fftq:�fPRt•U I et,cn�;c �: ������

pur� �l'fitPIRtij�qffi

�: I illf(iC{('I: � �S�ij(:qq: 11\1,11

putrera jayate lokiin iti satyavatz srut*

brahma-da[!pa-hata� papo yad veno 'tyatarat tamafi,

putre[ta-by the son; jayate-one becomes victorious; lokiin-all the heavenly planets; iti-thus; satyavati-becomes true; srutift - the Vedas; brahma-da[!c},a-by the curse of briihma[tas; hata�-kil1ed; piipa�-the most sinful; yat-as; venafi, - the father of Maharaja Prthu; ati - great; ataratbecome delivered; tama�-from the darkness of hellishlife.

TRANSLATION

They all declared that the Vedic conclusion that one can conquer the heavenly planets by the action of a putra, or son, was fulfilled, for the most sinful Vena, who had been killed by the curse of the brahmal).as, was now delivered from the darkest region of hellish life by his son, Maharaja Prthu.

PURPORT

According to the Vedic version, there is a hellish planet called Put, and one who delivers a person from there is called putra. The purpose of marriage is, therefore, to have a putra or sonwho is able to deliver his father, even if the father falls down to the hellish condition of Put. Maharaja J>rthu's father, Vena, was a most sinful person andwas therefore cursed to death by the briihmar;tas. Now all the great saintly persons, sages and brahmaryas present in the meeting, after hearing from Maharaja Prthu about his great mission in life, became convincedthatthestatementofthe Vedas had been fully proved. The purpose of accepting a wife in religious marriage, as sanctioned in the Vedas, is to have a putra, a son qualified to deliver his father from the darkest region of hellish life. Marriage is not intended for sense gratification but for getting a son fully qualified to deliver his father. But if a son is raised to become an unqualifieddemon,how canhe deliverhis father from hellish life? It istherefore the duty ofafather to become a Vai�Qava and raise his children to become Vai�Qavas; then even if by chance the father falls into a hellish life inhis next birth, such a son can deliver him, as Maharaja Prthu delivered his father.

Text46]
Instructions by
TEXT46
877

f«w4•Rlslf1W AA��·u�.(l:

TEXT 47

¥tiii'4Rl�qJ ijl{: I

�IG\4His¥11i'4�t: II\1\SII

hirar-yakasipus capi bhagavan-nindaya tamal;t vivik�ur atyagat sunol;t prahliidasyanubhavatal;t

hirm;tyakasipu�-the father of Prahlada Maharaja; ca-also; api-again; bhagava t- of the Supreme Personality of Godhead; nindaya-by blaspheming; tamal;t-in the darkest region of hellish life; vivik�ul;t-entered; atyagat-was delivered; sunol;t-of his son; prahliidasya-of Maharaja Prahlada; anubhiivatal;t-by the influence of.

TRANSLATION

Similarly, HiraHakasipu, who by dint of his sinful activities always defied the supremacy of the Supreme Personality of Godhead, entered into the darkest region of hellish life; but by the grace of his great son, Prahlada Maharaja, he· also was delivered and went back home, back to Godhead.

PURPORT

When Prahlada Maharaja was offered benediction by Nrsimhadeva, due to his great devotion and tolerance he refused to accept any benediction from the Lord, thinking that such acceptance was not befitting a sincere devotee. The rendering of service to the Supreme Personality of Godhead . in expectation of a good reward is deprecated by Prahlada Maharaja as mercantile business. Because Prahlada l\laharaja was a V ai�l).ava, he did not ask benediction for his personal self but was very affectionate towards his father. Although his father tortured him and would have killed him had he himself not been killed by the Supreme Personality of Godhead, Prahlada Maharaja begged pardon for him from the Lord. This favor was immediately granted by the Lord, and Hiral).yakasipu was delivered from the darkest region of hellish life, and he returned back home, back to Godhead, by the grace of his son. Prahlada Maharaja is the topmost example of a Vai�l).ava who is always compassionate toward sinful persons suffering a hellish life within this material world. Kr�l).a is therefore known as paradu�kha-duftkh"i krpiimbudhi, or one who is compassionate toward others' suffering and who is an. ocean of mercy. Like Prahlada Maharaja, all pure

878 Srimad-Bhagavatam
[Canto 4, Ch. 21

devotees of the Lord come to this material world with full compassion to deliver the sinful. They undergo all kinds of tribulations, suffering them with tolerance, because that is another qualification of a Vai�Q.ava, who tries to deliver all sinful persons from the hellish conditions of material existence. Vai�Q.avas are therefore offered the following prayer:

viiiicha-k alpatarubhyas ca krpii-sindhubhya eva ca patitiiniirh piivanebhyo vai§r-avebhyo nama nama�

The chief concern of a Vai�Q.ava is to deliver the fallen souls.

TEXT48

��:�:�:QRrm'f.Rft: 1

4�ffi� 11fS: ij�Jift¥tdft 11\l�ll

vira-varya pita� prthvyii� samii� saiifiva siisvati[l. yasyedrsy acyute bhakti[l. sarva-lokaika-bhartari

vira-varya- the best of the warriors; pita[�.- the father ; prthvyii[l.- of the globe; samii� - equal to in years; sarijiva-live; siisvat"Qt - forever; yasyawhose; idr5z- Like this; acyute-unto the Supreme; bhakti�-devotion; sarva- all ; loka - planets; eka- one; bhartari-maintainer.

TRANSLATION

All the saintly brahmai;J.as thus addressed Pfthu Maharaja: 0 best of the warriors, 0 father of this globe, may you be blessed with a long life, for you have great devotion to the infallible Supreme Personality of Godhead, who is the master of all the universe.

PURPORT

Prthu Maharaja was blessed bythe saintlypersons present at the meeting to have a Long life because of his unflinching faith and his devotion to the Supreme Personality ofGodhead. Although one's duration of life is limited in years, if bychance onebecomes a devotee, he surpasses the duration prescribed for his life; indeed, sometimes yogis die according to their wish, not according to the laws of material nature. Another feature of a devotee is that he lives forever because of his infallible devotion to the Lord. It is said, k"irtir yasya sa jivati: "One who leaves a good reputation behind him

Text48) Instructions
879
by Maharaja Pfthu

lives forever." Specifically, one who is reputed as a devotee of the Lord undoubtedly lives forever. When Lord Caitanya Mahaprabhu was talking with Ramananda Raya, Caitanya Mahaprabhu inquired, "What is the greatestreputation?" Ramananda Raya replied thata personwhois reputed as a great devotee has the greatest reputation, for a devotee not only lives forever in the Vaikul).tha planets, but by his reputation he also lives forever within this material world.

TEXT 49

aho vayarh hy adya pavitra-kTrte tvayaiva nathena mukunda-nathafi, ya uttamaslokatamasya vi�[!or brahma[!ya-devasya katharh vyanakti

aho- 0 goodness; vayam- we; hi-certainly; adya-today; pavitra-kirte0 supreme purity; tvaya- by you; eva-certainly; niithena-by the Lord; mukunda-the Supreme Personality of Godhead; niithiiQ--being the subject of the Supreme; ye-one who; uttamaslokatamasya-of the Supreme Personality of Godhead, who is praised by the nicest verses; V�[!oQ-- of Vi�J}.u; brahma[!ya-devasya-of the worshipable Lord of the brahma[!as; kathiim- words; vyanakti-expressed .

TRANSLATION

The audience continued: Dear King Ptthu, your reputation is the purest of all, for you are preaching the glories of the most glorified of all, the Supreme Personality of Godhead, the Lord of the brahmal}.as. Since, due to our great fortune, we have you as our master, we think that we are living directly under the agency of the Lord.

PURPORT

The citizens declared that through being under the protection of Maharaja Ptthu they were directly under the protection of the Supreme Personality of Godhead. This understanding is the proper situation of social steadiness within this material world. Since it is stated in the Vedas that the Supreme Personality of Godhead is the maintainer and leader of

880 Srimad-Bhagavatam [Canto 4, Ch. 21
n qA!tifft6 � UP.::"IIqU � �<itEMif� ftqftsilf'R4\q� � OllwtRti 11\l,ll

all living entities, the king or the executive head of the government must be a representative of the Supreme Person. Then he can claim honor exactly like the Lord's. How a king or leader of society can become the representative of the Supreme Personality of Godhead is also indicated in this verse by the statement that because Prthu Maharaja was preaching the supremacy and the glories of the Supreme Personality of Godhead, Vi�QU, he was therefore a proper representative of the Lord. To remain under the jurisdiction or administration of such a king or leader is the perfect status for human society. The primary responsibility of such a king or leader is to protect the brahminical culture and the cows in his state.

TEXT 50

�IEifiM: Wfl'l (fct1'5ft&liiS\IItt:iti( I

���tflQqRr:Cfi�ll€4f:itli( II� olf

niityadb!J.utam idarh niitha tavajwyiinusiisanam

prajiinuriigo mahatarh

prakrtift karup,iitmanam

na-not; ati-very great; adbhutam-wonderful; idam-this; niitha-0 lord; tava-your; iijivya-source of income; anusiisanam-ruling over the citizens; praja-citizens; anuriiga�-affection; mahatiim-of the great; prakrt*-nature;karup,a-merciful;iitmanam-of the living entities.

TRANSLATION

Our dear lord, it is your occupational duty to rule over your citizens. That is not a very wonderful task for a personality like you, who are so affectionate in seeing to the interests of the citizens, because you are full of mercy. That is the greatness of your character.

PURPORT

A king's duty is to give protection to his citizens and levy taxes from them for his livelihood. Since the ·Vedic society is divided into four classes of men-the bnihmarws, k§atriyas, vaisyas and sudras-their means of livelihood are also mentioned in the scriptures. The briihmar-as should live by spreading knowledge and therefore should take contributions from their disciples, whereas a king should give protection to the citizens for their development to the highest standard of life, and he can therefore

Text 50] Instructions by
881
Maharaja Prthu

levy taxes from them; businessmen or mercantile men, because they produce foodstuffs for the whole of society, can take a little profit from this, whereas the sudras, who cannot work as either brahma[taS, k�atriyas or vaisyas, should give service to the higher classes of society and be provided by them with a supply of the necessities of life.

The symptom of a qualified king or political leader is mentioned herein-he must be very merciful and compassionate to the people and see to their prime interest, which is to become elevated devotees of the Supreme Personality of Godhead. Great souls are naturally inclined to do good to others, and a Vai�Q.ava especially is the most compassionate and merciful personality in society. Therefore we offer our respects to a Vai�Q.ava leader as follows:

viifichii-kalpatambhyas ca k.rpii-sindhubhya eva ca patitiiniim piivanebhyo vai�[tavebhyo namo nama�

Only a Vai�Q.ava leader can fulfill all the desires of the people (viinchiikalpataru), and he is compassionate because he is the contributor of the greatest benefit to human society. He is patita-pavana, the deliverer of all fallen souls, because if the king or the head of the government follows in the footsteps of the briihmar-as and Vai�Q.avas, who are naturally leaders in missionary work, similarly the vaisyas will also follow in the footsteps of the Vai�I}avas and bnihmar-as, and the sudras will give them service. Thus the entire society becomes a perfect human institution for combined progress to the h�ghest perfection of life.

TEXT51

� �: Ql�=ctl41(11��u !Pit 1

iill�ffl lif!t!\;wf 4i��i!4Q�: 11'-\ �II

adya nas tamasa� paras tvayopiisiidita� prabho bhriimyatiirh na�ta-dr�finiirh karmabhir daiva-sarhjiiita*

adya-today; na�-of us; tamasa�-of the darkness of material existence; piira�-other side; tvayii-by you; upiisiidita�- increased ; prabho-0 lord; bhriimyatiim-who are wandering; n�ta-dr�tiniim- who have lost their goal of life; karmabh*-on account of past deeds; daiva-sarhjiiitai�arranged by superior authority.

882 Srimad-Bhagavatam [Canto 4, Ch. 21

The citizens continued: Today you have opened our eyes and revealed how to cross to the other side of the ocean of darkness. By our past deeds and by the arrangement of superior authority, we are entangled in a network of fruitive activities and have lost sight of the destination of life; thus we have been wandering within the universe.

PURPORT

In this verse, the words karmabhir daiva-sarhjiiita* are very significant. Due to the quality of our actions, we come to the association of the modes of material nature, and by superior arrangement we are given a chance to enjoy the fruitive results of such activities in different types of bodies. In this way, having lost sight of their destinations in life, all living entities are wandering in different species throughout the universe, sometimes getting birth in a lower species and sometimes existencein higher planetary systems; thus we are all wandering since time immemorial. It is by the grace of the spiritual master and the Supreme Personality of Godhead that we get the clue of devotional life, and thus progressive success in our life begins. Here this is admitted by the citizens of King Prthu; in full consciousness thty admit the benefit they have derived from the activities of Maharaja PJ;thu.

TEXT 52

� Mt'((1"'41q � � I

� Ql t4SI¥UA�q A'4t\tt( ��liiQI ����II

nama vivrddha-sattviiya puru�iiya mahiyase

yo brahma kflatram iivisya bibhartidarh sva-tejasa

nama�-a11 obeisances; vivrddha-highly elevated; sa ttviiya-unto the existence; puru�iiya- unto the person; mahTyase-unto one who is so glorified; ya�-who; brahma-brahminical culture; k�atram-administrative duty; iivisya- entering; bibharti-maintaining; idam-this; sva-tejasii-by his own prowess.

TRANSLATION

Dear lord, you are situated inyour pure existentialposition of goodness; therefore you are the perfect representative of the Supreme Lord. You

Text 52) Instructions by
883
Maharaja Prthu
TRANSLATION

are glorified by your own prowess, and thus you are maintaining the entire world by introducing brahminical culture and protecting everyone in your line of duty as a �atriya.

PURPORT

Without the spread of brahminical culture and without proper protection from the government no social standard can be maintained properly. This is admitted in this verse by the citizens of Maharaja Prthu, who could maintain the wonderful situation of his government due to his position in pure goodness. The word vivrddha-sattvaya is significant. In the material world there are three qualities-namely, goodness, passion and ignorance. One has to be raised from the platform of ignorance to the platform of goodness by devotional service. There is no other means for elevating one from the lowest stage of life to the highest stage but the execution of devotional service; as advised in the previous chapters of Sfimad-Bhagavatam, one can raise himself from the lowest position to the highest simply by associating with devotees and hearing Sfimad-Bhagavatam regularly from their mouths.

srrwatiim sva-kathii[l kr§T_la[l purzya-sravarza-k"irtana[l hrdy anta[l-stho hy abhadrar-i vidhunoti su-hrt satiim (Bhiig. 1.2.17)

"When one engages in devotional service in the first stages of hearing and chanting, the Lord who is in everyone's heart helps the devotee in cleansing his heart." In the gradual cleansing process one is relieved of the influence of passion and ignorance and is situated on the platform of goodness. The result of association with the qualities of passion and ignorance is that one becomes lusty and greedy. But when one is elevated to the platform of goodness, he is satisfied in any condition of life and is without lust and greed. This mentality indicates one's situation on the platform of goodness. One has to transcend this goodness and raise himself to the pure goodness which is called vivrddha-sattva or the advanced stage of goodness. In the advanced stage of goodness one can become Kr�qa conscious. Therefore Maharaja Prthu is addressed here as vivrddha-sattva, or one who is situated in the transcendental position. But Maharaja Prthu, although situated in the transcendental position of a pure devotee, comes down to the position of brahmarza and k.satriya for the benefit of human society and thus gives protection to the entire world by his personal prowess. Although he was a king, a k§atriya,

884 Srimad-Bhagavatam [Canto 4, Ch. 21

because he was a Vai!)p.ava he was also a briihma'{'a. As a briihma'{'a he could give proper instruction to the citizens and as a k§atriya he could rightly give protection to all of them. Thusthe citizens of Maharaja Prthu were protected in all respects bythe perfect king.

Thus end the Bhaktivedanta purports of the Fourth Canto, Twenty-first Chapter of the Srimad-Bhagavatam entitled, "Instructions by Mahiiriija Prthu."

Text 52 Instructions
885
by Maharaja Prthu

CHAPTER TWENTY-TWO

Prthu Maharaja's Meeting with the Four Kumaras

TEXT I

itill �

� !�4JOUI��fi q �Nsti+t4( I

6!tlqlil•lftit��: �C4�: II � II

maitreya uviica

janefiU pragrrzatsv evam

prthum prthula-vikramam

tatropajagmur munayas

catviira� surya-varcasa�

maitreya� uviica-the great sage Maitreya continued to speak; janefiuthe citizens; pragrrzatsu-while praying for; evam-thus; prthum-unto Maharaja Prthu; prthula-highly ; vikramam-powerful; tatra-there; upajagmu�-arrived;munaya�-the Kumiiras;catvara�-four; surya-as the sun; varcasa�-bright.

TRANSLATION

The great sage Maitreya said: While the citizens were thus praying to the most powerful King frthu, the four Kumaras, who were as bright as the sun, arrived on the spot.

TEXT 2

�ffi(lQOW{OO�Sqij(fflSRftfl I

�liifilit4NIW{� lUJT'f.������II

tiims tu siddhesvariin riijii

vyomno 'vatarato 'rcifill

lokiin apiipiin kurviirziin

siinugo 'cafita lak§itiin

887

'tan-them; tu-but; siddhesvaran-masters of all mystic power; raja-the King; vyomna�-from the sky; avatarata�-while descending; arci�a-by their glaring effulgence; lokan-all the planets; apapan-sinless; kurvartiindoing so; sa-anuga�-with his associates; aca�ta-recognized; lak�itan-by seeing them.

TRANSLATION

When the King and his associates saw the glowing effulgence of the four Kumaras, the masters of all mystic power, they could recognize them as they descended from the sky.

PURPORT

The four Kumaras are described herein as siddhesvaran, which means "masters of all mystic power." One who has attained perfection in yoga practice immediately becomes master of the eight mystic perfectionsto become smaller than the smallest, to become lighter than the lightest, to become bigger than the biggest, to achieve anything he desires, to control everything, etc. These four Kumaras, as siddhesvaras, had achieved all the yogic perfectional achievements, and as such they could travel in outer space without machines. While they were coming to Maharaja Prthu from other planets, they did not come by airplane, but personally. In other words, these four Kumaras were also spacemen who could travel in space without machines. The residents of the planet which is known as Siddhaloka can travel in outer space from one planet to another without vehicles. However, the special power of the Kumiiras mentioned herewith is that whatever place they went to would immediately become sinless. During the reign of Maharaja Prthu, everything on the surface of this globe was sinless, and therefore the Kumaras decided to see the King. Ordinarily they do not go to any planet which is sinful.

TEXT3

tad-darsanodgatan pra�an pratyaditsur ivotthita� sa-sadasyanugo vainya indriyeso gu[tlin iva

tat-him; darsana-seeing; udgatan-being greatly desired; prartan-life; pratyaditsub,-peacefully going; iva-like; utthita�-got up; sa-with;

888 Srimad-Bhagavatam [Canto 4, Ch. 22
6C:ti'11�61"{snut'FtS4�1f4\�R(t�ij: I ijQ�4MI�ift � �� !JOIIPwl€4 II� II

sadasya-associates or followers; anuga�-officers; vainya�-King Prthu; indriya-iSa�- a living entity; gur-iin iva-as influenced by the modes of material nature.

TRANSLATION

Seeing the four Kumaras, Prthu Maharaja was greatly anxious to receive them. Therefore the King, with all his officers, very hastily got up so anxiously that he is compared herewith to a conditioned soul whose senses are immediately attracted by the modes of material nature.

PURPORT

In Bhagavad-gita it is said:

prakrte� kriyamar-ani gur-aifl. karmar-i sarvasa�

ahahkiira-vimuflhatma kartiiham iti manyate. (Bg. 3.27)

Every conditioned soul is influenced by a particular mixture of the modes of material nature. As such, the conditioned soul is attracted to certain types of activity which he is forced to perform because he is completely under the influence of material nature. Here Prthu Maharaja is compared to such a conditioned soul, not because he was a conditioned soul hut because he was so anxious to receive the Kumaras that it was as if without them he would have lost his life. The conditioned soul is attracted by the objects of sense gratification. His eyes are attracted to see beautiful things, his ears are attracted to hear nice music, his nose is attracted to enjoy the aroma of a nice flower, and his tongue is attracted to tastenice food. Similarly, all his other senses-his hands, his legs, his belly, his genitals, his mind, etc.-are so susceptible to the attraction of the objects of enjoyment that he cannot restrain himself. Prthu Maharaja, in the same way, could not restrain himself from receiving the four Kumaras, who were bright by dint of their spiritual progress, and thus not only he himself hut also his officers and associates all received the four Kumaras. It is said, "Birds of a feather flock together." In this world, everyone is attracted by a person of the same category. A drunkard is attracted to persons who are also drunkards. Similarly, a saintly person is attracted by other saintly persons. Prthu Maharaja was in the topmost position of spiritual advancement, and as such, he was attracted by the Kumaras, who were of the same category. It is said, therefore, that a man is known by his company.

Text 3] P:rthu Maharaja's Meeting with the Four Kumaras 889

TEXT4

•ft�ct1Cif>;t6: �: 5f"'�lwtt1Efi"\\�:I

�- •ztl61"'1tullijWfiW{II '«i II

gauraviid yantrita� sabhya� prasrayiinata-kandharal;t vidhivat piijayiiiicakre

grhTtiidhyarhal)iisaniin

gauravat-glories; yantrita�-completely; sabhyal;t-most civilized; prasraya-by humbleness; anata-kandhara�-bowing down his shoulder; vidhivat-according to the instructions of the siistra; pujayiim-by worshiping; cakre-performed; grh"i"ta-accepting; adhi-including; arhal)a-paraphernalia for reception; asanan-sitting places.

TRANSLATION

When the great sages accepted their reception, according to the instructions of the sastras, and finally took their seats offered by the King, the King, influenced by the glories of the sages, immediately bowed down. Thus he worshiped the four Kumaras.

PURPORT

The four Kumaras are the parampara spiritual masters of the Vai�J).ava sampradaya. Out of the four sampradayas, namely Brahma-sampradaya, Sri-sampradaya, Kumara-sampradaya and Rudra-sampradaya, the disciplic succession of spiritual master to disciple known asthe Kumiira-sampradaya is coming down from the four Kumaras. So Prthu Maharaja was very re· spectful to the sampradiiya-iiciiryas. As it is said by Srila Visvanatha Cakravarti Thakura, siik�iid-dharitvena samasta-siistrair: a spiritual master or the paramparii-acarya should be respected exactly like the Supreme Personality of Godhead. The word vidhivat is significant in this verse. This means that Prthu Maharaja also strictly followed the injunctions of the siistra in receiving a spiritual master or acarya of the transcendental disciplic succession. Whenever an iicarya is seen, one should immediately bow down before him. Prthu Maharaja did this properly; therefore the words used here are prasrayanata-kandhara[t. Out of humility, he bowed down before the Kumaras.

890 Srimad-Bhagavatam [Canto4, Ch. 22
TEXTS I � �tit 1'ti41"1i4(;ttr.t�II'-\II

Prthu Maharaja's Meeting with the Four Kumaras

tat-pada-sauca-salilair

mO.rjitalaka-bandhana� tatra

s7lavatarh vrttam

acaran miinayann iva

tat-pada-their lotus feet; sauca-washed; salilail.z-water; marjitasprinkled; alaka-hair; bandhana�-bunch j tatra-there; silavatiim-of the respectable gentlemen; vrttam-behavior; acaran-behaving ; manayanpracticing; iva-like.

TRANSLATION

After this, the King took the water which had washed the lotus feet of the Kumaras and sprinkled it over his hair. By such respectful actions, the King, as an exemplary personality, showed how to receive a spiritually advanced personality.

PURPORT

Sri Caitanya Mahaprabhu has said, iipani acari prabhu jivere sikhiiya. It is very well known that whatever Sri Caitanya Mahaprabhu taught in His life as iiciirya, He Himself practiced. When He was preaching as a devotee, although He was detected by severalgreat personalities to be the incarnation of Kr�t:J.a, He never agreed to be addressed as an incarnation. Even though one may be an incarnation of .Kr�t:J.a, or especially empowered by Him, he should not advertise that he is an incarnation. People will automatically accept the real truth in due course of time. Prthu Maharaja was the ideal Vai(>Q.ava king; therefore he taught others by his personal behavior how to receiveandrespect saintly persons like the Kumaras. When a saintly person comesto one's home,it is the Vedic custom to wash his feetfirst with water and then sprinkle this water over the heads of oneself and his family. Prthu Maharaja did this,for he was an exemplary teacher of the people in general.

TEXT6

Chi('IWf3114\wtiW{��qNEfilif I

�414tt+t4fiji: 5fuf: ���II�II

hii{akiisana iis"iniin

sva-dhi�[lye�v iva pavakiin

sraddhii-sarhyama-sarhyuktaft pr"itaft praha bhaviigrajiin

hiitaka-iisane-on the throne made of gold; iis"inan-when they were seated; sva-dh�rzye�u-on the altar; iva- like; pavakiin- the fire; sraddha-

Text6]
891

respect; sarhyama-restraint; samyukta�-being decorated with; ptita�pleased;praha-said;bhava-Lord Siva;agrajan- the elder brothers.

TRANSLATION

The four great sages were elder to Lord Siva, and when they were seated on the golden throne, they appeared just like fire blazing on an altar. Maharaja Prfhu, out of his great gentleness and respect for them, began to speak with great restraint as follows.

PURPORT

The Kumaras are described herein as the elder brothers of Lord Siva. When the Kumaras were born out of the body of Lord Brahma they were requested to get married and increase the population. In the beginning of the creation there was a great need of population;therefore Lord Brahma was creating one son after another and ordering them to increase. However, when the Kumaras were requested to do so, they declined. They wanted to remain brahmaciiri throughout life and be engaged fully in the devotional service of the Lord. The Kumaras are called naifithika-brahmaciiri, meaning they are never to marry. Because of their refusal to marry, Lord Brahma became so angry that his eyes became reddish. Out of his eyes, Lord Siva, or Rudra, appeared. The mode of anger is consequently known as rudra. Lord Siva also has a sampradaya party known as the Rudrasampradaya, and they are also known as Vai�Q.avas.

TEXT7

2�ffl

3fit 31Mf(d ftli lt - 'l�lq;u: I � � � �161��i•d :q- titfilfiu II\911

prthur 1waca aho acaritam kim me mangalam mangaliiyana� yasya vo dadanam hy iisid durdarsiiniim ca yogibh*

prthu� uviica-King Prthu spoke;aho-0 Lord;iicaritam-practice;kimwhat; me-by me; mangalam-good fortune; mangala-iiyanii�-0 personified good fortune;yasya-by which; va�-your; darsanam-audience; hicertainly;iisi"t-became possible;durdar.Saniim-visible with great difficulty; ca-also;yogibhi�-by great mystic yogis.

892 Srimad-Bhagavatam [Canto 4, Ch. 22

King Ptthu spoke: My dear great sages, auspiciousness personified, it is very difficult for even the mystic yogis to see you. Indeed, you are very rarely seen. I do not know what kind of pious activity I performed for you to grace me by appearing before me without difficulty.

PURPORT

When something uncommon happens in one's progressive spiritual life, it should be understood to be incurred by ajniita-sukrti, or pious activities beyond one's knowledge. To see personally the Supreme Personality of Godhead or His pure devotee is not an ordinary incident. When such things happen, they should be understood to be caused by previous pious activity, as confirmed in Bhagavad-gltii: ye�iim tv anta-gatam piipam janiiniim purtya-karmartiim (Bg. 7.28). One who is completely freed from all the resultant actions of sinful activities and who is absorbed only in pious activities can engage in devotional service. Although Maharaja Prthu's life is full of pious activities, he was wondering how his audience with the Kumaras happened. He could not imagine what kind of pious activities he had performed. This is a sign of humility on the part of King Prthu, whose life was so full of pious activities that even Lord Vi�QU also came to see him and predicted that the Kumaras would also come.

TEXT8

fti � �J+tij(fit' � � � I �g�iijftm��:ll �II

kim tasya durlabhataram

iha loke paratra ca yasya viprii� pras"idanti sivo vi�fi,US ca siinugal;t

kim - what ; tasya-his; durlabhataram-very rare to achieve; iha-in this world; loke-world; paratra-after death; ca - or; yasya-one whose; viprii�the briihmartas and Vai�Qavas; pras"idanti -become pleased; siva� -allauspicious; vi�rtu�- Lord Vi�Qu; ca-as well as; siinuga� -going along with.

TRANSLATION

Any person upon whom the brahmaQas and Vai�Qavas are pleased can achieve anything which is very rare to obtain in this world as well as after death. Not only that, but one also receives the favor of the auspicious Lord Siva and Lord Vi�Qu, who accompany the brahmaQas and Vai�Qavas.

Text 8) frthu Maharaja's Meeting with the Four Kumaras 893
TRANSLATION

PURPORT

The briihmar-as and. Vai�l).avas are the bearers of Lord Vi�l).u, the allauspicious. As confirmed in the Brahma-sarhhitii: premiiiijana-cchurita-bhakti-vilocanena santafl sadaiva hrdayefiu vilokayanti yam syiimasundaram acintya-gurza-svaruparh govindam adi-purufiarh tam aharh bhajiimi.

The devotees, out of their extreme love for Govinda, the Supreme Personality of Godhead, always carry the Lord within their hearts. The Lord is already in the heart of everyone, but the Vai�Q.avas and the briihmarzas actually perceive and see Him always in ecstasy. Therefore briihmarzas and Vai�l).avas are carriers of Vi�I).U. Wherever they go, Lord Vi�l).u, Lord Siva or the devotees of Lord Vi�I).U are all carried. The four Kumaras are briihmarzas, and they visited the place of Maharaja Prthu. Naturally Lord Vi�l).u and His devotees were also present. Under the circumstances, the conclusion is that when the briihmarzas and Vai�l).avas are pleased with a person, Lord Vi�I).U is also pleased. This is confirmed by Srila Visvanatha Cakravarfi Thakura in his eight stanzas on the spiritual master: yasya prasiidiid bhagavat-prasiidal;t. By pleasing the spiritual master, who is both briihmarza and Vai�l).ava, one pleases the Supreme Personality of Godhead. If the Supreme Personality of Godhead is pleased, then one has nothing more to achieve either in this world or after death.

TEXT9

����q4aJtsfit �r.t. 1

� ��� 311€4414 it� t�: II � II

naiva lakfiayate loko

lokiin paryatato 'pi yiin

yathii sarva-drsarh sarva

atmiinarh ye 'sya hetavafl

na- not;eva- thus;lakfiayate- can see;lokafl- people;lokiin- all planets; paryatatafl,-traveling; api-although; yiin-whom; yathii-as much as; sarva-drsam-the Supersoul;sarve-in all; iitmiinam-within everyone;yethose;asya-of the cosmic manifestation;hetavafl,-causes.

TRANSLATION

Prthu Maharaja continued: Although you are traveling in all planetary systems, people cannot know you, just as they cannot know the Supersoul, although He is within everyone's heart as the witness of everything. Even Lord Brahma and Lord Siva cannot understand the Supersoul.

894 Srimad-Bhagavatam [Canto 4, Ch. 22

In the beginning of the SrTmad-Bhiigavatam it is said: muhyanti yat suraya�. Great demigods like Lord Brahma, Lord Siva, Indra and Candra are sometimes bewildered trying to understand the Supreme Personalityof Godhead. It so happened that when Kr�l).a was present on this planet, Lord Brahma and King lndra also mistook Him. And what to speak of great yogis orjniinl:s who conclude that theAbsolute Truth, the Personality of Godhead, is impersonal? In the same way, great personalities and Vai�l).a s like the four Kumiiras are also invisible to ordinary persons, although they are traveling all over the universe in different planetary systems. When Sanatana Gosvami went to see Lord Sri Caitanya 1\Iaha· prabhu, he could not be recognized by Candrasekhara Acarya. The conclusi::;:- is that the Supreme Personality of Godhead is situated in every· one's heart, and His pure devotees, the Vai�l).avas, are also traveling all over the world, but those who are under the modes of material nature cannot understand the form of the Supreme Personality of Godhead, the source of this cosmic manifestation, or the Vai�l).avas. It is said, therefore, that one cannot see the Supreme Personality of Godhead or a Vai�l).ava with these material eyes. One has to purify his senses and engage in the service of the Lord. Then gradually one can realize who is the Supreme Personality of Godhead and who is a Vai�l).ava.

TEXT 10

� 3Ift�'l"f(: � 4lC��tt: I �

tAf4444.1-t4ft•u•(t:

adhanii api te dhanyii�

siidhavo grha-medhina� yad-grhii hy arha-varyiimbu­

trl)a-bhumTsvariivarii�

���011

adhanii[l.-not very rich; api-although; te-they; dhanyii[l.-glorious; siidhava[l.-saintly persons; grha-medhina�-persons who are attached to family life; yat-grhii[l.- whose house; hi-certainly; arha-varya- the most worshipable; ambu-water; trl)a-grass; bhiimi-land; iSvara-the master; avarii[l.-the servants.

TRANSLATION

A person who is not very rich and is attached to family life becomes highly glorified when saintly persons are present in his home. Everyone,

Text 10] P�thu Maharaja ' s Meeting with the Four Kumaras 895
PURPORT

including master and servants who are engaged in offering the exalted visitors water, sitting place, paraphernalia for reception, and the home itself, are also glorified.

PURPORT

Materially if a man is not very rich, he is not glorious, and spiritually if a man is too attached to family life, he is also not glorious. But saintly • persons are quite ready to visit the house of a poor man or a man who is attached to material family life. When this happens, the owner of the house and his servants are glorified because they offer water for washing the feet of a saintly person, sitting places and other things to receive him. The conclusion is that if a saintly person goes to the house of even an unimportant man, such a person becomes glorious by his blessings. It is therefore the Vedic system that a householder invite a saintly person in his home to receive his blessings. This system is still current in India, and therefore saintly persons, wherevertheygo,are hosted bythehouseholders, who in turn get an opportunity to receive transcendental knowledge. It is the duty of a sannyiis'i, therefore, to travel everywhere just to favor the householders who are generally ignorant of the values of spiritual life.

It may be argued that all householders are not very rich and that one cannot receive great saintly persons or preachers because they are always accompanied by their disciples. If a householder is to receive a saintly person, he has to receive his entourage also. It is said in the siistras that Durvasa Muni was always accompanied by 60,000 disciples and that if there was a little discrepancy in their reception, he would be very angry and would sometimes curse the host. The fact is that every householder, regardless of his position or economic condition, can atleastreceive saintly guests with great devotion and offer them drinking water, for drinking water is available always. In India the custom is that even an ordinary person is offered a glass of water if he suddenly visits and one cannot offer him foodstuff. If there is no water, then one can offer a sitting place, even if it is on straw mats. And if he has no straw mat, he can immediately cleanse the ground and ask the guest to sit there. Supposing that a householder cannot even do that, then with folded hands he can simply receive the guest, saying welcome. And if he cannot do that, then he should feel verysorryforhis poor condition andshedteru;s and simplyoffer obeisances with his whole family, wife and children. In this way he can satisfy any guest, even if he is a saintly person or a king.

896 Srimad-Bhagavatam [Canto 4, Ch- 22

TEXT ll WIMM*4i441t �R'ffil��ijaoqa:: I

ii'ltCIQI\�qi(l4fqP(��CfffRn: II��II

vyiiliilaya-druma vai te�v ariktiikhila-sampadaft yad-grhiis tirtha-piidiyapiidatirtha-vivarjitiift

vyiila-venomous serpents; iilaya -home; dru miift - tree; vai-certainly; te�u-in those houses; arikta- abundantly; akhila-all; sampada� - opulences; yat - that ; grhii�-houses; tirtha-piidiya-in relation withthe feet of great saintly persons; piida-tirtha-the water which washed their feet; vivarjitii�- without.

TRANSLATION

On the contrary, even though full of all opulence and material prosperity, any householder's house where the devotees of the Lord are never allowed to come in, and where there is no water for washing their feet, is to be cons'�"'red as a tree in which all venomous serpents live.

PURPORT

In this verse the word tirtha-piidiya indicates devotees of Lord Vi�l)U, or Vai�l)avas. As far as briihma[tas are concerned, in the previous verse the mode of reception has been already described. Now, in this verse, special stress is being given to the Vai�l)avas. Generally the sannyiisis, or those in the renounced order of life, take trouble to enlighten the householders. There are ekadafl!fi sannyiisis and trida[lf/i sannyiisis. The ekada[lf/i sannyiisis are generally followers of Sarikaracarya and are known as Mayavadl sannyiisis, whereas the trida!l!fi sannyiisis are followers of Vai�l)ava iiciiryas- Ramanujacarya, Madhvacarya andso on-and theytake trouble to enlighten the householders. Ekada[lf/i sannyiisis can be situated on the platform of pure Brahman because they are aware that the spirit soul is different from the body, but theyare mainly impersonalists. The Vai�l)avas know that theAbsoluteTruth is theSupreme Person and that the Brahman effulgence is based on the Supreme Personality of Godhead, as confirmed in the Bhagavad-gitii: brahma[to hi prati�thiiham (Bg. 14.27). The conclusion is that tirtha-piidiya refers to Vai�l)avas. In the Bhiigavatam there is also another reference: tirthikurvanti tirthiini. Wherever he goes, a Vai�l)ava

Text
ll) �thu Maharaja's Meeting with the Four Kumaras
897

immediately makes that place a firtha, a place of pilgrimage. The Vai�l)ava sannyiiszs travelall over the world to make everyplace a place of pilgrimage by the touch of their lotus feet. It is mentioned there that any house which does not receive a Vai�l)ava in the manner already explained in the previous verse is to be considered the residential quarters of venomous serpents. It is said that about the sandalwood tree, which is a very valuable tree, there is a venomous serpent. Sandalwood is very cold, and venomous serpents, because of their poisonous teeth, are always very warm, and they take shelter of the sandalwood trees to become cooler. Similarly, th.ere are many rich men who keep watchdogs or doormen and put up signs that say do not enter, trespassers not allowed, beware of the dog, etc. Sometimes in western countries a trespasser is shot, and there is no crime in such shooting. This is the position of demoniac householders, and such houses are considered to be the residential quarters of venomous snakes. The members of such families are no better than snakes because snakes are very much envious, and when that envy is directed to the saintly persons,their position becomes more dangerous. It is said by Cal)akya Pal)c;l.ita that there are two envious living entities, the snake and the envious man. The envious man is more dangerous than a snake because a snake can be subdued by charming mantras or by some herbs, but an envious person cannot be pacified by any means.

TEXT 12

� if f@�l!l 441l61PI �: I

�'111n�'lm��� ����II

sviigatarh vo dvija-sre�thii

yad-vratiini mumuk�ava�

caranti sraddhayii dhirii

biilii eva brhanti ca

sviigatam - welco me; va�-unto you; dvija-sre�thiif:i,-the best of the briihmaras; yat-whose; vratiini-vows; mumuk�avaf:i,-of persons desiring liberation; caranti-behave; sraddhayii-with great faith;dhiriif:i,-controlled; biiliif:i,-boys; eva-like;brhanti-observe; ca-also.

TRANSLATION

Maharaja Pfthu offered his welcome to the four Kumiiras, addressing them as the best of the brahmaQ.as. He welcomed them, saying: From the beginning of your birth you were strictly observing the vows of celibacy,

898 Srimad-Bhagavatam [Canto 4, Ch. 22

and although you are experienced in the path of liberation, you are keeping yourselves just like small children.

PURPORT

The specific importance of the Kumaras is that they were brahmaciir"is living Lhe life of celibacy from birth. They kept themselves as small children about four or five years old because by growing into youth one's senses sometimes become disturbed and celibacy becomes difficult. The Kumaras therefore purposefully remained children because in a child's life the senses are never disturbed by sex. This is the significance of the life of the Kumaras, and as such Maharaja Prthu addressed them as the best of the briihmal}as. The Kumaras were not only born of the best briihmal}a fT .ord Brahma), but they are addressed herein as dvija-sre�thii/:t (the best o; the briihmal}as) on account of their being Vai�r;tavas also. As we have already explained, they have their sampradiiya (disciplic succession),and even to date the sampradiiya is being maintained and is known as the Nimbarka-sampradaya. Out of the four sampradiiyas of the Vai�r;tava iiciiryas, the Nimbarka-sampradaya is one. Maharaja Prthu specifically appreciated the position of the Kumaras because they maintained the brahmacarya vow from the very beginning of their birth. Maharaja Prthu, however, expressed his great appreciation of Vai�r;tavism by addressing the Kumaras as Vai�T}ava-sre�tha. In other words,everyone shouldoffer respect to a Vai�t)ava without considering his source of birth. Vai§T}ave jiitibuddhi/:t. No one should consider a Vai�r;tava in terms of birth. The Vai�r;tava is always the best of the briihmal}as, and as such one should offer all respects to a Vai�r;tava, not only as a briihmal}a but as the best of the briihmarws.

TEXT 13

�: 1

&iMWCiql'f

qf<HUWCt II��II

kaccin na/:t kusalam niithii

indriyarthiirtha-vediniim

vyasanaviipa etasmin

patitanarh sva-karmabhi/:t

kaccit- whether; na/:t-our; kusalam- good fortune; natha/:t-0 masters; indriya-artha- sense gratification as the ultimate goal of life; artha-vediniim- persons who understand only sense gratification; vyasana- illness;

Text 13] Prthu Maharaja's Meeting with the Four Kumaras 899

avape-got; etasmin-in this material existence;patitanam-those who are fallen; sva-karmabhi�-by their own ability.

TRANSLATION

Prthu Maharaja inquired from the sages about persons entangled in this dangerous material existence because of their previous actions; could such persons, whose only aim is sense gratification, be blessed with any good fortune?

PURPORT

Maharaja Prthu did not ask the Kumaras about their good fortune, for the Kumii.ras are always auspicious by dint of their life in celibacy. Since they are always engaged on the path of liberation, there was no question of ill fortune. In other words, brahma[!as and Vai�l)avas who are strictly following the path of spiritual advancement are always fortunate. The question was asked by Prthu Maharaja for his own sake, since he was in the position of a grhastha and in charge of the royal authority. Kings are not only grhasthas, who are generally absorbed in sense gratification,but are sometimes employed to kill animals in hunting because they have to practice the killing art, otherwise it is very difficult for them to fight their enemies. Such things are not auspicious. Four kinds of sinful activities-associating with woman for illicit sex, eating meat, intoxication and gambling-are allowed for the k�atriyas. For political reasons, sometimes they have to take to these sinful activities. K�atriyas do not refrain from gambling. One vivid example is the Pap.pavas. When the Pat;�pavas \\!"ere challenged by the opposite party, Duryodhana, to gamble and risk their kingdom, they could not refrain, and by that gambling they lost their kingdom, and their wife was insulted. Similarly, the k�atriyas cannot refrain from fighting if challenged by the opposite party. Therefore Prthu Maharaja, taking consideration of all these facts, inquired whether there is any auspicious path. Grhastha life is inauspicious because grhastha means consciousness for sense gratification, and as soon as there is sense gratification, one's position is always full of dangers. This material world is said to be padarh padarh yad vipadam na tefiam, dangerous in every step (Bhag. 10.14.58). Everyone in this material world is struggling hard for sense gratification. Clearing all these points, Maharaja Prthu inquired from the four Kumaras about the fallen conditioned souls who are rotting in this material world due to their past bad or inauspicious activities. Is there any possibility for their auspicious spiritual life? In this verse, the word indriyarthartha-vedinam is very significant. It indicates

900 Srimad-Bhagavatam [Canto 4, Ch. 22

persons whose only aim is to satisfy the senses. They are also described as patitiiniim, or fallen. Only one who stops all activities for sense gratificationis consideredto be elevated. Another significantword is sva-karmabhift. One becomes fallen by dint of his own past bad activities. Everyone is responsible for his fallen condition because of his own activities. When activities are changed to devotional service, one's auspicious life begins.

TEXT 14

M�lfii�l 1I'Jf 91 � +t�lcqtf: II�\lll

bhavatsu kusala-prasna iitmiiriime�u ne�yate kusaliikusalii yatra na santi mati-vrttaya�

bhavatsu-unto you; kusala-good fortune; prasna�-question; iitmiirame�u-one whJ is always engaged in spiritual bliss; ne�yate-there is no needof;kusala-good fortune;akusala�-inauspiciousness;yatra-where; nanever; santi-exists; mati-vrttaya�-m enta] concoction.

TRANSLATION

Prthu Maharaja continued: My dear sirs, there is no need to ask about your good and bad fortune because you are always absorbed in spiritual bliss. The mental concoction of the auspicious and inauspicious does not exist in you.

PURPORT

In the Caitanya-caritamrta it is said:

'dvaile' bhadrabhadra-jnana, saba- 'manodharma' 'ei bhiila, ei manda,'-ei saba 'bhrama.'

(Cc. Antya 4.176)

In this material world the auspicious and inauspicious are simply mental concoctions because such things exist only due to association with the material world. This is called illusion or atma-miiya. We think ourselves created by material nature exactly as we think ourselves experiencing so many things in a dream. The spirit soul is, however, always transcendental. There is no question of becoming materially covered. This covering is simply something like a hallucination or a dream.In Bhagavad-gita itis also said, sangat saiijayate kiima� (Bg. 2.62). Simply by association we create

Text 14] Prthu Maharaja's Meeting with the Four Kumaras 901
� �'R 311�1�1�! � I

artificial material necessities. Dhyiiyato vi�ayiin ptuhsaft sahgas te�upajiiyate (Bg. 2.62). When we forget our real constitutional position and wish to enjoy the material resources, our material desires manifest, and we associate with.varieties of material enjoyment. As soon as the concoctions of material enjoyment are there, because of our association we create a sort of lust or eagerness to enjoy them, and when that false enjoyment does not actually make us happy, we create another illusion known as anger, and by the manifestation of anger, the illusion becomes stronger. When we are illusioned in this way, forgetfulness of our relationship with Kr�qa follows,and by thus losing Kr�11a consciousness,our real intelligence is defeated. In this way we become entangled in this material world. In Bhagavad-gitii it is said:

krodhiid bhavati sammoha[l sammohiit smrti-vibhramaft

smrti-bhrarhsad buddhi-niiso buddhi-nasat prar-asyati (Bg. 2.63)

By material association we lose our spiritual consciousness; consequently there is the question of the auspicious and inauspicious. But those who are iitmariima or self-realized have transcended such questions. The atmariimas or self-realized persons, gradually making further progress in spiritual bliss, come to the platform of association with the Supreme Personality of Godhead. That is the perfection of life. In the beginning, the Kumaras were self-realized impersonalists, but gradually they became attracted to the personal pastimes of the Supreme Lord. The conclusion is that for those who are always engaged in the devotional service of the Personality of Godhead, the duality of the auspicious and inauspicious does not arise. Prthu Maharaja is therefore asking about auspiciousness not for the sake of the Kumaras but for his own sake.

TEXT 15

� tWtA�: � �(ijqf\q;ni( I

�� � 1((1fiit-t�:��1� II�"\ II

tad aharh krta-visrambhaft

su-hrdo vas tapasviniim sarhprcche bhava etasmin

k§emaft keniiiijasii bhavet

tat-therefore; aham-1; krta-visrambhaft- being completely assured; suhrda� - friend ; vaft- our ; tapasvinam-suffering material pangs; samprcchewish to inquire; bhave-in this material world; etasmin-this; k�emaft-

902 Srimad-Bhagavatam [Canto 4, Ch. 22

ultimate reality; kena-by which means; anjasa-without delay; bhavetcan be achieved.

TRANSLATION

I am completely assured that personalities like you are the only friends for persons who are blazing in the fire of material existence. I therefore ask you how in this material world we can very soon achieve the ultimate goal of life.

PURPORT

When saintly persons go from door to door to see those who are too much materially engaged, it is to be understood that they do not go to ask anything for their personal benefit. It is a fact that saintly persons go to materialists just to give real information of the auspicious. Maharaja :?�th11 was assured of this fact; therefore instead of wasting Lime by asking the Kumaras about the auspicious, he preferred to inquire from them whether he could soon be relieved from the dangerous position of materialistic existence. This was not, however, a question personally for Prthu Maharaja. It was raised to teach the common man that whenever one meets a great saintly person, he should immediately surrender unto him and inquire about relief from the material pains of existence. Therefore Srila Narottama diisa Thakura says: samsara-vi§linale, diva-nisi hiya jvale, juf[aite na kainu upaya. "We are always suffering from material pangs, and our hearts are burning, but we can not find any way out of it." The materialistic person can also be called a tapasvi, whichmeans someonewho is always suffering from material pains. One can only get rid of all these material pains when he takes shelter of the chanting of the Hare Kr�qa mantra. This is also explained by Narottama dasa Thakura: golokera premadhana, hariniima-sankirtana, rati nii janmila kene tiiya. 1\ arottama diisa Thiikura regretted that he did not pursue his attraction for the transcendental vibration of the Hare Kr�qa mantra. The conclusion is that all persons in this material world are suffering from material pains, and if one wants to get rid of them, he must associate with saintly persons, pure devotees ofthe Lord, and chant the mahii-mantra, Hare Kr�r:ta, Hare Kr�r;a, Kr�qa Kr�qa, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare. That is the only auspicious way for materialisticpersons.

Text 16] Prthu Maharaja's Meeting with the Four Kumaras 903
TEXT 16 ¥qiffi¥tR+fqtff'CI�•n ��MI�4tMwt: (.EiMMP,A•d �-� �®Ill: II��II

vyaktam iitmavatam atma

bhagavan atma-bhavanaft svanam anugrahayemiirh siddha-rupT caraty ajalt

vyaktam-clear; atmavatam-of the transcendentalists; atma-the goal of life; bhagavan- the Supreme Personality of Godhead; atma-bhavana!talways wishing to elevate the living entities;svanam-whose own devotees; anugrahaya -just to show mercy; imam-this way; siddha-rupT-perfectly self-realized; carati-travels; aja!t-Nii.rii.yal).a.

TRANSLATION

The Supreme Personality of Godhead is always anxious to elevate the living entities, who are His parts and parcels, and for their special benefit, the Lord travels all over the world in the form of self-realized persons like you.

PURPORT

There are different kinds of transcendentalists, namely the Fian"is, or impersonalists, the mystic yogis, and, of course, all the devotees of the Supreme Personality of Godhead. The Kumii.ras, however, were both yogis and jnanTs and finally bhaktas later on. In the beginning they were impersonalists, but later they developed devotional activities; therefore they are the best of the transcendentalists. The devotees are representatives of the Supreme Personality of Godhead, and to elevate the conditioned soulsto their originalconsciousness, theytravel all overthe universes to enlighten the conditioned souls about Kr�l)a consciousness. The best devotees are atmavat, or those who have fully realized the Supreme Soul. The Supreme Personality of Godhead, as Paramatmii., is sitting within everyone's heart, trying to elevate everyone to the platform of Kr�l)a consciousness. Therefore He is called iitma-bhiivana. The Supreme Personality of Godhead is always trying to give intelligence to the individual soul to understand about Himself. He is always with the individual as a friend sitting by the side of a friend, and He gives facilities to all living entities according to their desires.

The word iitmavatiim issignificant in this verse. There are three different kinds of devotees, namely kal)ifitha-adhikiirl, madhyama-adhikiifi and uttama-adhikari: the neophyte, the preacher, and the mahii-bhiigavata or the highly advanced devotees. The highly advanced devotee is one who knows the conclusion of the Vedas in full knowledge; thus he becomesa devotee.

904
Srimad-Bhagavatam
[Canto 4, Ch. 22

Indeed, not only is he convinced himself, but he can convince others on the strength of Vedic evidence. The advanced devotee can also seeall other living entities as part and parcel of the Supreme Lord, without discrimination. The madhyama-adhikiiri (preacher) is also well-versed in the siistras and can convince others also, but he discriminates between the favorable and the unfavorable. In other words, the madhyama-adhikan does not care for the demoniac living entities, and the neophyte kartifitha-adhikiiri: does not know much about sastra hut has full faith in the Supreme Personality of Godhead. The Kumaras were, however, mahii-bhiigavatas because after scrutinizingly studying the Absolute Truth, they became devotees. In other words, they were in full knowledge of the Vedic conclusion. In the Bhagavad-gi:tii it is confirmed bythe Lord that there aremany devotees, but a devotee who is fully conversant in the Vedic conclusion is very dear to Him. Everyone is trying to elevate himself to the highest position according to his mentality. The karmi:s, who have a bodily concept of life, try to enjoy sense gratification to the utmost. The jiiani:s' idea of the highest position is merging into the effulgence of the Lord. But a devotee's highest position is in preaching all over the world the glories of the Supreme Personality of Godhead. Therefore the devotees are actually the representatives of the Supreme Lord, and as such they travel all over the world directly as Narayar:ta because they carry Narayar:ta within their hearts and preach His glories. The representative of Naniyar:ta is as good as Nariiyar:ta, but he is not to conclude, like the Mayiivadis, that he has become Narayar:ta. Generally, a sannyasi: is addressed as Nariiyar:ta by the Mayiivadis. Their idea is that simply by taking sannyiisa one becomes equal to Niirayar:ta or becomes Niiriiyar:ta Himself. The Vai�qava conclusion is different, as stated by Srila Visvanatha Cakravarti 'fhakura:

siikfiiid-dharitvenasamasta-siistrair

uktastathiibhiivyataevasadbhiJ:t

kintuprabhorya�priyaevatasya

vandeguro�sr"i-carartiiravindam

According to the Vai�r:tava philosophy, a devotee is as good as Narayar:ta not by becoming Nariiyar:ta but by becoming the most confidential servant of arayar:ta. Such great personalities act as spiritual masters for the benefit of the people in general, and as such, a spiritual master who is preaching the glories of Narayaf)a should be accepted as Niirayar:ta and be given all respects due Him.

Text 16] Prthu Maharaja ' s Meeting with the Four Kumaras 905

TEXT 17 m�

t-.l�Efl'(fi¥4�� � � fiRi ¥4! I

4tq¥tlwt � � f'I'Rt �fir { "�""

maitreya uviica

p[thos tat suktam iikar[lya

siiram sttfithu mitam madhu

smayamiina iva prityii

knmiira� pratynviica ha

maitreya� uviica-the great sage Maitreya continued to speak; prtho�of King Prthu; tat-that; suktam- Vedic conclusion; iikarrtya-hearing; siiram-very substantial; sufithu-appropriate; mitam-minimized; madhusweet to hear; smayamiina�-smiling; iva-like; pntyii-out of great satisfaction; kumiira�-celibate; pratyuviica-replied; ha-thus.

TRANSLATION

Thus Sanatkumiira, the best of the celibates, after hearing the speech of Prthu Maharaja, which was meaningful, appropriate, full of precise words and very sweet to hear, smiled with full satisfaction and began to speak as follows.

PURPORT

Prthu Maharaja's talks before the Kumaras were very laudable because of so many qualifications. A speech should be composed of selected words, very sweet to hear and appropriate to the situation. Such speech is called meaningful. All these good qualifications are present in P.rthu Maharaja's speech because he is a perfect devotee. It is said, yasyasti bhaktir bhagavaty akiiicana sarvair gu[tais tatra samasate sura�: "For one who has unflinching devotional faith and is engaged in His service, all good qualities become manifest in his person." (Bhag. 5.18.12) Thus the Kumaras were very much pleased, and Sanat-kumara began to speak as follows.

906 Srimad-Bhagavatam [Canto 4, Ch. 22
TEXT 18 ijlfR � 'i't QWU:it «�'(ijf{ij1€tfwt1 I � � � «1'ffftt�a«ft ������

sanat-kumara uvaca

sadhu pr�tarh maharaja

sarvabhuta-hitatmana

bhavata vidufiii capi

sadhunarh matir "idrSi

sanat-kumara[t uvaca-Sanatkumara said; sadhu-saintly;P!fi{am-question;maharaja-my dearKing;sarva-bhuta-all living entities;hita-iitmaniiby one who desires good for all; bhavatii-by you; vidufiii-well learned; ca-and; api-although; siidhuniim-of the saintly persons; mat*-intelligence;idrSi-like this.

TRANSLATION

Sanat-kumarasaid: �y dear King Prthu, I am very nicely questioned by you, and such questions are beneficial for all living entities, especially because they are raised by you, who are always thinking of the good of others. Although you know everything, still you ask such questions because that is the behavior of saintly persons. Such intelligence is befitting yourposition.

PURPORT

Maharaja PJ;thu was well conversant in transcendental science, yet he presented himself before the Kumaras as one ignorant of it. The idea is that even if a person is very exalted and knows e erything, before his uperior he should present questions. For instance, although Arjuna knew all the transcendental science, he questioned Kr�rp as if he did not know. Similarly, Prthu Maharaja knew everything, but he presented himself before the Kumaras as if he did not know anything. The idea is that questions by exalted persons put before the Supreme Personality of Godhead or His devotees are meant for thebenefit of the general people. Therefore sometimes great personalities put themselves in that position and inquire from higher authority because they are always thinking of the benefit of others.

Text 19] J>rthu Maharaja's Meeting withthe Four Kumaras 907
TEXT 19 �: � �WIIfPt4td ��: I '4«1Wir1Ul(1¥SI-\l: ��awn�� II��II sangama[tkhalu siidhuniim ubhaycfiiirh casammata[t

yat-sambhii�ar-a-samprasna�

saroe�iirh vitanoti sam

sarigama�- association; khalu-certainly; siidhuniim-of devotees; ubhaye�iim-for both; ca-also; sammata�-conclusive; yat- which; sambhii�ar-adiscussion; samprasna�-question and answer; saroe�iim-of all; vitanotiexpands; sam-real happiness.

TRANSLATION

When there is a congregation of devotees, their discussions, questions and answers become conclusive to both the speaker and the audience. Thus such a meeting is beneficial for everyone's real happiness.

PURPORT

Hearing discussions among the devotees is the only means to receive the powerful message of the Supreme Personality of Godhead. For instance, Bhagavad-g"itii has been well known all over the world for a very long time, especially in the western world, but because the subj ect matter was not discussed by devotees, there was no effect. Not a single person in the West became Kr�Qa conscious before the Kr�Qa consciousness movement was founded. When the same Bhagavad-gitii was presented as it is throughthedisciplicsuccession,therewasimmediately spiritual realization.

Sanat-kumara, one of the Kumaras, informed Prthu Maharaj a thathis meeting with the Kumaras benefited not only Maharaja Prthu but the Kumaras as well. When Narada Muni questioned Lord Brahma about the Supreme Personality of Godhead, Lord Brahma thanked Narada Muni because he gave him a chance to speak about the Supreme Lord. Therefore questions about theSupreme Personality ofGodhead or about the ultimate goal of life put by a saintly person to another saintly person surcharge everything spiritually. Whoever takes advantage of such discussions is benefitedboth in this life and in the next.

The word ubhaye�iim can be described in many ways. Generally there are two classes of men, the materialist and the transcendentalist. By hearing discussionsbetween devotees,both the materialist and transcendentalisl are benefited. The materialist is benefited by association with devotees, and his life becomes regulated so that his chance of becoming a devotee or making the present life successful for understanding the real position of the living entity is increased. When one takes advantage of this opportunity, he is assured of a human form of life in the next birth, or he may be liberated completely and go back home, back to Godhead. The con-

908
Srimad-Bhagavatam
[Canto 4, Ch. 22

elusion is that if one participates in a discussion of devotees, he is both materially and spiritually benefited. The speaker and the audience are bothbenefited, andthe karmis and jiian"is arebenefited. Thediscussion of spiritual matters amongst devotees is beneficial for everyone without exception. Consequently the Kumaras admitted that not only wasthe King benefitedbysucha meeting, but the Kumaraswere as well.

TEXT 20

asty eva riijan bhavato madhu-dvifiaft padiiravindasya gur-anuviidane ratir duriipii vidhunoti na�_thiki kiimarh ka�iiyarh malam antaratmana[l.

asti-there is; eva-certainly; rajan-0 King; bhavatal)-your; madhudvi�al)-of the Lord; piida-aravindasya-of the lotus feet; gur-a-anuvadanein glorifying;rati!t-attachment; durapa - verydifficult;vidhunoti-washes; nai�thikT-unflinching; kamam-lusty; ka�ayam-embellishment; malamdirty; antar-atmana[l.-from the core of the heart.

TRANSLATION

Sanat-kumara continued: My dear King, you already have an inclination to glorify the lotus feet of the Supreme Personality of Godhead. Such attachment is very difficult to achieve, but when one has attained such unflinching faith in the Lord, it automatically cleanses lusty desires from the core of the heart.

PURPORT

satam prasahgan mama virya-samvido

bhavanti hrt-karrw-rasayanafl katha{z

taj-jo�a[tad asv apavarga-vartmani

sraddha-ratir bhaktir anukraminati (Bhag. 3.25.25)

By association with devotees, dirty things within the heart of a materialistic man are gradually washed away by the grace of the Supreme Person-

Text 20] Prthu Maharaja's Meeting with the Four Kumaras 909
����: qiC(I(��� gun�sn� 1 (fa(oq• ��wilRt * tfiPi � '4�'4�(1€¥4.,:11�011

ality of Godhead. As silver becomes shiny by being polished, so lusty desires within the heart of a materialistic person are cleansed by the good association of devotees. Actually the living being has no connection with this material enjoyment nor with lusty desires. He is simply imagining or dreaming while asleep. But by the association of pure devotees, he is awakened, and immediately the spirit soul is situated in his own glory by understanding his constitutional position as the eternal servant of the Lord. Prthu Maharaja was already a self-realized soul; therefore he had a natural inclination to glorify the activities of the Supreme Personality of Godhead, and the Kumiiras assured him that there was no chance of his falling victim to the illusory energy of the Supreme Lord. In other words, the process of hearing and chanting about the glories of the Lord is the only means lo clarify the heart of material contamination. By the process of karma, jiiiina and yoga, no one will succeed in driving away contamination from the heart, but once a person takes to the shelter of the lotus feet of the Lord by devotional service, automatically all dirty things in the heart are removed without difficulty.

TEXT 21

siistre�v iyiin eva suniscito nrr-iim k�emasya sadhryag-vimrse�u hetu[l asanga iitma-vyatirikta iitmani

dnlhii ratir brahmari nirgure ca yii

siistre�u-in the scriptures;iyiin eva-this is only;suniscitatt-positively concluded;nrrtiim-of human society; k�emasya-of the ultimate welfare; sadhryak-perfectly; vimrse�u - by full consideration; hetu t-cause; asangalt-unattachment; iitma-vyatirikte-bodily concept of life; iitmaniunto the Supreme Soul;dpjhii-strong;rat*-attachment;brahma[ti-lranscendence; nirgure-in the Supreme, who is beyond the material modes; ca-and;yii-which.

TRANSLATION

It has been conclusively decided in the scriptures, after due consideration, that the ultimate goal for the welfare of human society is detach-

910 Srimad-Bhagavatam [Canto 4, Ch. 22
au�PI
�cqqaifet��� � �et'l�� �: I qw an�oqfijf(.ffi
m m-�� � � ������

ment from the bodily concept of life and increased and steadfast attachment for the Supreme Lord, who is transcendental and beyond the modes of material nature.

PURPORT

Everyone in human society is engaged for the ultimate benefit of life, but persons who are in the bodily conception cannot achieve the ultimate goal, nor can they understand what it is. The ultimate goal of life is described in Bhagavad-gtta. Pararh drfitvii nivartate (Bg. 2.59). When one finds out the supreme goal of life,he naturally becomes detached from the bodily concept. Here in this verse the indication i that one has to stead· fastlyincrease attachmentforTranscendence (brahma[ti). Asit is confirmed in the Vediinta-sutra, athiito brahma-jijiiiisii ( Vs. l.l.l ): without inquiry about the Supreme or the Transcendence, one cannot give up attachment for this material world. By the evolutionary process in 8,400,000 species of life, one cannot understand the ultimate goal of life because in all those species of lifP., :;,e bodily conception is very prominent. A thiito brahmajijriiisii means that in order to get out of the bodily conception, one has to increase attachment or inquiry about Brahman. Then he can be situated in the transcendental devotional service-sr:ava[t am k"irtanam vi§[!-O�. To increase attachment for Brahman means to engage in devotional service. Those who are attached to the impersonalform of Brahman cannot remain attached for very long. 1mpersonalists, after rejecting this world as mithyii or false (jagan-mithyii), come down again to this jagan-mithyii, although they take sannyiisa to increase their attachment for Brahman. Similarly, many yogis who are attached to the localized aspect of Brahman as Paramatma-great sages like Visvamitra-also fall down as victims of women. Therefore increased attachment for the Supreme Personality of Godhead is advised in all siistras. That is the only way of detachment from material existence and is explained in Bhagavad-gftii as param dr§tvii nivartate (Bg. 2.59). One can cease rnaterial activities when he actually has the taste for devotional service. Sri Caitanya Mahaprabhu also recommended love of Godhead as the ultimate goal of life (premii purruirtho mahan). Without increasing love of Godhead, one cannot achieve the perfectional stage or the transcendental position.

Text 22] Prt hu Maharaja's Meeting with the Four Kumaras 911
TEXT 22 � qt(T +ttl���. M(ll(1qiSSWIIR¥i4Wl•IMJjql I

fR4�:� � :q ������

sii sraddhayii bhagavad-dharma-caryayii jijiiiisayiidhyiitmika-yoga-ni�thayii yogdvaropiisanayii ca nityarh

pu[tya-srava�-kathayii pu[tyayii ca

sa-that devotional service; sraddhayii-with faith and conviction; bhagavat-dharma-devotional service; caryayii-by discussion; jijiiiisayiiby inquiry;adhyiitmika-spiritual;yoga-ni�{hayii-by conviction in spiritual understanding; yogdvara-the Supreme Personality of Godhead; upiisanayii-by worship of Him; ca-and; nityam-regularly; pu[tya-srava�-by hearing which; kathayii-by discussion;pu!�yayii-by pious;ca-also.

TRANSLATION

Attachment for the Supreme can be increased by practicing devotional service, inquiring about the Supreme Personality of God, applying bhaktiyoga in life, worshiping the Yogesvara, the Supreme Personality of Godhead, and by hearing and chanting about the glories of the Supreme Personality of Godhead. These actions are pious in themselves.

PURPORT

The word yogdvara is applicable to both the Supreme Personality of Godhead, J<r�J).a, and His devotees also. In Bhagavad-gitii this word occurs in two places. In the Eighteenth Chapter (18.78), Kr�J).a is described as the Supreme Personality of Godhead, Hari, who is the master of all mystic power (yatra yogdvara� kr�rto). Yoge5vara is also described at the end of the Sixth Chapter (sa me yuktatamo mata[l,) (Bg. 6.47). This yuktatama indicates the topmost of all yogis-the devotees, who can also be called yoge5vara. In this verse yogesvara-upiisanii means to render service to a pure devotee. Thus Narottama dasa Thiikura says: chii(liyii vai�rwva-sevii nistiira payeche keba. Without serving a pure devotee, one cannot advance in spiritual life. Prahliida l\Taharaja also has said:

na(siirh matis tiivad urukramiihghrirh sprsaty anarthiipagamo yad arthaft mahiyasiirh piida-rajo'bhifiekarh

n�kiTicaniiniirh na vrrtita yiivat. (Bhiig. 7.5.32)

912 Srimad-Bhagavatam [Canto 4, Ch. 22
4(ti\JQ(NI(1Wf�l :q �

One should take shelter of a pure devotee, who has nothing to do with this material world but is simply engaged in devotional service. By serving him only, one can transcend the qualitative material condition. In this verse it is recommended (yogdvara-upasanaya) that one serve the lotus feet of the topmost yogi, or the devotee. To serve the topmost devotee means to hear from him about the glories of the Supreme Personality of Godhead. To hear the glories of the Supreme Personality of Godhead from the mouth of a pure devotee is to acquire a pious life. In Bhagavad-g'ita it is also said that without being pious one cannot engage in devotional service.

ye§iirh tv anta-gatarh paparh jananarh pu[!ya-karma[lam te dvandva-moha-nirmukta bhajante mam dglha-vratii[l (Bg. 7.28)

To become fixed in devotional service one has to become completely cleansed from the contamination of the material modes of nature. For work in devotional service the first item is adau gurvasrayam: one should accept a bona fide spiritual master, and from the bona fide spiritual master (sad-c!?;::-rma-prcchii) inquire about his transcendental occupational duties (siidnu-marga-anugamanam) and follow in the footsteps of great saintly persons, devotees. These are the instructionsgiven in Bhakti-rasamrta-sindhu by

The conclusion is that to increase attachment for the Supreme Person· ality of Godhead one has to accept a bona fide spiritual master and learn from him the methods of devotional service and hear from him about the transcendental message and glorification of the Supreme Personality of Godhead. In this way one has to increase his conviction about devotional service. Then it will be very easy to increase attachment for the Supreme Personality of Godhead.

TEXT 23

ij�W(ijlwtl'fqRSitul

arthendriyiiriima-sago�thy-atr§r;tayii tat-sammatanam aparigrahe[la ca

vivikta-rucya parito�a atmani

vina harer gur-a-p'iyii�a-piiniit

Text 23] Prthu Maharaja's Meeting with the Four Kumaras 913
� I �A'¥�1 qfuiNstR+t.fwt AWf1 �o1�1_lNiwtl( ����II

artha-riches; indriya-senses; aruma-gratification; sa-go�thi"-with their companion; atr�r;taya-by reluctance; tat-that; sammatanam-since approved by them; aparigraher;ta- by nonacceptance; ca-also; vivikta-rucyadisgusted taste; parito�e-happiness; atmani-self; vina-without; hare�-of the Supreme Personality of Godhead; gur;ta-qualities; pi"yii.§a-nec tar; panat-drinking.

TRANSLATION

One has to make progress in spiritual life by not associating with persons who are simply interested in making money and sense gratification. Not only such persons, but onewho associates with such persons should be avoided. One should mold his life in such a way that he cannot live in peace without drinking the nectar of the glorification of the Supreme Personality of Godhead, Hari. One can be thus elevated by losing taste for sense enjoyment.

PURPORT

In the material world everyone is interested in money and sense gratification. The only objective is to earn as much money as possible and utilize it for satisfaction of the senses. Srila Sukadeva Gosvami thus described theactivities of the materialistic persons:

nidraya hriyate naktam vyavayena ca vii vaya� diva carthehayii rajan kutumba-bharar;tena vii (Bhiig. 2.1.3)

This is a typical example of materialistic persons. At night they waste their time by sleeping more than six hours or by wasting time in sex indulgence. This is their occupation at night, and in the morning they go to their office or business place just to earn money.As soon as there is some money, they become busy in purchasing things for their children and others. Such persons are never interested in understanding the values of life-what is God, what is the individual soul, what is its relationship with God, etc. Things are degraded to such an extent that those who are supposed to be religious are also at the present moment only interested in sense gratification. The number of materialistic persons in this age of Kali has increased more than in any other age; therefore persons who are interested in going back home, back to Godhead, should not only engage in the service of realized souls but should give up the company of materialistic persons whose only aim is to earn money and employ it in sense gratification. They should also not

914 Srimad-Bhagavatam [Canto 4, Ch. 22

accept the objectives of materialistic persons, namely money and sense gratification. Therefore it is stated: bhakti-parasyiinubhavarh viraktir anyathii syiit. To advance in devotional service one should be uninterested in the materialistic way of life. That which is the subject matter of satisfaction for the devotees is of no interest to the nondevotees.

Simple negation, or giving up the company of materialistic persons, will not do. We must have engagements. Sometimes it is found that a person interested in spiritual advancement gives up the company of material society and goes to a secluded place as recommended for the yogis especially, but lhal will also not help a person in spiritual advancement, for in many instances such yogis also fall down. As far as jiiiinis are concerned, generally they fall down without taking shelter of the lotus feet of the Lord. The impersonalists or the voidists can simply avoid the positive material association; they cannot remain fixed in transcendence without being engaged in devotjonal service. The beginning of devotional service is lo hear about tlte glories of the Supreme Personality of Godhead. That is recommended in this verse: viniiharer gu[La-piyu�a-piiniit. One must drink the nectar of the glories of the Supreme Personality of Godhead, and this means that one must be always engaged in hearing and chanting the glories of the Lord. It is the prime method for advancing in spiritual life. Lord Caitanya Mahiiprabhu also recommends this in the Caitanyacaritiimrta. If one wants to make advancement in spiritual life, by great fortune he may meet a bonafide spiritual master and from him learn about Kr�rya. By serving both the spiritual master and Kr�rya he gets the seed of devotional service (bhakti-lata-bija), and if he sows the seedwithin his heart and waters it by hearing and chanting, it grows into a luxuriant bhakti-latii or bhakti creeper. The creeper is so strong that it penetrates the covering of the universe and reaches the spiritual world and continues to grow on and on until it reaches and takes shelter of the lotus feet of Kr�rya. An ordinary creeper also grows on and on until it takes a solid shelter on a roof; then it very steadily grows and produces the required fruit. The real cause of the growing of such fruit, which is here called nectar, is hearing and chanting the glories of the Supreme Personality of Godhead. The purport is that one cannot live outside the society of devotees; one must live in the association of devotees, where there is constant chanting and hearin� of the glories of the Lord. The Kr�r:ta consciousness movement is started for this purpose, and there are hundreds of ISKCON centers to give opportunity lo all people to hear and chant and to accept the spiritual master. By not associating with persons who are materially interested, one can make solid advancement in going back home, back to Godhead.

Text 23] Prthu Maharaja's Meeting with the Four Kurnaras 915

TEXT 24 . � 31tte�u q""R'i(�'itttttl � lt;((l'itRijlstt�� 1 tta�.ar:ttt��trfwt;a::q.

ahimsaya paramaharhsya-caryayii smrtya mukundiicaritiigrya-s"idhunii yamair akiimair niyamais ciipy anindaya nirmaya dvandva-titik�aya ca

ahimsayii-by nonviolence; piiramahamsya-caryayii-by following in the footsteps of great iiciiryas; smrtya- by remembering; mukunda-the Supreme Personality of Godhead; iicarita-qgrya- simply preaching His activities;sidhunii- hy the nectar; yamail). -by following regulative principles; akiima* - without material desires; niyamail). - by strictly following the rules and regulations;ca-also;api-certainly; anindayii-without blaspheming; nirmayii- living simply, plain living; dvandva-duality; titik�aya-by tolerance;ca-and.

TRANSLATION

A candidate for spiritual advancement must be nonviolent, must follow in the footsteps of great acaryas, must always remember the nectar of the pastimes of the Supreme Personality of Godhead, must follow the regulative principles without material desire, and, while following the regulative principles,shouldnotblasphemeothers. A devoteeshouldlead a very simple life and not be disturbed by the duality of opposing elements. He should learn to tolerate them.

PURPORT

The devotees are actually saintly persons or siidhus. The first qualification of a siidhu or Jevotee is ahimsii or nonviolence. Persons interested in lhe path of devotional service or in going back home, hack to Godhead, must firsl practice ahimsii or nonviolence. A siidhu is described as titik�avaf:t kiiru[likiil;t (Bhiig. 3.25.21). A devotee should be tolerant and should be very much compassionate toward others. For example, if he suffer personal injury, he should tolerate it, but if someone else suffers injury, he need not tolerate it. The whole world is full of violence, and a devotee's first business is to stop this violence, including the unnecessary

916
Srimad-Bhagavatam
[Canto 4, Ch. 22
firotttt1 t�� =i!J11�\lll

slaughter of animals. A devotee is the friend not only of human society but of all living entities, for he sees all living entities as sons of the Supreme Personality of Godhead. He does not claim himself to be the only son of God and allow all others to be killed, thinking that they have no soul. This kind of philosophy is never advocated by a pure devotee of the Lord. Suhrdal). sarva-dehinam: a true devotee is the friend of all living entities. K��Q.a claims in Bhagavad-gita to be the father of all species of living entities; consequently the devotee of Kn>Q.a is always a friend of all. This is called ahirhsa. Such nonviolence can be practiced only when we follow in the footsteps of great acaryas. Therefore, according to our v ai91)ava philosophy' we have to follow the great acaryas of the four sampradayas or disciplic successions.

Trying to advance in spiritual life outside the disciplic succession is simply Ludicrous. It is said, therefore: acaryavan puru�o veda (Chand. Up. 6.14.2). One who follows the disciplic succession of acaryas knows things as they are. Tad-vijnanartharh sa gurum evabhigacchet (Mund. Up. 1.2.12). In order to understand the transcendental science, one must approach the bona fide spiritual master. The word smrtya is very impor· tanl in spiritual life. Smrtya means remembering Kr9ra always. Life should be molded in such a way that one cannot remain alone without thinking of K�9Q.a. We should live in Kr9Q.a so that while eating, sleeping, walking and working we remain only in K�9Q.a. Our K.r.sra consciousness society recommends that we arrange our living so that we can remember K�9Q.a. In our ISKCON society the devotees, while engaged in making Spiritual Sky incense, are also hearing about the glories of Kr�Q.a or His devotees. The sastra recommends: smartavyal). satatarh vi�(tU/.J.. Lord Vi�Q.U shouldbe remembered always, constantly. Vismartavyo na jiitucit: Vi�I)U should never be forgotten. That is the spiritual way of life. Smrtya. This remembrance of the Lord can be continued if we hear about Him con· stantly. It is therefore recommended in this verse: mukundiicaritiigrya; sidhuna. Sidhu means nectar. To hear about Kr9Da from SrtmadBhiigavatam or Bhagavad-g"ita or similar authentic literature is to live in K��Q.a consciousness. Such concentration in Kr�l)a consciousness can be achieved by persons who are strictly following the rules and regulative principles. We have recommended in our Kr�Q.a consciousness movement that a devotee chant sixteen rounds on beads daily and follow the regulative principles. That will help the devotee to spiritually advance in life.

It is also stated in this verse that by controlling the senses one can become a svam"i or gosviim"i. One who is therefore enjoying this super-

Text 24] Prthu Maharaja's Meeting with the Four Kumiiras 917

title, sviimt or gosviimt, must be verystrict in controlling his senses. Indeed, he must be master of his senses. This is possible when one does not desire any material sense gratification. If, by chance, the senses want to work independently, he must control them. If we simply practice avoiding material sense gratification, controlling the senses is automatically achieved.

Another important point mentioned in this connection (anindaya) is that we should not criticize others' methods of religion. There are different types of religious systems operating under different qualities of material nature. Those operating in the modes of ignorance and passion cannot be as perfect as that system in the mode of goodness. In Bhagavadgl:ta everything has been divided into three qualitative divisions; therefore religious systems are similarly categorized. When people are mostly under the modes of passion and ignorance, their system of religion will be of the samequality. A devotee, instead of criticizing such systems, will encourage the followers to stick to their principles so that gradually they can come to the platform of religion in goodness. Simply by criticizing them, a devotee's mind will be agitated. Thus a devotee should tolerate and learn to stop agitation.

Another feature of the devotee is nir"ihayii, simple living. Nir"ihii means gentle, meek or simple. A devotee should not live very gorgeously and imitate a materialistic person. Plain living and high thinking are recommended for a devotee. He should accept only so much as he can to keep the material body fit for the execution of devotional service. He should not eat nor sleep more than is required. Simply eating for living, and not living for eating, and sleeping only six to seven hours a day are principles to be followed by devotees. As long as the body is there it is subjected to the influence of climatic changes, disease and natural disturbances, the threefold miseries of material existence. We cannot avoid them. Sometimes we receive letters from neophyte devotees questioning why they have fallen sick, although pursuing Kr�J;la consciousness. They should learn from this verse that they have to become tolerant (dvandvatitik�ayii). This is the world of duality. Because he has fallen sick, one should not think that he has fallen from Kr�J;la consciousness. Kr�J;la consciousness can continuewithoutimpedimentfrom anymaterial opposition. Lord Sri Kr�J;la therefore advises in Bhagavad-gl:tii, tams titik�asva bhiirata: "My dear Arjuna, please try to tolerate all these disturbances. Be fixed in your Kr�J;la conscious activities." (Bg. 2.14)

918 Srimad-Bhagavatam [Canto 4, Ch . 22

TEXT 25 �� ���I e �' �: (1�(1�it�l�qf;r �gut;mfoJ �Uij-: ������

harer muhus tat-para-karrta-puragw;iibhidhiinena vijrmbhamiirwya bhaktyii hy asanga/:1. sad-asaty aniitmani syan nirgutJe brahmar-i ciiiijasii ratiJ:t

hareJ:t-of the Supreme Personality of Godhead; muhu�t - constantly; tat-para-in relation with the Supreme Personality of Godhead; kartJapura-decoration of the ear; gur-a-abhidhiinena- discussing transcendental qualities; vijrmbhamiir-ayii-by increasing Kr�l]a consciousness; bhaktyaby devotion; hi-certainly; asanga/:1.-uncontaminated; sat-asati-the material world; aniitmani-opposed to spiritual understanding; syiit-should be; nirgutJe-in transcendence; brahmaTJ-i-in the Supreme Lord; ca-and; aiijasii-easily; rati{t-attraction.

TRANSLATION

The devotee should gradually increase the culture of devotional service by constant hearing of the transcendental qualities of the Supreme Personality of Godhead. These pastimes are like ornamental decorations on the ears of devotees. By rendering devotional service and transcending the material qualities, one can easily be fixed in transcendence in the Supreme Personality of Godhead.

PURPORT

This verse is especially mentioned to substantiate the devotional process of hearing the subject matter. A devotee does not like to hear anything other than subjects dealing with spiritual activities, or the pastimes of the Supreme Personality of Godhead. We can increase our propensity for devotional service by hearing Bhagavad-g"itii and Sr"imad-Bhiigavatam from realized souls. The more we hear from realized souls, the more we make advancement in our devotional life. The more we advance in devotional life, the more we become detached from the material world. The more we become detached from the material world, the less we associate with

Text 25) Prthu
Maharaja's Meeting with the Four Kumaras
919

persons who are after money and sense gratification. This is the advice of LordCaitanya Mahaprabhu:

ni�kiiicanasya bhagavad-bhajanonmukhasya param param jigami�or bhava-sagarasya sandarsanarh v�ayit;tam atha yo�itarh ca ha hanta hanta vi�a -bhak�at;tato 'py asadhu.

The word brahmat;ti usedin this verse is commentedupon by the impersonalists or professional reciters of Bhagavatam, who are mainly advocates of the caste system by demoniac birthright. They say that brahma[Li means the impersonal Brahman. Butthey cannot conclude this withoul reference to the context of the words bhaktya and gu[Labhidhanena. According to the impersonalists, there are no transcendental qualities in the impersonal Brahman; therefore we should understand that brahma[Li means "in the Supreme Personality of Godhead." K�11qa is the Supreme Personality of Godhead, as admitted by Arjuna in Bhagavad-g"itii; therefore wherever the word brahma is used, it must refer to Kr11qa, not to the impersonal Brahman effulgence. Brahmeti paramatmeti bhagavan iti sabdyate (Bhag. J .2.11). Brahman, Paramatma and Bhagavan can all be taken in total as Brahman, but when there is reference to the word bhakti or remembrance of the transcendental qualities, the word indicates theSupreme Personality of Godhead, not theimpersonal Brahman.

TEXT 26

� u-�rur �ctt �'�'­

otF-n4cu'f_ ij�;d'«Ttt�m

G\t�tft� � JAi\\i

q��f.lllttil�fflsfil: 11�,11

yada ratir brahma[li nai�thik"i pumiin acaryavan jiiana-viriiga-ramhasa dahaty av"iryam hrdayam fiva-kosam

panciitmakarh yonim ivotthito 'gnil;t

yada-when; rat*-attachment; brahmm;ti-in the Supreme Personality of Godhead; nai�thik"'i-fixed; puman-the.person; acaryavan -completely surrendered to the spiritualmaster;jiiana-knowledge;viriiga-detachment; rqmhasa-by the force of; dahati-burns; av"iryam-impotent; hrdayam-

920 Srimad-Bhagavatam [Canto 4, Ch. 22

within the heart; ftva-kosam-the covering of the spirit soul; pancaiitmakam-five elements; yonim-source of birth; iva-like; utthita�emanating; agn*-fire.

TRANSLATION

Upon becoming fixed in his attachment to the Supreme Personality of Godhead bythegrace ofthe spiritual master and by awakeningknowledge and detachment, the living entity, situated within the heart of the body and covered by the five elements, burns up his material surroundings exactly as fire, arising from wood, burns the wood itself.

PURPORT

It is said that both the jivatmii, theindividualsoul,andtheParamatma live together within the heart. In the Vedic version it i stated, hrdi hy ayam iitmii: the soul and Supersoul both live within the heart. The individual soul is liberated when it comes out of the material heart or cleanses the heart to make it spiritualized. Theexamplegivenhereisvery appropriate: yonim ivotthito 'gnib.. Agni, or fire, comesoutofthewood, and by it the wood is completely destroyed. Similarly, when a living entity increases his attachment for the Supreme Personality of Godhead, he is to be consideredlikefire. Ablazingfireisvisiblebyitsexhibitionof heat and light; similarly, when the living entity within theheartbecomes enlightened with full spiritual knowledge,anddetachedfromthematerial world, he burns up his material covering of the five elements-earth, water, fire, air and sky-and becomes free from thefive kinds ofmaterial attachments, namely, ignorance, false egoism, attachment to thematerial world, envy and absorption in material consciousness. Therefore paiiciitmakam, asmentionedinthisverse,referstoeitherthefiveelements or the five coveringsof materialcontamination. Whentheseareallburned into ashes by the blazing fire of knowledge and detachment, oneisfixed firmly in the devotional service of the Supreme Personality of Godhead. Unless one takes shelter of a bona fide·spiritual master and advances his attraction for .Kr�qa by his instructions, the five coverings of the living entity cannot be uncovered from the material heart. The living entity is centered within the heart, and to take him away from the heart is to liberate him. This is the process. One must take shelter of a bona fide spiritual master and by his instruction increase one's knowledge in devotional service, become detached from the material world and thus become liberated. An advanced devoteethereforedoesnotlivewithinthe material body but within his spiritual body, just as a dry coconut lives

Text 26] Prthu Maharaja's Meeting with the Four Kumaras 921

detached from the coconut husk, even though within the husk. The pure devotee's body is therefore called cinmaya-sar"ira (spiritualized body). In other words, a devotee's body is not connected with material activities, and as such, a devotee is always liberated. Brahma-bhiiyiiya kalpate. (Bg. 14.26) This is confirmed in Bhagavad-g"itii. Srila Rupa Gosvami also confirms this:

lhii yasya harer diisye karmartii manasii viicii nikhiliisv apy avasthiisu jivan-mukta!). sa ucyate.

"One who isengaged fully with his body, mind and speechin the service of the Lord is liberated even within this body, despite his condition."

TEXT

dagdhiiSayo mukta-samasta-tad-guro naiviitmano bahir antar vica�te pariitmanor yad-vyavadhiinarh purastiit svapne yathii puru�as tad-viniise

dagdha-iisayafl-all material desires being burned; mukta-liberated; samasta-all; tat-gurafL-qualities in connection with matter; na - not ; evacertainly; iitmana�-the soul or the Supersoul; bahi?J. -external; anta�internal; vica�te-acting; para-iitmanol].-of the Supersoul; yat- that ; vyavadhiinam-difference; purastiit-as it was in the beginning; svapnein dream; yathii-as ; puru�a�-a person; tat-that; viniise-being finished.

TRANSLATION

When a person becomes devoid of all material desires and liberated from all material qualities, he transcends distinctions between actions executed externally and internally. At that time the difference between the soul and the Supersoul, which was existing before self-realization, is annihilated. When a dream is over, there is no longer a distinction between the dream and the dreamer.

922 Srimad-Bhagavatam [Canto 4, Ch. 22
� a'ffi(til(ijijf(gun �qRit;il 111Mf4:q4 I �� � � �«ttl:•n� 11�\911
27

PURPORT

As described by Srila Rupa Gosviimi (anyiibhilii,sitii-sunyam), one must be devoid of all material desires. When a person becomes devoid of all material desires, there is no longer need for speculative knowledge or fruitive activities. In that condition it is to be understood that one is free from the material body. The example is already given above-a coconut which is dry is loosened from its outward husk. This is the stage of liberation. As said in Srimad-Bhiigavatam, mukti (liberation) means svarupera avasthiti{z -being situated in one's own constitutional position. All material desires are present as long as one is in the bodily concept of life, but when one realizes that he is an eternal servant of Kr�l').a, his desires are no longer material. A devotee acts in this consciousness. In other words, when material desires in connection with the body are finished, one is actually liberated.

When one is liberated from the material qualities, he does not do anything for his personal sense gratification. At that time all activities performed by him are absolute. In the conditioned state there are two kinds of activities. One acts on behalf of the body, and at the same time he acts to become liberated. The devotee, when he is completely free from all material desires or all material qualities, transcends the duality of action for the body and soul. Then the bodily concept of life is completely over. Therefore Srila Rupa Gosviimi says: Lhii yasya harer diisye karmarii manasii viicii/ nikhiliisv apy avasthiisu jivan-mukta!z sa ucyate. When one is completely fixed in the service of the Lord, he is a liberated person in any conditionof life. He is called fivan-mukta!z, liberatedeven within thisbody. In such a liberated condition, there is no distinction between actions for sense gratification and actions for liberation. When one is liberated from the desires of sense gratification, he has no longer to suffer the reactions of lamentation or illusion. Activities performed by the karmis and jiiiinis are subjected to lamentation and illusion, but a self-realized liberated person acting only for the Supreme Personality of Godhead experiences none. This is the stage of oneness, or merging into the existence of the Supreme Personality of Godhead. This means that the individual soul, while keeping his individuality, no longer has separate interests. He is fully in the service of the Lord, and he has nothingto do for his personal sense gratification; therefore he sees only the Supreme Personality of Godhead and not himself. His personal interest completely perishes. When a person comes out of a dream, the dream vanishes. While dreaming a person may consider himself a king and see the royal paraphernalia, his soldiers,etc., but when the dream is over, he does not see anything beyond

Text 27J Prthu Maharaja 's Meeting with the Four Kumaras 923

himself. Similarly, a liberated person understands that he is part and parcel of the Supreme Lord acting in accordance with the desire of the Supreme Lord, and as such there is no distinction between himself and the Supreme Lord, although both of them retain their individuality. Nityo nityanarh cetanas cetaniiniim. This is the perfect conception of oneness in relation to the Supersoul and the soul.

TEXT 28

iitmiinam indriyiirtharh ca pararh yad ubhayor api satyiisaya upiidhau vai pumiin pasyati niinyadii

iitmiinam-the soul; indriya-artham-for sense gratification; ca-and; param-transcendental; yat-that; ubhayo�-both; api-certainly; satibeing situated;iisaye-material desires;upiidhau-designation;vai-certainly; pumiin-the person;pasyati-sees; niinyadii-not otherwise.

TRAN SLATION

When the soul exists for sense gratification, he creates different desires, and for that reason he becomes subjected to designations. But when one is in the transcendental position, he is no longer interested in anything except fulfilling the desires of the Lord.

PURPORT

Being covered by material desires, a spirit soul is also considered to be covered by designations belonging to a particular type of body. Thus he considers himself an animal, man, demigod, bird, beast, etc. In so many ways he is influenced by false identification caused by false egotism, and being covered by illusory material desires, he distinguishes between matter and spirit. When one is devoid of such distinctions, there is no longer a difference between matter and spirit. At that time, the spirit is the only predominating factor. As long as one is covered by material desires, he thinks himself the master or the enjoyer. Thus he acts for sense gratification and becomes subjected to material pangs, happiness and distress. But when one is freed from such a concept of life, he is no longer subjected to designations, and he envisions everything as spiritual in connection with the Supreme Lord. This is explained by Srila Riipa Gosvami in his Bhakti-

924 Srimad-Bhagavatam [Canto 4, Ch. 22
31Rttt;wfflf� � � �4\(fq I (1f'41\14�l �tmftf � ����II

rasiimrta-sindhu: anyiisaktasya vi�ayiin yathiirham upayuiijataM nir bandha�

knTJ-a-sambandhe yuktarh vairiigyam ucyate (Bh.r.s. 1.2.255).

The liberated person has no attachment for anything material or for sense gratification. He understands that everything is connected with the Supreme Personality of Godhead and that everything should be engaged in the service of the Lord. Therefore he does not give up anything. Thereis no question of renouncing anything because the paramaharhsa knows how to engage everything in the service of the Lord. Originally everything is spiritual; nothing is material. In the Caitanya-caritiimrta also it is explained that a mahii-bhiigavata, a highly advanced devotee, has no material vision, sthiivara-jangama dekhe, nii dekhe tiira murti/ sarvatra haya nija i�.tadeva-sphilrti (Cc. Madhya 8.274). Although he sees trees, mountains, and other living entities moving here and there, he sees all as the creation of the Supreme Lord, and, with reference to the context, sees only the creator and not the created. In other words, he no longer distinguishes between the created and the creator. Hesees only the Supreme Personality of Godhead in everything. He sees Kr�l')a in everything and everything in Kr�l')a. Thisis oneness.

TEXT 29

�

m ��91' �� �: 1

�*1

qmrfq f'm�� ������

nimitte sati sarvatra

jaladav api puru�a�

atmanaS ca parasyapi

bhidarh pasyati nanyadii

nimitte-on account of causes; sati-being; sarvatra-everywhere; jalaadau api- water and other reflecting mediums; p uru�a�-the person; at mana{l -oneself; ca-and; parasya api-another's self; bhidam-differentiation;pasyati-sees; niinyada- there is no other reason.

TRANSLATION

Only because of different causes does a person see a difference between himself and others. It is like the reflection of a body on water or oil or in a mirror appearing to be differently manifested.

PURPORT

The spirit soul is one, the Supreme Personality of Godhead. He is manifested in svarhsa and vibhinnarhsa expansions. The jivas are vibhinniirhsa expansions. The different incarnations of the Supreme

Text 29] Prthu Maharaja's Meeting with the Four Kumaras 925

Personality of Godhead are sviirhsa expansions_ Thus there are different potencies of the Supreme Lord, and there are different expansions of the different potencies. In this way, for different reasons there are different expansions of the same one principle, the Supreme Personality of Godhead. This understanding is real knowledge, but when the living entity is covered by the upiidhi or designated body, he sees differences, exactly as one sees differences in reflections of oneself on water, oil or in a mirror. When something is reflected on the water, it appears to be moving. When it is reflected on ice, it appears fixed. When it isreflected on oil,it appears hazy. The subject is one,but under different conditions it appears differently. When the qualifying factor is taken away, the whole appears to be one. In other words, when one comes to the paramuharhsa or perfectional stage of life by practicing bhakti-yoga, he sees only Kr��a everywhere. For him there is no other objective.

In conclusion, due to different causes, the living entity is visible in different forms as an animal, human being, demigod, tree, etc. Actually every living entity is the marginal potency of the Supreme Lord. In Bhagavad-gita, therefore, it is explained that one who actually sees the spirit soul does not distinguish between a learned brahmar-a and a dog, an elephant or a cow. Par-!litalt sama-darsina� (Bg. 5.18). One who is actually learned sees only the living entity, not the outward covering. Differentiation is therefore the result of different karma or fruitive activities, and whenwe stop fruitive activities, turning them into acts of devotion, we can understand that we are not different from anyone else, regardless of the form. This is only possible in ���a consciousness. In this movement there are many different races of men from all parts of the world participating, but because they think of themselves as servants of the Supreme Personality of Godhead, they do not differentiate between black and white, yellow and red. The ���a consciousness movement is therefore the only means to make the living entities transcend all designations.

TEXT 30

926 Srimad-Bhagavatam [Canto 4, Ch. 22
QW:Iffl 1191: , � m ri:: �· m( II� oil indriyair vi�ayiikr�tair iik�iptarh dhyiiyatiirh mana� cetaniirh harate buddhe[t stambas toyam iva hradiit

indriya*-by the senses; vi§aya-the sense objects; iikr§tai?t-being attracted; iik§iptam-agitated; dhyiiyatiim-always thinking of; manalJmind; cetaniim-consciousness;harate-becomes lost;buddheh-of intelligence;stambalJ-big straws;toyam-water;iva-like;hradiit-fr�m the lake.

TRANSLATION

When one ' s mind and senses are attracted to sense objects for enjoyment, the mind becomes agitated. As a result of continually thinking of sense objects, one's real consciousness almost becomes lost, like the water in a lake that is gradually sucked up by the big grass straws on its bank.

PURPORT

In this verse it is very nicely explained how our original Kn>Qa consciousness becomes polluted. Gradually we become almost completely forgetful of our relationship with the Supreme Lord. In the previous verse it is recommended that we should always keep in touch with the devotional ervice of the Lord so that the blazing fire of devotional service can gradually burn into ashes material desires and we can become liberated from lhe repetition of birth and death. This is also how we can indirectly keep our staunch faith in the lotus feet of the Supreme Personality of Godhead. When the mind is allowed to think of sense gratification continuously, it becomes the cause of our material bondage.If our mind is simply filled with sense gratification, even though we want Kr��a consciousness, by continuous practice we cannot forget the subject matter of sense gratification. If one takes up the sannyiisa order of life but is not able to control the mind, he will think of objects of sense gratificationnamely family, society, expensive house, elc. Even though he goes to the Himalayas or the forest, his mind will continue thinking of the objects of sense gratification. In this way,gradually one's intelligence will be affected. When intelligence is affected, one loses his original taste for Kn�a consciOusness.

The example given here is very appropriate. If a big lake is covered all around by long kusa grass, just like columns, the waters dry up. Similarly, when the big columns of material desire increase, the clear water of consciousness is dried up. Therefore these columns of kusa grass should be cut or thrown awayfrom the very beginning. Sri Caitanya Mahaprabhu hac: instructed that if from the very beginning we do not take care of unwanted grass in the paddy fields, the fertilizing agents or water will be used by them and the paddy plants will dry up. The material desire for sense en-

Text 30] Prthu Maharaja's Meeting with the Four Kumaras 927

joyment is the cause of our falldown in this material world, and thus we suffer the threefold miseries and continuous birth, death, old age and disease. However, if we turn our desires toward the transcendental loving service of the Lord, our desires become purified. We cannot kill desires. We have to purify them of different designations. If we constantly think of being a member of a particular nation, society or family and continuously think about them, we become very strongly entangled in the conditioned life of birth and death. But if our desires are applied to the service of the Lord, they become purified, and thus we become immediately freed from material contamination.

TEXT 31

�iti���Rt�

�: � I

� �: ���: 11��11

bhrasyaty anusmrtis cittarh jniina-bhrarhsa� smrti-k�aye tad-rodharh kavaya� priihur atmiipahnavam iitmana�

bhrasyati-becomes destroyed; anusmrt*-constantly thinking; cittamconsciousness; jiiiina- bhrarhsa� - bereft of real knowledge; smrti-k�aye-by destruction of remembrance; tat-rodham- choking that process; kavaya�great learnedscholars; prahu� - have opined ; iitma- ofthe soul;apahnavamdestruction; iitmana�- of the soul.

TRANSLATION

When one deviates from his original consciousness, he loses the capacity to remember his previous position or recognize his present one. When remembrance is lost, all knowledge that is acquired is based on a false foundation. When this occurs, learned scholars consider that the soul is lost.

PURPORT

The living entity or the soul is ever existing and eternal. It cannot be lost, but learned scholars say that it is lost when actual knowledge is not working. That is the difference between animals andhuman beings. According to less intelligent philosophers, animals have no soul. But factually animals have souls. Due to the animals' gross ignorance, however, it appears that they have lost their souls. Without the soul, a body cannot move. That is the difference between a living body and a dead body. When the soul is out of the body, the body is called dead. The soul is said to be lost when

928 Srimad-Bhagavatam [Canto 4, Ch. 22

there is no proper knowledge exhibited. Our original consciousness is K{�qa consciousness because we are part and parcel of Kr�Qa. When this consciousness is misguided and one is put into the material atmosphere, which pollutes the original consciousness, one thinks that he is a product of the material elements. Thus one loses his real remembrance of his position as part and parcel of the Supreme Personality of Godhead, just as a man who sleeps forgets himself. In this way, when the activities of proper consciousness are checked, all the activities of the lost soul are performed on a false basis. At the present moment human civilization is acting on a false platform of bodily identification; therefore it can be said that the people of the present age have lost their souls.

TEXT 32

;rnr: cmm � �: �: 44C(W4;:14�

nata� parataro loke pumsa� svartha-vyatikrama�

yadadhy anyasya preyastvam atmana� sva-vyatikramat

na-not;ata�-after this;paratara�-greater ;loke-in thisworld;pumsa�of the living entities; sva-artha- interest; vyatikrama�-obstruc tion ; yadadhi-beyond that; anyasya-of others ;preyastvam-to be more intere ting; iitmana�-for the self; sva-own ; vyatikramat-by obstruction.

TRANSLATION

There is no stronger obstruction to one's self-interest thanthinking other subject matters to be more pleasing than one's self-realization.

PURPORT

Human life is especially meant for self-realization. Self refers to the Superself and the individual self, the Supreme Personality of Godhead and lhe living entity. When, however, one becomes more interested in the body and bodily sense gratification, he creates for himself obstructions on the path of self-realization. By the influence of miiyii, one becomes more interested in sense gratification, which is prohibited in this world for those interested in self-realization. Instead of becoming interested in sense gratification, one should divert his activities to satisfy the senses of the Supreme Soul. Anything performed contrary to this principle is certainly against one's self-interest.

Text 32] Prthu Maharaja's Meeting with the Four Kumaras 929
(q&qRJ¥'11�������

TEXT 33

�NtPtQ4t;i('1q�tq;q1� I �ijlwtMijtwtiil;uRm�� ������

arthendriyiirthiibhidhyanarh sarviirthiipahnavo nr[tiim bhrarhsito jiiana-vijiiiiniid yeniivisati mukhyatiim

artha-riches; indriya-artha- for the satisfaction of the senses; abhidhyiinam-constantly thinking of; sarva-artha-four kinds of achievements; apahnava!t -destru ctive; nr[tiim-of human society; bhrarhsitatLbeing devoid of; jiiiina-knowledge; vijiiiinat- devotional service; yenaby all this; iivisati-enters; mu khyatam-immovable life.

TRANSLATION

For human society, constantly thinking of how to earn money and apply it for sense gratification brings about the destructionof everyone's interests. When one becomes devoid ofknowledge and devotionalservice, he enters into speciesof life like those of treesand stones.

PURPORT

]nana, or knowledge, means to understand one's constitutional position, and v�jnana refers to practical application of that knowledge in life. In the human form of life, one should come to the position of jnana and vijfiana, but despite this great opportunity if one does not develop knowledge and practical application of knowledge through the help of a spiritual master and the sastras-in other words, if one misuses this opportunity-then in the next life he is sure to be born in a species of nonmoving living entities. Nonmoving living entities include hills, mountains, trees, plants, etc. This stage of life is called puTJ-yatam or mukhyatam, namely, making all activities zero. Philosophers who support stopping all activities are called silnyavadi. By nature's own way, our activities are to be gradually diverted to devotional service. But there are philosophers who, instead of purifying their activities, try to make everything zero, or void of all activities. This lack of activity is represented by the trees and the hills. This is a kind of punishment inflicted by the laws of nature. If we do not properly execute our mission of life in self-realization, nature's punishment will render us inactive by putting us in the form of trees and hills. Therefore activities directed towards sense gratification are condemned herein. One who is

930 Srimad-Bhagavatam [Canto 4, Ch. 22

constantly thinking of activities to earn money and gratify the senses is following a path which is suicidal. Factually all human society is following this path. Some way or other, people are determined to earn money or get money by begging, borrowing or stealing and applying that for sense gratification. Such a civilization is the greatest obstacle in the path of selfrealization.

TEXT 34 WI �t�flPl�q ij'� Rtdlf(,;: I l1p{�q�

na kuryiit karhicit sangam tamas tivram titiri§u{l. dharmiirtha-kiima-mok§ap,iirh yad atyanta-vighiitakam

na-do not; kuryiit -act; karhicit-at any time; sangam-associatwn; tama�-ignorance; tfvram-with great speed; tit"lr�u�-persons who desire to cross over nescience; dharma-religion; artha-economic development; kiima-sense gratification; mok§ii'!iim-of salvation; yat- that which; atyanta-very much; vighiitakam-obstruction or stumbling block.

TRANSLATION

Those who strongly desire to cross the ocean of nescience must not associate with the modes of ignorance because hedonistic activities are the greatest obstructions to realization of religious principles, economic development,regulated sense gratification and, at last, liberation.

PURPORT

The four principles of life allow one to live according to religious principles, to earn money according to one's position in society, to allow the senses to enjoy the sense objects according to regulations, and to progress along the path of liberation from this material attachment. As long as the body is there, it is not possible to become completely free from all these material interests. It is not, however, recommended that one act only for sense gratification and earn money for that purpose only, sacrificing all religious principles. At the present moment, human civilization does not care for religious principles. It is, however, greatly interested in economic development without religious principles. For instance, in a slaughterhouse the butchers certainly get money easily, but such business is not based on religious principles. Similarly, there are many night clubs for sense gratifi-

Text 34] Prthu Maharaja's Meeting with the Four Kumiiras 931
�G;�W'd�f41ijEfi�ll�'clll

cation and brothels for sex. Sex, however, is allowed in married life only,and prostitution is prohibitedbecause all ouractivities are ultimately aimed at liberation, at freedom from the clutches of material existence. It is advised therefore that one not act in a way that will obstruct the regular process of advancement in spiritual life and liberation. The Vedic process of sense gratification is therefore planned in such a way that one can economically develop and enjoy sense gratification and yet ultimately attain liberation. Vedic civilization offers us all knowledge in the sastras, andifwelive a regulated life underthe direction of sastras and guru, all our material desires will be fulfilled; at the same time we will be able to go forward to liberation.

TEXT 35

�S¥it � r..�� 11�'-\11 tatrapi mok�a evartha atyantikataye�yate traivargyo 'rtho yato nityam

krtanta-bhaya-samyutaft

tatra-there; api-also; mok�aft- liberation ; eva-certainly; arthe- for the matter of; atyantikataya-most important; i�yate-taken in that way; .traivargya�-the three others, namely, religion, economic development and sense gratification; artha�-interest; yataft-wherefrom; nityam- regularly; krtanta-death; bhaya- fear ; samyuta�-attached.

TRANSLATION

Out of the four principles-namely, religion, economic development, sense gratification and liberation-liberation has to be taken very seriously. The other three are subject to destruction by the stringent law of naturedeath.

PURPORT

Mok�a, or liberation, has to be taken very seriously, even at the sacrifice of the other three items. As advised by Suta Gosvamiin the beginning of Sfimad-Bhiigavatam, religiousprinciplesarenotbasedonsuccessin economic development. Because we are very attached to sense gratification, we go to God, to the temple or churches, for some economic reasons. Then again, economic development does not mean sense gratification. Everything shouldbe adjusted in such a way that we attain liberation. Therefore

932 Srimad-Bhagavatam [Canto 4, Ch. 22
� � ��� �r�����a 1

in this verse, liberation, mok�a, is stressed. The other three items are material and therefore subject to destruction. Even if somehow we accumulate a great bank balance in this life and possess many material things, everything will be finished with death. In Bhagavad-gita it is said that death is the Supreme Personality of Godhead, who ultimately takes away everything acquired by the materialistic person. Foolishly we do not care for this. Foolishly we are not afraid of death, nor do we consider that death will take away everything acquired by the process of dharma, artha and kama. By dharma, or pious activities, we may be elevated to the heavenly planets, but this does not mean freedom from the clutches of birth, death, old age and disease. The purport is that we can sacrifice our interests in traivargya, religious principles, economic development and sense gratification, but we cannot sacrifice the cause of liberation. Regarding liberation, it is stated in Bhagavad-gita: tyaktva deharh punar janma naiti (Bg. 4.9). Liberation meansthat after giving up this body one does not have to accept another material body. But to the impersonalists liberation means merging into the existence of impersonal Brahman. But factually this is not mok�a because one has to again fall down into this material world from that impersonal position. One should therefore seek the shelter of the Supreme Personality of Godhead and engage in His devotional service. That is real liberation. The conclusion is that we should not stress pious activities, economic development and sense gratification but should concern ourselves with approaching Lord Vi�Q.U in His spiritual planets,of which the topmost is Goloka V�ndavana where Lord K��11a lives. Therefore this Kr�l).a consciousness movement is the greatest gift for persons who are actually desiring liberation. TEXT

pare 'vare ca ye bhavii gu[ta-vyatikarad anu na te�arh vidyate k�emam isa-vidhvarhsitasifilim

pare-in the higher status of life; avare-in the lower status of life; caand; ye-all those; bhava�-conceptions; gu(la-material qualities; vyatikarat-by interaction; anu-following; na-never; te�am-of them; vidyate-exist; kfiemam-correction; Isa-the Supreme Lord; vidhvarhsitadestroyed; asi�am-of the blessings.

Text 36] Prthu Maharaja's Meeting with the Four Kumiiras 933
36
:q � � giJTOlJRt� I
� �iJ¥t¥tl�N'<4RH11Rl«mt_ ������
�Strt
Wf

We accept as blessings different states of higher life, distinguishing them from lower states of life, but we should know that such distinctions exist only in relation to the interchange of the modes of material nature. Actually these states of life have no permanent existence, for all of them will be destroyed by the supreme controller.

PURPORT

In our material existence we accept a higher form of life as a blessing and a lower form as a curse. This distinction of higher and lower only exists as long as the different material qualities (gur-as) interact. In other words, by our good activities we are elevated to the higher planetary systems or to a higher standard of life (good education, beautiful body, etc.). These are the results of pious activities. Similarly, by impious activities we remain illiterate, get ugly bodies, a poor standard of living, etc. But all these different states of life are under the laws of material nature through the interaction of the qualities of goodness, passion and ignorance. However, all these qualities will cease to act at the time of the dissolution of the entire cosmic manifestation. The Lord therefore says in Bhagavad-gitii:

iibrahma-bhuvaniillokal;t punar iivartino 'rjuna miim upetya tu kaunteya punar janma na vidyate (Bg. 8.16)

Even though we elevate ourselves to the highest planetary system by the scientific advancement of knowledge or by the religious principles of lifegreat sacrifices and fruitive activities-at the time of dissolution these higher planetary systems and life on them will be destroyed. The words in this verse (isa-vidhvarhsitiisi§am) indicate that all such blessings will be destroyed by the supreme controller. We will not be protected. Our bodies, either in this planet or in another planet, will be destroyed, and again we will have to remain for millions of years in an unconscious state within the body of Maha-Vil;ll).U. And again, when the creation is manifested, we have to take birth in different species of life and begin our activities. Therefore we should not be satisfied simply by a promotion to the higher planetary systems. We should try to get out of the material cosmic manifestation, go to the spiritual world and take shelter of the Supreme Personality of Godhead. That is our highest achievement. We should not be attracted by anything material, higher or lower, but should consider them all on the same

934 Srimad-Bhagavatam [Canto 4, Ch. 22
TRANSLATION

level. Our real engagement should be in inquiring about the real purpose of life and rendering devotional service to the Lord. Thus we will be eternally blessed in our spiritual activities, full ofknowledge and bliss.

Regulated human civilization promotes dharma, artha, ka.ma and mok§a. In human society there must be religion. Without religion, human society is only animal society. Economic development and sense gratification must be based on religious principles. When religion, economic developmentandsense gratification are adjusted,liberation from this material birth, death, old age and disease is assured. In the present age of Kali, however, there is no question of religion and liberation. People have taken interest in economic development and sense gratification. Therefore, despite sufficient economic development all over the world, dealings in human society have become almost animalistic. When everything becomes grossly animalistic, dissolution takes place. This dissolution is to be accepted as Isa-vidhvarhsitiisi�iim. The Lord's so-called blessings of economicdevelopmentandsense gratificationwillbe conclusivelydissolved by destruction. At the end of this Kali-yuga, the Lord will appear as the incarnation of Kalki, and His only business willbe to kill all human beings on the surface of the globe. After that killing, another golden age will begin. We should therefore know that our material activities are just like childish play. Children may play on the beach and the father will sit and watch this childish play, the construction of buildings with sand, the construction of walls and so many things, but finally the father will ask the children tocome home. Then everything is destroyed. Persons who are too much addicted to the childish activities of economic development and sense gratification are sometimes especially favored by the Lord when He destroystheir construction of thesethings.

It is said by the Lord: yasyaham anugrhr-ami hari§ye tad-dhanarh §ana*. The Lord told Yudhi9thira Mahanija that His special favor is shown to His devotee when He takes away all his material opulences. Generally, therefore, it is experienced that Vai�l)avas are not very opulent in the material sense. When a Vai9l)ava, pure devotee, tries to be materially opulent and at the same time desires to serve the Supreme Lord, his devotional service is checked. The Lord, in order to show him a special favor,destroys his so-calledeconomic developmentand materialopulences. Thus the devotee, being frustrated in his repeated attempts at economic development, ultimately takes solid shelter under the lotus feet of the Lord. This kind of action may also be accepted as Isa-vidhvarhsitasifiam, whereby the Lord destroys one's material opulences but enriches him in spiritual understanding.In the course of ourpreaching work,wesometimes

Text 36] Prthu Maharaja's Meeting with the Four Kumaras 935

see that materialistic persons come to us and offer their obeisances to take blessings, which means they want more and more material opulences. If such material opulences are checked, suchpersons are no longer interested in offering obeisances to the devotees. Such materialistic persons are alwaysconcerned about their economicdevelopment.Theyoffer obeisances to saintly persons or the Supreme Lord and give something in charity for preaching work with a view that they will be rewarded with further economic development.

However, when one is sincere in his devotional service, the Lord obliges the devotee to give up his material development and completely surrender unto Him. Because the Lord does not give blessings of material opulence to His devotee, people are afraid of worshiping Lord Vi�Qu because they see that the Vai�Qavas, who are worshipers of Lord Vi�Qu, are poor in superficial material opulences. Such materialistic persons, however, get immense opportunity for economic development by worshiping Lord Siva, for Lord Siva is the husband of the goddess Durga, and Durga is the proprietor of this universe. By the grace of Lord Siva, a devotee gets the opportunity to be blessed by the goddess Durga. RavaQa, for example,was a great worshiper and devotee of Lord Siva, and in return he got all the blessings of goddess Durga, so much so that his whole kingdom was constructed of golden buildings. In Brazil, in this present age,huge quantities ofgold have been found,and fromhistorical references in the Puriir-as, we can guess safely that this was RavaQa's kingdom.This kingdom was, however, destroyed by Lord Ramacandra.

By studying such incidents, we can understand the full meaning of zsa-vidhvamsitiisi�iim. The Lord does not bestow material blessings upon the devotees, for they may be entrapped again in this material world by continuous birth, death, old age, and disease. Due to materialistic opulences, persons like RavaQa become puffed up for sense gratification. RavaQaevendared kidnap Sita,whowas boththewife of Lord Ramacandra and the goddess of fortune, thinking that he would be able to enjoy the pleasure potencyof the Lord. But actually, by such action, RavaQa became vidhvamsita or ruined. At the present moment human civilization is too much attached to economic development and sense gratification and is therefore nearing the path of ruination.

936 Srimad-Bhagavatam [Canto 4, Ch. 22

tat tvarh narendra jagatam atha tasthii§iirh ca dehendriyasu-dhi§ar-atmabhir avrtanam ya� k§etravit-tapataya hrdi visvag av* pratyak cakasti bhagavarhs tam avehi so 'smi

tat-therefore; tvam-you; narendra-0 best of the kings; jagatam-of the moving; atka-therefore; tasthu§iim-the immovable; ca-also; dehabody; indriya-senses; asu-life air; dhi§ar-a-by consideration; iitmabhiftself-realization; avrtaniim-those who are covered in that way; yafl - one who; k§etra-vit-knower of the field; tapatayii-by controlling; hrdi-within the heart; vis'vak-everywhere; iivift-manifest; pratyak-in every hair follicle; cakiisti- shining; bhagaviin-the Supreme Personality of Godhead; tam-unto Him; avehi- try to understand; safl asmi-I am that.

TRANSLATION

Sanat-kumara advised the King: My dear King Prthu, try to understand the Supreme Personality of Godhead, who is living within everyone's heart along with the individual soul, in each and every body, either moving or not moving. They are fully covered by the gross material body and subtle body made of the life air and intelligence.

PURPORT

In this verse it is specifically advised that instead of wasting time in the human form of life endeavoring for economic development and sense gratification, one should try to cultivate spiritual values by understanding the Supreme Personality of Godhead who is existing within the individual soul within everyone's heart. The individual soul and the Supreme Personality of Godhead in His Paramatma feature are both sitting within this body, which is covered by gross and subtle elements. To understand this is to attain actual spiritual culture. There are two ways of advancing in spiritual culture-by the method of the impersonalist philosophers and by devotional service. The impersonalist comes to the conclusion that he and the Supreme Spirit are one, whereas devotees or personalists realize the Absolute Truth by understanding that the Absolute Truth is the supreme predominator and we living entities are predominated; therefore our duty is to serve Him. The Vedic injunctions say: tat tvam asi, "You are the same," and so 'ham, "I am the same." The impersonalist conception of these mantras is that the Supreme Lord or the Absolute Truth and the living entity are one, but from the devotee's point of view these mantras

Text 37] Prthu Maharaja's
;.r: �'SIN*fq6;.rr �
Meeting with the Four Kumaras
R'lllltif: �+44i1Rd�iA'f({t)S,.rll � \911
937

assert that both the Supreme Lord and ourselves are of the same quality. Tat tvam asi, ayam iitmii brahma. Both the Supreme Lord and the living entity are spirit. Understanding this is self-realization. The human form of life is meant for understanding the Supreme Lord and oneself by spiritual cultivation of knowledge. One should not waste valuable life simply engaged in economic development and sense gratification.

In this verse the word k�etra-vit is also important. This word is explained inBhagavad-gitii: idarit sarirarit kaunteya k�etram ity abhidhiyate (Bg.l3.2). This body is called k�etra, or the field of activities, and the proprietors of the body, the individual soul and the Supersoul sitting within the body, are both called k�etra-vit. But there is a difference between the two kinds of k�etra-vit. One k�etra-vit, or knower of the body, namely the Paramatma or the Supersoul, is directing the individual soul. When we rightly Lake the direction of the Supersoul, our life becomes successful. He is directing from within and from without. From within He is directing as caitya-guru, or the spiritualmastersittingwithin the heart. Indirectly He is also helping the living entity by manifesting Himself as the spiritual master outside. In both ways the Lord is giving directions to the living entity so that he may finish up his material activities and come back home, back to Godhead. The presence of the Supreme Soul and Lhe individual soul within the body can be perceived by anyone by the fact that as long as the individual soul and the Supersoul are both living within the body, the body is always shining and fresh. But as soon as the Supersoul and the individual soul give up possession of the gross body, it immediately decomposes. One who is spiritually advanced can thus understand the real difference between a dead body and a living body. In conclusion, one should not waste his time by so-called economic development and sense gratification but should cultivate spiritual knowledge to understand the Supersoul and the individual soul and their relationship. In this way, by advancement of knowledge, one can achieve liberation and the ultimate goal of life. It is said that if one takes to the path of liberation, even rejecting his so-called duties in the material world, he is not a loser at all. But a person who does not take to the path of Liberation yet carefully executes economic development and sense gratification, loses everything. Narada's statement before Vyasadeva is appropriate in this connection:

yatra kva viibhadram abhud amu�ya kim

ko viirtha iipto'bhajatiirh sva-dharmata[!

(Bhiig. 1.5.17)

938 Srimad-Bhagavatam [Canto 4, Ch. 22
tyaktvii sva-dharmarit carartiimbujarit harer
bhajann apakvo'tha patet tato yadi

If a person, out of sentiment or for some other reason, takes to the shelter of the lotus feet of the Lord and in due course of time does not succeed in coming to the ultimate goal of life or falls down due to lack of experience, there is no loss. But for a person who does not take to the devotional service, yet executes his material duties very nicely, there is no gain.

TEXT 38

yasminn idarh sad-asad-atmataya vibhati maya viveka-vidhuti sraji vahi-buddhift tam nitya-mukta-parisuddha-visuddha-tattvarh praty"tu)ha-karma-kalila-prakrtirh prapadye

yasmin-in which; idam-this; sat-asat-the Supreme Lord and His different energies;atmataya-being the root of allcause andeffect;vibhatimanifests;maya-illusion;viveka-vidhuti-liberated by deliberate consideration; sraji-on the rope; va-or; ahi-serpent; buddh*-intelligence; tamunto Him;nitya-eternally;mukta-liberated;parisuddha-uncontaminated; visuddha-pure;tattvam-truth;pratyu�ha-transcendental;karma-fruitive activities; kalila-impurities; prakrtim-situated in spiritual energy; prapadye-surrender.

TRANSLATION

The Supreme Personality of Godhead manifests Himself as one with the cause and effect within this body and also as one who has transcended the illusory energy.Thisclearsthe misconceptionofasnakeforarope.Thusone can understand that the Paramatma is eternally transcendental to the material creation and situated in pure internal energy. Thus He is transcendental to all material contamination. Unto Him only must one surrender.

PURPORT

This verse is specifically stated to defy the Mayavada conclusion of onenesswithout differentiation between the individual soul and the Supersoul. The Mayavada conclusion is that the living entity and the Supersoul are

Text 38] Prthu Maharaja's Meeting with the Four Kumaras 939
J.4f44Nt� ��..� � ;ntn �Tel��1J ��! I ({ �U*MR¥aR�oa<t�� �d��estiftl m 11��11

one; there is no difference. They proclaim that there is no separate existence outside the impersonal Brahman and that the feeling of separation is miiyii or an illusion by which one considers a rope to be a snake. The rope and the snake argument is generally offered by the Mayavadi philosophers. Therefore these words, which represent vivarta-viida, are specifically mentioned herein. Actually Paramatma, the Supersoul, is the Supreme Personality of Godhead, and He is eternally liberated. In other words, the Supreme Personality of Godhead is living within this body along with the individual soul, and this is confirmed in the Vedas. They are likened to two friends sitting on the same tree. Yet Paramatma is above the illusory energy. The illusory energy is called bahirangii sakti or external energy, and the living entity is called tatasthii sakti or marginal potency. As stated in Bhagavad-gitii, the material energy, represented as earth, water, air, fire, sky, etc., and the spiritual energy, the living entity, are both energies of the Supreme Lord. Even though the energies and the energetic are identical, the living entity, individual soul, being prone to be influenced by the external energy, considers the Supreme Personality of Godhead as one with himself.

The word prapadye is also significant in this verse, for it refers to the conclusion of the Bhagavad-gitii: sarva-dharmiin parityajya miim ekam sararwm vraja (Bg. 18.66). In another place the Lord says: bahiiniim janmaniim ante jniinaviin miim prapadyate (Bg. 7.19). This prapadye or sarar-am vraja refers to the individual's surrender to the SupersouL The individual soul, when surrendered, can understand that the Supreme Personality of Godhead,although situatedwithin the heart of the individual soul, is superior to the individual soul. The Lord is always transcendental to the material manifestation, even though it appears that the Lord and the material manifestation are one and the same. According to theVai�l).ava philosophy, He is one and different simultaneously. The material energy is a manifestation of His external potency, and since the potency is identical with the potent, it appears that the Lord and individual soul are one, but actually the individual soul is under the influence of material energy, and the Lord is always transcendental to it. Unless the Lord is superior to the individual soul, there is no question of prapadye or surrender unto Him. This word prapadye refers to the process of devotional service. Simply by nondevotionalspeculation on the rope and the snake, one cannot approach the Absolute Truth. Therefore devotional service is stressed as more important than deliberation or mental speculation to understand the Absolute Truth.

940 Srimad-Bhagavatam [Canto 4, Ch. 22

mti�ij� tf(f;.r)sfq ���flliJfffil� � �� II��II

yat-piida-pankaja-paliisa-viliisa-bhaktyii karmiisayarh grathitam udgrathayanti santa�

tadvan na rikta-matayo yatayo 'pi ruddhasrotogariis tam arararh bhaja viisudevam

yat-whose ; ptida-feet ; pankaja-lotus ; paltisa-petals or toes; viliisa-enjoyment; bhaktyii- by devotional service; karma-fruitive activities; iisayam-desire ; grathitam-hard knot; udgrathayanti-roots out; santa�-devotees; tat-that; vat-like; na-never; rikta-mataya� - persondevoid of devotional service; yataya�-ever increasingly trying; api- even though; ruddha-stopped; srotogartii�-the waves of sense enjoyment; tam-unto Him; araram-worthy to take shelter; bhaja-engage in devotional service; viisudevam-unto Kr�l)a, the son of Vasudeva.

TRANSLATION

The devotees, who are always engaged in the service of the toes of the lotus feet of the Lord, can very easily overcome hard-knotted desires for fruitive activities. Because this is very difficult, the nondevotees-the jiiiinis and yogis-although trying to stop the waves of sense gratification, cannot do so. Therefore you are advised to engage in the devotional service of Kr�J}.a, the son of Vasudeva.

PURPORT

There are three kinds of transcendentalists trying to overcome the influence of the modes of material nature-the jniin"is, yogis and bhaktas. All of them attempt to overcome the influence of the senses, which is compared to Lhe incessant waves of a river. The waves of a river flow incessantly, and it is very difficult to stop them. Similarly, the waves of desire for material enjoyment are so strong that they cannot be stopped by any process other than bhakti-yoga. The bhaktas, by theirtranscendental devotional service unto the lotus feet of the Lord, become so overwhelmed with transcendental bliss that automatically their desires for

Text 39) Prthu
Maharaja's Meeting with the Four Kumiiras TEXT 39 " ����,ijf�� (' , ,.... ,...... �"r�trm%f�trr� �: 1 ij'�
941

material enjoyment stop. The jniinis and yogis, who are not attached to the lotusfeet of the Lord,simply struggle against the waves of desire. They are described in this verse as rikta-mataya[l., which means devoid of devotional service. In other words, the jiiiinis and yogis, although trying to be free from the desires of material activities, actually become more and more entangled in false philosophical speculation or strenuous attempts to stop the activities of the senses. As stated previously:

vasudeve bhagavati bhakti-yoga[l. prayojita[l. janayaty iisu vairiigyam jiiiinam ca yad ahaitukam (Bhag. 1.2.7)

Here also the same point is stressed. Bhaja vasudevam indicates that one who is engaged in the loving service of K{�Q.a, the son of Vasudeva, can very easily stop the waves of desires. As long as one will continue to try to artificially stop the waves of desires, he will certainly be defeated. That is indicated in this verse. Desires for fruitive activities are strongly rooted, but the trees of desire can be uprooted completely by devotional service because devotional service employs superior desire. One can give up inferior desires when engaged in superior desires. To try to stop desires is impossible. One has to desire the Supreme in order not to be entangled in inferior desires. ]iiiinis also maintain a desire to become one with the Supreme, but such desire is also considered to be kama, lust. Similarly, the yogis desire mystic power, and that is also kama. And the bhaktas, not being desirous of any sort of material enjoyment, become purified. There is no artificial attempt to stop desire. Desire becomes a source of spiritual enjoyment under the protection of the toes of the lotus feet of the Lord. It is stated herein by the Kumaras that the lotus feet of the Lord Kr�Q.a are the ultimate reservoir of all pleasure. One should therefore take shelter of the lotus feet of the Lord instead of trying unsuccessfully to stop desires for material enjoyment. As long as one is unable to stop the desire for material enjoyment, there is no possibility of becoming liberated from the entanglement of material existence. It may be argued that the waves of a river are incessantly flowing and that they cannot be stopped, but the waves of the river flow towards the sea. When the tide comes over the river, it overwhelms the flowing of the river, and the river itself becomes overflooded, and the waves from the sea become more prominent than the waves from the river. Similarly, a devotee with intelligence plans so many things for the service of the Lord in K{�Q.a consciousness that stagnant material desires become overflooded by the desire to serve the Lord. As

942 Srimad-Bhagavatam [Canto 4, Ch. 22

confirmed by Yamunacarya, since he has been engaged in the service of the lotus feet of the Lord, there is always a current of newer and newer desires flowing to serve the Lord, so much so that the stagnant desire· of sex life becomes very insignificant. Yamunacarya even says that he spits on such desires. Bhagavad-gztii also confirms: param dr§tvii nivartate (Bg. 2.59). The conclusion is that by developing a loving desire for the service of the lotus feet of the Lord, we subdue all material desires for sense gratification.

TEXT40

krcchro mahan iha bhaviir[tavam aplavesiim

�a{i-varga-nakram asukhena titzr�anti

tat tvam harer bhagavato bhajanzyam anghrim

krtvo{iuparh vyasanam uttara dustariir[tam

krcchra�-troublesome; mahan-very great; iha-here in this life; bhavaar!wvam- ocean of rnaterial existence; aplava-zsiim-of the nondevotees, who have not taken shelter of the lotus feet of the Supreme Personality of Godhead; �at-varga-six senses; nakram-sharks; asukhena-with great difficulty; titir�anti-cross over; tat-therefore; tvam-you; hare�-of the Personality of Godhead; bhagavatal;t-of the Supreme; bhajanzyam-worthy of worship; anghrim-the 'lotus feet; krtvii-making; u{iupam- boat; vyasanam-all kinds of dangers; uttara-cross over; dustara-very difficult; ariJ.am- the ocean.

TRANSLATION

The ocean of nescience is very difficult to cross because it is infested with many dangerous sharks.Although those who are nondevotees undergo severe austerities and penances to cross that ocean, we recommend that you simply take shelter of the lotus feet of the Lord, which are like boats for crossing the ocean. Although the ocean is difficult to cross, by taking shelter of His lotus feet you will overcome all dangers.

PURPORT

Material existence is compared herein with the great ocean of nescience. Another name of this ocean is VaitaraQ.i. In that Vailara¢ ocean, which is

Text40] Prthu Maharaja's Meeting with the Four Kumaras 943
I ... C' �� mtT;fflt ��tt �q1� �� ��ilui't11\loll
� 'i(IM( �q��� 't�q�"ftfl'4ij@'1 ffflfi�

the Causal Ocean, there are innumerable universes

floating like

footballs. On the other side of the ocean is the spiritual world of VaikuQ�ha, which is described in Bhagavad-g!tii as paras tasmiit tu bhiivo 'nyo (Bg. 8.20). Thus there is an ever-existing spiritual nature which is beyond this material nature. Even though all the material universes are annihilated again and again in the Causal Ocean, the VaikuQ�ha planets, which are spiritual, exist eternally and are not subject to dissolution. The human form of life gives the living entity a chance to cross the ocean of nescience, which is this material universe,and enterinto the spiritualsky.Although there are many methods or boats by which one can cross the ocean, the Kumiiras recommend that the King take shelter of the lotus feet of the Lord, just as one would take shelter of a good boat. Nondevotees, who do not take shelter of the Lord's lotus feet, try to cross the ocean of nescience by other methods (karma, jiiiina and yoga), but they have a great deal of trouble. Indeed, sometimes they become so busy simply enjoying their troubles that theynever crossthe ocean.There is no guarantee that the nondevotees will cross the ocean, but even though they manage to cross, they have to undergo severe austerities and penances. On the other hand, anyone who takes to the process of devotional service and has faith that the lotus feet of the Lord are safe boats to cross that ocean is certain to cross very easily and comfortably.

Prthu Maharaja is therefore advised to take the boat of the lotus feet of the Lord to easily cross overall dangers.Dangerous elements in the universe are compared to sharks in the ocean. Even though one may be a very expertswimmer,he cannot possibly survive if he is attacked bysharks. One often sees that many so called sviim!s and yogis sometimes advertise themselves as competent to cross the ocean of nescience and to help others cross, but in actuality they are found to be simply victims of their own senses. Instead of helping their followers to cross the ocean of nescience, such sviim!s and yogis fall prey to miiyii, represented by the fair sex, woman, and are thus devoured by the sharks in that ocean.

944 Srimad-Bhagavatam [Canto 4, Ch. 22
TEXT4l it5fq �·n"f � � iRI�IJf �IJfR'llt�I CS:�I<tl�•lf«:('('tt'fSI�I�d�:����II maitreya uviica sa evarh brahma-putrer-a kumiirertiitma-medhasii

maitreya(l. uviica- the great sage Maitreya continued to say; sa[l.-the King; evam-thus; brahma-putre!la-by the son of Lord Brahma; kumiire[Laby one of the Kumaras; iitma-medhasii-well versed in spiritual knowledge; darsita-being shown; iitma-gati[l.-spiritual advancement; samyak-completely; prasasya-worshiping; UVUCa-said; tam-unto him; nrpa{I-the King.

TRANSLATION

Being thus enlightened to complete spiritual knowledge by the son of Brahma-one of the Kumiiras, who was complete in spiritual knowledgethe King worshiped them in the following words.

PURPORT

In this verse the word iitma-medhasii is commented upon by Sripada Visvanatha Cakravarti Thakura, who says that iitmani means unto Lord �91]a, paramiitmani. Lord ��!]a is Paramiitma (iSvarafi. paramafi. kr�f'afi., Brahma-samhitii, 5.1); therefore one whose mind is acting fully in ��l]a consciousness is called iitma-medhiifi.. This may be contrasted to the word grha-medh"i, which refers to one whose brain is always engrossed with thoughtc; of material activities. The iitma-medhiifi. is always thinking of Kr�I:la's activities in Kr�I:!a consciousness. Since Sanat-kumara, who was a son of Lord Brahma, was fully Kr�l]a conscious, he could point out the path of spiritual advancement. The word iitma-gatifi. refers to that path of activities by which one can make progress in understanding Kr�J;�.a.

TEXT42

H�Tm

�it�:'leim-m��;;q;n 1

ij+uqii(Pid JRiil. � \J:4¥tl•atm 11\l�ll

riijoviica

krto me 'nugraha[l. purvarh

harir-iirtiinukampinii

tam iipiidayiturh brahman

bhagavan yuyam iigatii(l.

Text42) Prthu Maharaja's Meeting
Kumiiras darsitiitma-gati[l. samyak prasasyoviica tam nrpa[l. 945
with the Four

rap uvaca- the King said; krta�-done; me-unto me; anugraha�causeless mercy; purvam-formerly; harirtii-by the Supreme Personality of Godhead, Lord Vi�Q.U; arta-anukampina- compassionate for persons in distress; tam-that; tipiidayitum-to confirm it; brahman-0 briihmap.a; bhagavan-0 powerful one; yuyam-all of you; iigatii� -have arrived here.

TRANSLATION

The King said: 0 brahmaQ.a, 0 powerful one, formerly Lord Vi�J.l.U showed me His causeless mercy, indicating that you would come to my house, and to confirm that blessing, you have all come.

PURPORT

When Lord Vi�Q.U appeared on the great arena of sacrifice at the time when King Prthu was performing a great sacrifice (aivamedha), He predicted that the Kumaras would very soon come and advise the King. Therefore Prthu Maharaja remembered the causeless mercy of the Lord and thus welcomed the arrival of the Kumaras, who were fulfilling the Lord's prediction. In other words, when the Lord makes a prediction, He fulfills that prediction through some of His devotees. Similarly, Lord Caitanya Mahaprabhu predicted that both His glorious names and the Hare Kr�Qa mahii-mantra would be broadcast in all the towns and villages of the world. Srila Bhaktivinoda Thakura and Srila Bhaktisiddhanta Sarasvafi Prabhupada desired to fulfill this great prediction, and we are following in their footsteps.

Regarding His devotees, Lord Kr�Qa told Arjuna, kaunteya pratijan"ihi na me bhakta[l prar;zasyati: "0 son of Kunti, declare it boldly that My devotee will never perish." (Bg. 9.31) The point is that the Lord Himself could declare such things, but it was His desire to make the declaration through Arjuna and thus doubly assure that His promise would never be broken. The Lord Himself promises, and His confidential devotees execute the promise. The Lord makes so many promises for the benefit of suffering humanity. Although the Lord is very compassionate upon suffering humanity, human beings are generally not very anxious to serve Him. The relationship is something like that between the father and the son; the father is always anxious for the welfare of the son, even though the son forgets or neglects the father. The word anukampinii is significant; the Lord is so compassionate upon the living entities that He comes Himself into this world in order to benefit fallen souls.

yadiiyadiihidharmasya gliinir bhavati bhtirata

946 Srimad-Bhagavatam [Canto 4, Ch. 22

"Whenever and wherever there is a decline in religious practice, 0 descendant of Bharata, and a predominantrise of irreligion-at that time I descend Myself." (Bg. 4.7)

Thus it is out of compassion that the Lord appears in His different forms. Lord Sri Kreyqa appeared on this planet out of compassion for fallen souls; Lord Buddha appeared out of compassion for the poor animals who were being killed by the demons; Lord Nrsini.hadeva appeared out of compassion for PrahHida Maharaja. The conclusion is that the Lord is so compassionate upon the fallen souls within this material world that He comes Himself or sends His devotees and His servants to fulfill His desire to have all the fallen souls come back home, back to Godhead. Thus Lord Sri Kreyqa instructed Bhagavad-gitii to Arjuna for the benefit of the entire human society. Intelligent men should therefore seriously consider this Kreyqa consciousness movement and fully utilize the instructions of Bhagavad-gitii as preached without adulteration by His pure devotees.

TEXT 43

(;wtqlfa31����Wf��riiJI�: I

�-s! ft if -��(it� IIV�II

ni�paditas ca kartsnyena

bhagavadbhir ghrp.alubh*

sadhucchi�tam hi me sarvam

atmana saha kim dade

ni§padital;t ca-also the order is properly carried out; kartsnyena-in full; bhagavadbhi[t-by the representatives of the Supreme Personality of Godhead; ghrl).a-alubhil;t-by the most compassionate; sadhu-ucchi�{am-remnants of the foodstuffs of saintly persons;hi-certainly;me-mine;sarvameverything; atmanii-heart and soul; saha-with; kim-what; dade-shall give.

TRANSLATION

My dear brahmaJ)a, you have carried out the order thoroughly because you are also as compassionate as the Lord. It is my duty, therefore, to offer you something, but I only possess remnants of food taken by great saintly persons. What shall I give?

Text 43] Prthu Maharaja's Meeting with the Four Kumaras abhyutthiinam adharmasya tadiitmiinarh srjiimy aham 947

The word siidhiicchi§tam is significant in this verse. Prthu Maharaja got his kingdom from great saintly persons like Bhrgu and others just as one gets remnants of food. After the death of King Vena, the whole world was bereft of a popular ruler. There were so many catastrophes occurring that the great saintly persons, headed by Bhrgu, created the body of King Prthu out of the body of his dead father, King Vena. Since King Prthu was thus offered the kingdom by the virtue of the mercy of great saintly persons, he did not want to divide his kingdom among saints like the Kumaras. When a father is eating food, he may, out of compassion, offer the remnants of his food to his son. Although such food may be already chewed by the father, it cannot be offered to the father again. Prthu Maharaja's position was something like this; whatever he possessed had already been chewed, and therefore he could not offer it to the Kumaras. Indirectly, however, he offered everything he possessed to the Kumaras, and consequently they utilized his possessions m whatever way they liked. The next verse clarifies this matter.

TEXT44

3111111�:

��

(1qR+4§�J: I

ri �61{_11\l\lll

prar-a dara� suta brahman grhas ca sa-paricchada� rajyarh balarh mah"i kosa iti sarvarh niveditam

pri:il}a�-life; di:iri:i�-wife; suti:i�-children; brahman-0 great bri:ihmar-a; grha�-home; ca-also; sa-with; paricchada�-all paraphernalia; rajyamkingdom; balam-strength; mah"i-land; kosa�-treasury; iti-thus; sarvameverything; niveditam-offered.

TRANSLATION

The King continued: Therefore, my dear brahmaJ;tas, my life, wife, children, home, furniture and household paraphernalia, my kingdom, strength, land, and especially my treasury, are all offered nnto you.

PURPORT

In some readings, the word diirii[l. is not used, but the word used then is riiya[l., which means wealth. In India there are still wealthy persons who

948 Srimad-Bhagavatam [Canto 4, Ch. 22
PURPORT
��� ·�
��

are recognized by the state as rii.ya. A great devotee of Lord Caitanya Mahaprabhu was called Ramananda Raya because he was governor of Madras and very rich. There are still many holders of the title rii.yaRaya Bahadur, Raya Chaudhuri and so on. The diirii[t, or wife, is not permitted to be offered to the brii.hmaras. Everything is offered to worthy persons who are able to accept charity, but nowhere is it found that one offers his wife; therefore in this case the reading rii.ya� is more accurate than dii.rii.{t. Also, since Prthu Maharaja offered everything to the Kumaras, the word kosa� (treasury) need not be separately mentioned. Kings and emperors used to keep a private treasury which was known as ratna-bhii.rpa. The ratna-bhii.rufa was a special treasury room which contained special jewelries, such as bangles, necklaces and so on, which were presented to the king by the citizens. This jewelry was kept separate from the regular treasury house where all the collected revenueswere kept. Thus Prthu Maharaja offered his stock of private jewelry to the lotus feet of the Kumaras. Ithas already been admittedthat allthe King's property belonged to the brii.hmarws and that Prthu Maharaja was simply using it for the welfare of the state. If it were actually the property of the briihmafJas, how could it be offered again to them? In this regard, Sripada Sridhara

Svami has explained that this offering is just like the servant's offering of food to his master. The food already belongs to the master, for the master has purchased it, but the servant, by preparing food, makes it acceptable to the master and thus offers it to him. In this way, everything belonging to Prthu Maharaja was offered to the Kumaras.

TEXT45

:q- �q :q ��q-iR :q I

:q- ��� II'J�II

sainapatyam ca rajyam ca da[tpa-netrtvam eva ca sarva-lokiidhipatyam ca veda-siistra-vid arhati

sainiipatyam-post of commander-in-chief; ca-and; riijyam-post of rulerover the kingdom;ca-and;da�J�a-ruling;netrtvam-leadership;evacertainly; ca-and;sarva-all;loka-adhipatyam-proprietorship of the planet; ca-and; veda-siistra-vit-one who knows the purport of Vedic literature; arhati-deserves. ·

Text 45)
949
Prthu Maharaja's Meeting with the Four Kumaras
ri�

Since only a person who is completely educated according to the principles of Vedic knowledge deserves to be commander-in-chief, ruler of the state, the first to chastise and the proprietor of the whole planet, Prthu Maharaja offered everything to the Kumiiras.

PURPORT

In this verse it is very clearly stated that a kingdom, state or empire must be governed under the instructions of saintly persons and briihmarzas like the Kumaras. When monarchy ruled throughout the world, the monarchwas actually directedby a board of brahma�as and saintlypersons. The king, as the administrator of the state, executed his duties as a servant of the briihmarzas. It was not that the kings or briihmarzas were dictators, nor did they consider themselves proprietors of the state. The kings were also well versed in Vedic literatures and thus were familiar with the injunction of Sri: Isopani�ad: i:siiviisyam idam sarvam - ev erything that exists belongs to the Supreme Personality of Godhead. In Bhagavad-gitii Lord Kr�Qa also claims that He is the proprietor of all planetary systems (sarva-loka-mahesvaram). Since this is the case, no one can claim to be proprietor of the state. The king, president or head of the state should always remember that he is not the proprietor but the servant.

In the present age, the king or president forgets that he is the servant of God and thinks of himself as servant of the people. The present democratic government is proclaimed to be a people's government, a government by the people and for the people, but this type of government is notsanctioned by the Vedas. The Vedas maintain that a kingdom should be governed for the purpose of satisfying the Supreme Personality of Godhead and should therefore be ruled by a representative of the Lord. The head of a state should not be appointed if he is bereft of all Vedic knowledge. In this verse it is clearly stated (veda-siistra-vid arhati) that all high government posts are especially meant forpersons who arewell conversant with the teachings of the Vedas. In the Vedas thereare definite instructions defining how aking, commander-in-chief, soldier andcitizen shouldbehave. Unfortunately there are many so-called philosophers in the present age who give instruction without citing authority, and many leaders follow their unauthorized instruction. Consequently people are not happy.

The modern theory of dialectic communism, set forth by Karl Marx and followed by communist governments, is not perfect. According to Vedic communism, no one in the state should ever starve. Presently there

950 Srimad-Bhagavatam [Canto 4, Ch. 22
TRANSLATION

are many bogus institutions which are collecting funds from the public for the purpose ofgiving foodto starving people, but these funds are invariably misused. According to the Vedic instructions, the government should arrange things in such a way that there will be no question of starvation. In the Sr"imad-Bhiigavatam it is stated that a householder must see to it that even a lizard or a snake does not starve. They also must be given food. In actuality,however,there is no question of starvation because everything is the property of the Supreme Lord, and He sees to it that there is ample arrangement for feeding everyone. In the Vedas it is said: eko bahuniim yo vidadhiiti kiimiin (Ka,tha Up. 2.2.13). The Supreme Lord supplies the necessities of life to everyone, and there is no question of starvation. If anyone starves, it is due to the mismanagement of the so-called ruler,governor or president.

It is clear therefore that a person who is not well versed in the Vedic injunctions (veda-siistra-vit) should not run for election as president, governor, etc. Formerly kings were riijar§is, which meant that although they were serving as kings, they were as good as saintly persons because they would not transgress any of the injunctions of the Vedic scriptures and would mle under the direction of great saintly persons and briihmartas. According to this arrangement, modern presidents, governors and chief executive officers are all unworthy of their posts because they are not conversant with Vedic administrative knowledge and they do not take direction fromgreat saintlypersons and briihmartas. Because of his disobedience to theorders of the Vedas and the brahma1Jas, King Vena, Prthu Maharaja's father, was killed by the briihmartas. Prthu Maharaja therefore knew very well that it behooved him to rule the planet as the servant of saintly persons and briihmartas.

TEXT 46

svam eva briihmar-o bhunkte svam vaste svam dadiiti ca tasyaiviinugraher-iinnarh

svam-own;eva-certainly; briihmar-a[!-the briihmar-as; bhunkte-enj o y; svam-own; vaste -clothing ; svam-own ; dadiiti-gives in charity; ca-and; t asya-his; eva-certainly; anugraher-a-by the mercy of; annam-food

Text 46] Prthu Maharaja's Meeting with the Four Kumaras 951
�;nmuft������� I ij������ m aJf'P•IIG:44! ����II
bhuiijate k�atriyiidayaft

grains; bhuiijate-eats; kfiatriya-adayab- -other divisions of the society, headed by the kfiatriyas.

TRANSLATION

The �atriyas, va1syas and sudras eat their food by virtue of the brahma1,1as' mercy. It is the brahma1,1as who enjoy their own property, clothe themselves with their own property and give charity with their own property.

PURPORT

The Supreme Personality of Godhead is worshiped with the words namo brahmar-_ya-devaya, which indicate that the Supreme Lord accepts the brahmar-as as worshipable gods. The Supreme Lord is worshiped by everyone, yet lo teach others He worships the brahmar-as. Everyone should follow the instructions of the brahmar-as, for their only business is to spread sabda-brahma or Vedic knowledge all over the world. Whenever there is a scarcity of briihmar-as to spread Vedic knowledge, chaos throughout human society results. Since briihmar-as and Vai�l)avas are direct servantsoftheSupreme Personality of Godhead, theydonot depend onothers. In actuality, everything in the world belongs to the briihmar-as, and out of their humility the briihmar-as accept charity from the kfiatriyas, or kings, and the vaisyas, or merchants. Although everything belongs to the briihmar-as, the kfiatriyas and vaiSyas keep everything in custody, and whenever the briihmar-as need money, they supply it. It is like a savings account with money which the depositor can draw out at his wilL The briihmar-as, being engaged in the service of the Lord, have very little time to handle the finances of the world, and therefore the riches are kept by the kfiatriyas or the kings, who are to produce money upon the briihmar-as' demand. Actually the briihmar-as or Vai§ll)avas do not live at others' cost; they live by spending their own money, although it appears that they are collecting this money from others. K,satriyas and vaiSyas have no right to give charity because whatever they possess belongs to the brahmar-as. Therefore charity should be given by the kfiatriyas and vaisyas under the instructions of the briihmartas . Unfortunately at the present moment there is a scarcity of briihmartas, and since there is no one to advise the kfiatriyas and vaisyas, the world is in a chaotic condition.

The second line of this verse indicates that the kfiatriyas, vaisyas and sudras eat only by virtue of the briihma�J.a 's mercy; in other words, they should not eat anything which is forbidden by the brahmar-as. The briihmaras and Vai�Q.avas know what to eat, and by their personal example they do not eat anything which is not offered first to the Supreme Person-

952 Srimad-Bhagavatam [Canto 4, Ch. 22

Text47] Prthu Maharaja's Meeting with the Four Kumaras 953

ality of Godhead. They eat only prasiida, or remnants of the food offered to the Lord. The kfiatriyas, vaisyas and sudras should eat only Kreyqaprasadam, which is afforded them by the mercy of the brahmar-as. They cannot open slaughterhouses and eat meat, fish or eggs, or drink liquor, or earn money for this purpose without authorization. In the present age, because society is not guided by brahminical instruction, the whole population is only absorbed in sinful activities. Consequently everyone is deservedly being punished by the laws of nature. This is the situation in this age of Kali.

yair zdriibhagavato gatir atma-vada ekantato nigamibh* pratipadita na�

tufiyantv adabhra-karur-aft sva-krtena nityam ko nama tat pratikaroti vinoda-patram

yai[l-by those;idrii-such kind of;bhagavatal)-of the Supreme Personality of God�ead; gat*-progress; atma-vade-spiritual consideration; ekantatal;l-in ·complete understanding;nigamibh*-by Vedic evidences; pratipadita-conclusively established;nal)-unto us;tufiyantu-be satisfied; adabhra-unlimited; karur-al;l-mercy; sva-krtena-by your own activity; nityam-eternal;kal;l-who;nama-no one;tat-that;pratikaroti-counteracts; vina-without;uda-patram-offering of water in cupped hands.

TRANSLATION

J>tthu Maharaja continued: How can such persons, who have rendered unlimitedservice byexplaining the path of self-realization in relation to the Supreme Personality of Godhead, and whose explanations are given for our enlightenment with complete conviction and Vedic evidence, be repaid except by folded palms containing water for their satisfaction? Such great personalities can be satisfied only by their own activities, which are distributed amongst human society out of their unlimited mercy.

PURPORT

Great personalities of the material world are very eager to render welfare service to human society, but actually no one can render better

� •1Rt�l€+tcn�
� � � ;nq �ctiilRI II'J\911
TEXT47 �{tt�"i
�_.mPt•tf'tM:SIRt41�(11 wt: I dQ4Wf!lii)i(Cfi(illlt:

service than one who distributes the knowledge of spiritual realization in relation with the Supreme Personality of Godhead. All living entities are within the clutches of the illusory energy. Forgetting their real identity, they hover in material existence, transmigrating from one body to another in search of apeaceful life. Sincethese living entities have very little knowledge of self-realization, they are not getting any relief, although they are very anxious to attain peace of mind and some substantial happiness. Saintly persons like the Kumaras, Niirada, Prahlada, Ianaka, Sukadeva Gosviimi, Kapiladeva, as well as the followers of such authorities as the Vai�r;tava iiciiryas and their servants, can render a valuable service to humanity by disseminating knowledge of the relationship between the Supreme Personality of Godhead and the living entity. Such knowledge is the perfect benediction for humanity.

Knowledge of Kr�qa is such a great gift that it is impossible to repay the benefactor. Therefore Prthu Maharaja requested the Kumiiras to be satisfied by their own benevolent activities, which involved delivering souls from the clutches of miiyii. The King saw that there was no other way to satisfy them for their exalted activities. The word vinodapiitram can be divided into two words, vinii and uda-piitram, or can be understood as one word, vinoda-piitram, which means joker. A joker's activities simply arouse laughter, and a person who tries to repay the spiritual master or teacher of the transcendental message of Kr�qa becomes a laughing stock just like a joker because it is not possible to repay such a debt. The best friend and benefactor of all people is one who awakens humanity to its original Kr�r:ta consciousness.

TEXT48

�5tq�

� 3fl�q1•a4ijJOt 31tRo'Jttt �ffl: 1

maitreya uviica

ta iitma-yoga-pataya

iidi-riijena pujitiif!.

silam tadiyam �amsantaf!.

khe 'bhavan mifiatiim nrr-iim

maitreyaf!. uviica- the great sage Maitreya continued to speak; te- they; iitma-yoga-pataya[l.-the masters of self-realization by devotional service;

954 Srimad-Bhagavatam [Canto 4, Ch. 22
��,��:�qf���ll��ll

iidi-riijena-by the original King (Prthu); piijitii�-being worshiped; s'ilamcharacter; tadiyam- of the King; samsanta�-eulogizing;khe-in the sky; abhavan- appeared;mi�atiim-while observing; nr[Uim-of the people.

TRANSLATION

Being thus worshiped by Maharaja Pfthu, the four Kumiiras, who were masters of devotional service, became very pleased. Indeed, they appeared in the sky and praised the character of the King, and everyone observed them.

PURPORT

It is said that the demigods never touch the surface of the earth. They walkandtravel in spaceonly. Like thegreat sage Niirada,theKumaras do not require any machine to travel in space. There are also residents of Siddhaloka who can travel in space without machines. Since they can go from one planet to another, they are called siddhas; that is to say they have acquiJed all mystic and yogic powers. Such great saintly persons who have attained complete perfection in mystic yoga are not visible in this age on earth because humanity is not worthy of their presence. The Kumaras, however, praised the characteristics of Maharaja Prthu and his great devotional attitude and humility. The Kumaras were greatly satisfied by King Prthu's method of worship. It was by the grace of Maharaja Prthu that the common citizens in his domain could see the Kumaras flying in outer space.

TEXT 49

3llft.:filqflci41�14it;:r 3ll�+i;:qi4Rtf('l: 11\l�ll

vainyas tu dhuryo mahatiim samsthityadhyatma-sikfiaya

iipta-kamam ivatmanam mena atmany avasthita[t

vainya[t-the son of Vena Maharaja (Prthu);tu-of course;dhurya�-Lhe chief; mahatam-of great personalities; samsthityii -being completely fixed; iidhyiitma-sik�ayii-in the matter of self-realization;iipta- achieved; kiimam-desires;iva-Like;atmanam-inself-satisfaction;mene-considered; 'iitmani-in the self;avasthita�-situated.

Text 49] Prthu Maharaja's Meeting with the Four Kumaras 955
��fte��IUfk+i��
I

Amongst great personalities, Maharaja Prthu was the chief by virtue of his fixed position in relation to spiritual enlightenment. He remained satisfied as one who has achieved all success in spiritual understanding.

PURPORT

Remaining fixed in devotional service gives one the utmost in selfsatisfaction. Actually self-satisfaction can be achieved only by pure devotees who have no desire other than to serve the Supreme Personality of Godhead. Since the Supreme Personality of Godhead has nothing to desire, He is fully satisfied with Himself. Similarly, a devotee who has no desire other than to serve the Supreme Personality of Godhead is as self-satisfied as the Supreme Lord. Everyone is hankering after peace of mind and selfsatisfaction, but these can only be achieved by becoming a pure devotee of the Lord.

King Prthu's statements in previous verses regarding his vast knowledge and perfect devotional service are justified here, for he is considered best amongst all mahiitmiis. In Bhagavad-gitii Sri Kr�J;la speaks of mahiitmiis in this way:

mahatmanas tu marh partha daiv"irh prakrtim iisritiift

bhajanty ananya-manaso jiiiitva bhutiidim avyayam

"0 son of Prtha, those who are not deluded, the great souls, are under the protection of the divine nature. They are fully engaged in devotional service because they know Me as the Supreme Personality of Godhead, original and inexhaustible." (Bg. 9.13)

The mahiitmiis are not under the clutches of the illusory energy but are under the protection of the spiritual energy. Because of this, the real mahiitmii is always engaged in the devotional service of the Lord. Prthu Maharaja exhibited all the symptoms of a mahiitmii; therefore he is mentioned in this verse as dhuryo mahatiim, best of the mahiitmiis.

TEXT 50

956 Srimad-Bhagavatam [Canto 4, Ch. 22
TRANSLATION

karmiir-i-activities; ca-also; yathii-kiilam-befitting time and circumstances; yathii-desam-befitting the place and situation; yathii-balambefitting one's own strength ;yathii-ucitam-as far as possible;yathii-vittamas far as one can spend money in this connection; akarot-performed; brahma-siit-in the Absolute Truth; krtam-did.

TRANSLATION

Being self-satisfied, Maharaja J>tthu executed his duties as perfectly as possible according to the time and his situation, strength and financial p<>sition. His only aimin all his activitieswas to satisfy the Absolute Truth. In this way, he duly acted.

PURPORT

Maharaja Prthu was a responsible monarch, and he had to execute the duties of a k�atriya, a king and a devotee at the same time. Being perfect in the Lord's devotional service, he could execute his prescribed duties with complete perfection as befitted the time and circumstance and his financial strength and personal ability. In this regard, the word karmiir-i in this verse is significant. Prthu Mahiiriija's activities were not ordinary because they were in relationship with the Supreme Personality of Godhead. Srila Rupa Gosvami has advised that things which are favorable to devotional service should not be rejected, nor should activity favorable for devotional service be considered ordinary work or fruitive activity. For example, an ordinary worker conducts business in order to earn money for his sense gratification. A devotee may perform the same work in exactly the same way, but his aim is to satisfy the Supreme Lord. Consequently his activities are not ordinary.

Prthu Maharaja's activities were therefore not ordinary but were all spiritual and transcendental, for his aim was to satisfy the Lord. Just as Arjuna, who was a warrior, had to fight to satisfy Kr�J;ta, Prthu Maharaja performed his royal duties as king for the satisfaction of Kr�J;ta. Indeed, whatever he did as emperor of the whole world was perfectly befitting a pure devotee. It is therefore said by a V ai�l).ava poet, va�r-avera kriyii mu!lha vijne na bujhaya: no one can understand the activities of a pure devotee. A pure devotee's activities may appear like ordinary activities, but

Text 50)
ca yatha-kiilam
yathii-balam yathocitarh yathii-vittam akarod brahma-siit-krtam 957
Prthu Maharaja's Meeting with the Four Kumaras karmiir-i
yathii-desam

behind them there is profound significance-the satisfaction of the Lord. In order to understand the activities of a Vai�l)ava, one has to become very expert. Maharaja Prthu did not allow himself to function outside the institution of four var[tas and four iisramas, although as a Vai�l)ava he was a paramahamsa, transcendental to all material activities. He remained at his position as a k�atriya to rule the world and at the same time remained transcendental to such activities by satisfying the Supreme Personality of Godhead. Concealing himself as a pure devotee, he externally manifested himself as a very powerful and dutiful king. In other words, none of his activities were carried out for his own sense gratification; everything he did was meant for the satisfaction of the senses of the Lord. This is clearly explained in the next verse.

TEXT 51

phalarh brahma[ti sann_yasya nirvi�ahga� samahita� karmadhyak�am ca manviina iitmiinarh prakrte� param

phalam-result; brahma[ti-in the Absolute Truth; sannyasya-giving up; nirv�anga�-without being contaminated; samiihita�-completely dedicated; karma-activity; adhyak�am-superintendent; ca-and; manviina�always thinking of; iitmiinam-the Supersoul;prakrte�-of material nature; param-transcendental.

TRANSLATION

Maharaja Prthu completely dedicated himself to be an eternal servant of the Supreme Personality of Godhead, transcendental to material nature. Consequently all the fruits of his activities were dedicated to the Lord, and he always thought of himself as the servant of the Supreme Personality of Godhead, who is the proprietor of everything.

PURPORT

The life and dedication of Maharaja Prthu in the transcendental loving service of the Supreme Personality of Godhead serve as a good example of karma-yoga. The term karma-yoga is often used in Bhagavad-g'itii, and herein Maharaja Prthu is giving a practical example of what karma-yoga

958 Srimad-Bhagavatam [Canto 4, Ch. 22
qfUI � ��: ��: I � � �3U�+u4�:
�
q�����II

actually is. The first requirement for the proper execution of karma-yoga is given herein. Phalam brahmar-i sannyasya (or vinyasya): One must give the fruits of his activities to the Supreme Brahman, Parabrahman, Kr�t:J.a. By doing so, one actually situates himself in the renounced order of life, sannyiisa. As stated in Bhagavad-gitii, giving up the fruits of one's activities to the Supreme Personality of Godhead is called sannyiisa. Although he was living as a householder, P:rthu Maharaja was actually in the renounced order of life, sannyiisa. This will be clearer in the following verses.

The word nirvi�anga� (uncontaminated) is very significant because Maharaja Prthu was not attached to the results of his activities. In this material world a person is always thinking of the proprietorship of everything he accumulates or works for. When the fruits of one's activities are rendered to the service of the Lord, one is actually practicing karma-yoga. Anyone can practice karma-yoga, but it is especially easy for the householderwho can install the Deity of the Lord in the home and worship Him according to the methods of bhakti-yoga. This method includes nine items: hearing, chanting, remembering, serving, worshiping the Deity, praying, carrying oul orders, serving Kr�Qa as friend and sacrificing everything for Him. These methods of karma-yoga and bhakti-yoga are being broadcast all over the world by the International Society for Krishna Consciousness. Anyone can learn these methods simply by following the examplesof the members of the Society.

In one's home or a temple, the Deity is considered the proprietor of everything, and everyone is considered the Deity's eternal servant The Lord is transcendental, for He is not part of this material creation. The words prakrte� param are used in this verse because everything within this material world is created by the external material energy of the Lord, but the Lord Himself is not a creation of this materialenergy. The Lord is the supreme superintendent of all material creations, as confirmed in Bhagavad-gitii:

mayiidhyak�er-a prakrt*

suyate sa-cariicaram

hetuniinena kaunteya

jagad viparivartate

"This material nature is working under My direction, 0 son of Kunti, producing all the moving and unmoving beings, and byits rule this manifestation is created and annihilated again and again." (Bg. 9. I 0)

Text 51) Prthu Maharaja's Meeting with the Four Kumaras 959

All material changes andmaterial progresstaking place by the wonderful interaction of matter are under the superintendence of the Supreme Personalityof Godhead, Kr�t:J.a. Events in the material world are not taking place blindly. If one always remains as a servant of Kr�t:�-a and engages everything in His service, he is accepted as fivan-mukta, a liberated soul, even during his lifetime within the material world. Generally liberation takes place after one gives upthis body, but one who lives according to the example of Prthu Maharaja is liberated even in this lifetime. In Kr�t:Ia consciousness the results of one's activities depend on the will of the Supreme Person. Indeed, in all cases the result is not dependent on one's own personal dexterity but is completely depend�nt on the will of the Supreme. This is the real significance of phalarh brahmari sannyasya. A soul dedicated to the service of the Lord should never think of himself as the personal proprietor or the superintendent. A dedicated devotee should prosecute his work according to the rules and regulations described in devotional service. The results of his activities are completely dependent on the supreme will of the Lord.

TEXT 52

grhe§U vartamiino 'pi sa siimriijya-sriyiinvita� niisajjatendriyarthe§U niraharh-matir arka-vat

grhe�u-at home; vartamana�-being present; api-although; sa�- the King, Prthu; samrajya-the entire empire; sriya-opulence; anvita�-be i ng absorbed in; na-never; asajjata- became attracted; indriya-arthe�u-for sense gratification; nir-nor ; aham-1 am; mat*-consideration; arka-the sun;vat-like.

TRANSLATION

Maharaja Prthu, who was very opulent due to the prosperity of his entire empire, remained at home as a householder. Since he was never inclined to utilize his opulences for the gratification of his senses, he remained unattached, exactly like the sun, which is unaffected in all circumstances.

960 Srimad-Bhagavatam [Canto 4, Ch. 22
m�d•u-.lsfit � 61WIIitlf'-lqiM�: I :rtR1�{l�f.\(t¥1Rtm� ����"

Theword grhe�u is significant in this verse. Out of the four iisramas-the brahmacarya, grhastha, vanaprastha and sannyasa- only agrhastha orhouseholder is allowed to associate with women; therefore the grhastha-iiSrama is a kind of license for sense gratification given to the devotee. Prthu Maharaja was special in that although he was given license to remain a householder, and although he possessed immense opulences in his kingdom, he never engaged in sense gratification. This was a special sign that indicated him to be a pure devotee of the Lord. A pure devotee is never attracted by sense gratification, and consequently he is liberated. In material life a person engages in sense gratification for his own personal satisfaction, but in the devotional or liberated life one aims to satisfy the senses of the Lord.

In this verse Maharaja Prthu is likened to the sun (arka-vat). Sometimes the sun shines on stool, urine and so many other polluted things, but since the sun is all-powerful, it is never affected by the polluted things with which it associates. On the contrary, the sunshine sterilizes and purifies polluted and dirty places. Similarly, a devotee may engage in so many material activities, but because he has no desire for sense gratification, they never affect him. On the contrary, he dovetails all material activities for the service of the Lord. Since a pure devotee knows how to utilize everything for the Lord's service, he is never affected by material activities. Instead, by his transcendental plans he purifies such activities. This is described in Bhakti-rasiimrta-sindhu. Sarvopiidhi-vinirmuktarh tatparatvena nirmalam: his aim is to become completely purified in the service of the Lord without being affected by material designations.

TEXT 53

t(Ct¥\Qtl��i\;c 'lfi+IM�(C¥\M(W{ I

��l(tU¥\IQqfil�l��i¥4(11(����II

evam adhyiitma-yogena karmiir-y anusamiicaran putriin utpiidayii.miisa paiiciirci,sy ii.tma-sammatii.n

evam-thus;adhyii.tma-yogena-by themeans of bhakti-yoga; ka rmii.TJi-activities; anu-always; samiicaran- executing; putrii.n-sons;utpii.dayii.mii.sa-

Text 53) Prthu Maharaja's Meeting with the Four Kumaras 961
PURPORT

begotten; pan ca- five in number; arc i�i-in his wife, Arci; atma-own; s ammatan- according to his desire.

TRANSLATION

Being situated in the liberated position of devotional service, J>rthu Maharaja not only performed all fruitive activities but also begot five sons by his wife Arci. Indeed, all his sons were begotten according to his own desire.

PURPORT

As a householder, Prthu Maharaja had five sons by his wife Arci, and all these sons were begotten as he desired them. They were not born whimsically or by accident. How one can beget children according to one's own desire is practically unknown in the present age (Kali-yuga). In this regard the secret of success depends on the parents' acceptance of the various purificatory methods known as sarhskiiras. The first sarhskiira, the garbhiidhiina-sarhskiira or child-begetting sarhskiira, is compulsory, especially for the higher castes, the briihmar-as and the k§atriyas. As stated in Bhagavad-g'itii, sex life which is not against religious principles is Kg;l).a Himself, and according to religious principles when one wants to beget a child he must perform the garbhiidhiina-sarhskiira before having sex. The mental state of the father and mother before sex will certainly affect the mentality of the child to be begotten. A child who is begotten out of lust may not turn out as the parents desire. As stated in the siistras, yathii yonir yathii b'ijam. Yathii yon* indicates the mother, and yathii b'ijam indicates the father. If the mental state of the parents is prepared before they have sex, the child which they will beget will certainly reflect their mental condition. It is therefore understood by the words iitma-sammatiin that both Prthu Maharaja and Arci underwent thegarbhiidhiina purificatory process before begetting children, and thus they begot all their sons according to their desires and purified mental states. Prthu Mahadija did not beget his children out of lust, nor was he attracted to his wife for sense gratificatory purposes. He begot the children as a grhastha for the future administration of his government all over the world.

962 Srimad-Bhagavatam [Canto 4, Ch. 22
TEXT 54 NM61'44 � m � fi1J:. I �triJlitNI�Iwtf ���: �� lllt\lU

vijitii.svam dhumrakesarh

haryakflam dravirwm vrkam

sarve�ii.m loka-pii.liinii.m

dadhii.raika� prthur gur-iin

vijitiisvam-of the name Vijitasva; dhumrake5am-of the name Dhiimrakesa; haryak§am-of the name Haryak!la; dravi1Jam-of the name DraviQ.a; vrkam-of the name Vrka; sarve§iim-of all; loka-piiliiniim-the governing heads of all planets; dadhiira-accepted; ekal;l.-one; prthu/:1.- King Prthu Maharaja;gu1Jiin-all qualities.

TRANSLATION

After begetting five sons named Vijitasva, Dhiimrakesa, Hary�a, Dravi1,1a and VJ;ka, ftthu Maharaja continued to rule the planet. He accepted all the qualities of the deities who governed all other planets.

PURPORT

In each and every planet there is a predominating deity. It is understood from Bhagava'd-g"itii that in the sun there is a predominating deity named Vivasviin. Similarly, there is a predominating deity of the moon and of the various planets. Actually the predominating deities in all the other planets are descendants from the predominating deities of the sun and moon. On this planet earth there are two kflatriya dynasties, and one comes from the predominating deity of the sun and the other from the predominating deity of the moon, known as Surya-varhsa and Candra-vamsa respectively. When monarchy existed on this planet, the chief member was one of the members of the Surya dynasty or Surya-varhsa, and the subordinate kings belonged to the Candra-vamsa. However, Maharaja Prthu was so powerful that he could exhibit all the qualities of the predominating deities in other planets.

TEXT 55

kiile sve sve 'cyutiitmakafl. mano-vii.g-vrttibhifl. saumyair guraifi. sarhraiijayan prajiifl.

Text 55] Prthu Maharaja's Meeting with the Four Kumaras 963
' ¥twftiwtRtflr:��:(i(�tt��t: ������
•ncft?.lt�iiif·,�:������:
gop"ithiiya jagat-srflte�

gopithiiya-for the protection of; jagat-sr�Jel;t-of the supreme creator; kiile-in due course of time; sve sve-own; acyuta-iitmaka� -being Kr�Q.a conscious; mana� - mind ; viik-words; vrttibhi� - by occupation; saumya*very gentle; gurtai�-by qualification; sarhrmijayan-pleasing; prajii�-the citizens.

TRANSLATION

Since Maharaja J>rthu was a perfect devotee of the Supreme Personality of Godhead, he wanted to protect the Lord's creation by pleasing the various citizens according to their various desires. Therefor� J>rthu Maharaja used to please them in all respects by his words, mentality, works and gentle behavior.

PURPORT

As will be explained in the next verse, Prthu Maharaja used to please all kinds of citizens by his extraordinary capacity to understand the mentality of others. Indeed,his dealings were so perfect that every one of the citizens was very much satisfied and lived in complete peace. The word acyutiitmaka� is significant in this verse, for Maharaja Prthu used to rule this planet as the representative of the Supreme Personality of Godhead. He knew he was the representative of the Lord and that the Lord's creation must be protected intelligently. Atheists cannot understand the purpose behind the creation. Although tliis material world is condemned when it is compared to the spiritual world, there is still some purpose behind it. Modern scientists and philosophers cannot understand that purpose, nor do they believe in the existence of a creator. They try to establish everything by their so-called scientific research, but they do not center anything around the supreme creator. A devotee, however, can understand the purpose of creation, which is to give facilities to the individual living entities who want to lord it over material nature. The ruler of this planet should therefore know that all the inhabitants, especially human beings, have come to this material world for sense enjoyment. It is therefore the duty of the ruler to satisfy them in their sense enjoyment as well as to elevate them to Kr�Q.a consciousness so that they all can ultimately return home, back to Godhead.

With this idea in mind, the king or government head should rule the world. In this way, everyone will be satisfied. How can this be accomplished? There are many examples like Prthu Maharaja, and the history of hisregency on this planet iselaborately described in Sri:mad-Bhiigavatam.

964 Srimad-Bhagavatam [Canto 4, Ch. 22

Evenin this fallen age ifthe rulers, governors and presidents take advantage of Prthu Maharaja's example, there will certainly be a reign of peace and prosperity throughout the world.

TEXT 56

(1��1:11'11¥4� �3f �: I &.4c.FA:��'l m 3RN� wn � lllt�ll

rojety adhan nama-dheyarh

soma-raja ivaparaft

surya-vad visrjan grhcwn .

prataparhs ca bhuvo vasu

nija-the King; iti-thus; adhat-took up; nama-dheyam-of the name; soma-raja[l-the king of the moon planet; iva-like; apara�-on the other hand; su rya-vat-like the sun-god; visrjan-distributing; grh!wn-exacting; pratapan-by strong ruling; ca-also; bhuva�-of the world; vasu-revenue.

TRANSLATION

Maharaja Prthu became as celebrated a king as Somaraja, the king of the moon. He was also powerful and exacting, just like the sun-god who distributes heat and light and at the same time exacts all the planetary waters.

PURPORT

In this verse Maharaja Prthu is compared to the kings of the moon and sun. The king of the moon and the king of the sun serve as examples of how the Lord desires the universe to be ruled. The sun distributes heat and light and at the same time exacts water from all planets. The moon is very pleasing at night, and when one becomes fatigued after a day's labor in the sun, he can enjoy the moonshine. Like the sun-god, Prthu Maharaja distributed his heat and light to give protection to his kingdom, for without heat and light no one can exist. Similarly, Prthu Maharaja exacted taxes and gave such strong orders to the citizens and government that no one hadthe power to disobey him. On the other hand,he pleased everyone just like the moonshine. Both the sun and the moon have particular influences by which they maintain order in the universe, and modern scientists and philosophers should become familiar with the Supreme Lord's perfect plan for universal maintenance.

Text 56] Prthu Maharaja's Meeting with the Four Kumaras 965

TEXT 57

���€41Rt�t� � ��: I

��M� �um{_ 11�\SII

durdharfiaS tejasevagnir mahendra iva durjaya�

titikfiaya dharitriva dyaur ivabh�s.ta-do nrram

durdhar�a�-unconquerable; tejasa-by prowess; iva-like; agni�-fire ; mahendra�-the king of heaven; iva-likened; durjaya�-insuperable; titik§aya-by tolerance; dharitri-the earth; iva-like; dyau�-the heavenly planets; iva-like; abhi§ta-da[t-fulfilling desires; nrr am-of human society.

TRANSLATION

Maharaja Prthu was so strong and powerful that no one coulddisobey his orders any more than one could conquer fire itself. He was so strong that he was compared to lndra, the king of heaven, whose power is insuperable. On the other hand, Maharaja Prthu was also as tolerant as the earth, and in fulfilling various desires of human society, he was like heaven itself.

PURPORT

It is the duty of a king to give protection to the citizens and to fulfill their desires. At the same time, the citizens must obey the laws of the state. Maharaja Prthu maintained all the- standards of good government, and he was so invincible that no one could disobey his orders any more than a person could stop heat and light emanating from a fire. He was so strong and powerful that he was compared to the king of heaven, Indra. In this age modern scientists have been experimenting with nuclear weapons, and in a former age they used to release brahmiistras, but all these brahmiistras and nuclear weapons are insignificant compared to the thunderbolt of the king of heaven. When Indra releases a thunderbolt, even the biggest hills and mountains crack. On the other hand, Maharaja Prthu was as tolerant as the earth itself, and he fulfilled all the desires of his citizens, just as torrents of rain from the sky fulfill the need of the earth for water. Without rainfall, it is not possible to survive on this planet. As stated in Bhagavad-gitii (parjanyiid anna-sambhava�, Bg. 3.14), food grains are produced only because rain falls from the sky, and without

966 Srimad-Bhagavatam [Canto 4, Ch. 22

grains, no one on the earth can survive. Consequently an unlimited distribution of mercy is compared with the water falling from the clouds. Maharaja Prthu distributed his mercy incessantly, much like rainfall. In other words, Maharaja Prthu was softer than a rose flower and harder than a thunderbolt. In this way he ruled over his kingdom.

TEXT 58

� � �1:'{: ���� Q.,�;ct"'-t€5(1Rct 11'-\<=11

� � �qfifil&i

var�ati sma yathii-kiimam

parjanya iva tarpayan samudra iva durbodha[l. sattveniicala-rii(i iva

var�ati-pouring;sma-used to;yathii-kiimam-as much as one can desire; parjanya[l.-water; iva-like ; tarpaya n-pleasing; samudra[l. - the sea; ivalikened; durbodha[l.- not understandable; sattvena-by existential position; acala-the hills; riit iva-like the king of.

TRANSLATION

Just as rainfall satisfies everyone's desires, Maharaja frthu used to satisfy everyone. He was like the sea in that no one could understand his depths, and he was like Meru, the king of hills, in the fixity of his purpose.

PURPORT

Maharaja Prthu used to distribute his mercy to suffering humanity, and it was like rainfall after excessive heat. The ocean is wide and expansive, and it is very difficult to measure its length and breadth; similarly, Prthu Maharaja was so deep and grave that no one could fathom his purposes. The hill known as Meru is fixed in the universe as a universal pivot, and no one can move it an inch from its position; similarly, no one could ever dissuade Maharaja Prthu when he was determined.

TEXT 59

dharma-rii(i iva sik�iiyiim

iiscarye himaviin iva

Text 59] Prthu Maharaja's Meeting with the Four Kumaras 967
\I�(IRct ��mn� �filer I ��"'�"�!l'�m� � 11'-\���

dharma-rat iva- like King Yamaraja (the superintendent of death); sik;;iiyiim-in education; iiscarye-in opulence; himaviin iva-like the Himalayan Mountains; k uvera�- the treasurer of the heavenly planets; iva-like; kosa-iiflhya�- in the matter of possessing wealth; gupta-artha�secrecy; varur-a�- the demigod named VaruQ-a ; yathii-like.

TRANSLATION

Maharaja Prthu's intelligence and education were exactly like that of Yamaraja, the superintendent of death. His opulence was comparable to the Himalayan Mountains, where all valuable jewels and metals are stocked. He possessed great riches like Kuvera, the treasurer of the heavenly planets, and no one could reveal his secrets, for they were like the demigod Varur,m's.

PURPORT

Yamaraja or Dharmaraja, as the superintendent of death, has to judge the criminal livingentitieswho have committed sinfulactivities throughout their lives. Consequently Yamaraja is expected to be most expert in judicial matters. Prthu Maharaja was also highly learned and exceedingly exact in delivering his judgment upon the citizens. No one could excel him in opulence any more than estimate the stock of minerals and jewels in the Himalayan Mountains; therefore he is compared to Kuvera, the treasurer of the heavenly planets. Nor could anyone discover the secrets of his life any more than learn the secrets of Varul).a, the demigod presiding over the water, the night, and the western sky. Varul).a is omniscient, and since he punishes sins, he is prayed to for forgiveness. He is also the sender of disease andis oftenassociatedwith Mitra and Indra.

TEXT60

968
kuvera iva kosiiphyo guptiirtho varurw yathii [Canto 4, Ch. 22
Srimad-Bhagavatam
¥tRtR�� 3TW'i�HI41
miitarisveva sarviitmii balena mahasaujasii avi�ahyatayii devo bhagaviin
iva
bhuta-riip

miitarisvii- the air; iva-like; sarva-iitmii-all-pervading; balena-by bodily strength; mahasii ojasa-by courage and power; avi§ahyatayii-by intolerance; deva� - the demigod; bhagaviin- the most powerful; bhuta-riit ivalike Rudra or Sadasiva.

TRANSLATION

In his bodily strength and in the strength of his senses, Maharaja frthu was as strong as the wind, which can go anywhere and everywhere. As far as his intolerance was concerned, he was just like the all-powerful Rudra expansion of Lord Siva, or Sadasiva.

TEXT6l

kandarpa iva saundarye manasvi mrga-riii} iva viitsalye manuvan nrr-arh prabhutve bhagaviin aja�

kandarpa�-Cupid; iva-like; saundarye-in beauty; manasvi-in thoughtfulness; mrga-riit iva-like the king of the animals, the lion; viitsalye-in affection; manu-vat-like Svay ambhuva Manu; nrr-am-of human society; prabhutve-in the matter of controlling;bhagaviin-the lord; aja�-Brahma.

TRANSLATION

In his bodily beauty he was just like Cupid, and in his thoughtfulness he was like a lion. In his affection he was just like Svayambhuva Manu, and in his ability to control he was like Lord Brahma.

TEXT 62

'RWRf�IRf4� 3ll�¥4ift� � d{: � �� �'it�wtl�f4ffl!I

WIT 3J����T+ttlql€tiWAt!�II��II

brhaspatir brahma-viide

iitmavattve svayarh har*

bhaktyii go-guru-vipre§u

vi§vakseniinuvartifiu

hriyii prasraya-siliibhyiim

iitma-tulya� parodyame

Text62] Prthu
Meeting
Four Kumaras 969
Maharaja's
with the
� �;r ��if � �um'· ��¥4ifiw-ljatf � ��: II��II

brhaspat*- the priest of the heavenly planets; brahma-viide-in the matter of spiritual understanding; iitmavattve-in the matter of selfcontrol; svayam-personally ; har*-the Supreme Personality of Godhead; bhaktyii-in devotion; go-cow; guru-spiritual master; vipre�u-unto the briihmar.as; vi�vaksena-the Personality of Godhead; anuvarti�u-followers; hriyii-by shyness; prasraya-Siliibhyiim- by most gentle behavior; iitmatulya� - exactly like his personal interest; para-udyame-in the matter of philanthropic work.

TRANSLATION

In his personal behavior, }\thu Maharaja exhibited all good qualities, and in spiritual knowledge he was exactly like B�haspati. In self-control he was like the Supreme Personality of Godhead Himself. As far as his devotional service was concerned, he was a great follower of devotees who were attached to cow protection and the rendering of all service to the spiritual master and the briihmru:tas. He was perfect in his shyness and in his gentle behavior, and when he engaged in some philanthropic activity, he worked as if he were working for his own personal self.

PURPORT

When Lord Caitanya talked to Sarvabhauma Bhattacarya, the Lord gave him the honor of becoming the incarnation of Brhaspati. Brhaspati is the chief priest of the heavenly kingdom, and he is a follower of the philosophy known as Brahmavada or Mayavada. Brhaspati is also a great logician. It appears from this statement that Maharaja Prthu, although a great devotee constantly engaged in the loving service of the Lord, could defeatallkindsofimpersonalists and Mayavadisbyhis profound knowledge of Vedic scriptures. We should learn from Maharaja Prthu that a Vai�r;�ava or devotee must not only be fixed in the service of the Lord, but, if required, must be prepared to arguewith the impersonalist Mayavadis with all logic and philosophy and defeat their contention that the Absolute Truth is impersonal.

The Supreme Personality of Godhead is the ideal self-controller or brahmaciiri. When Knn:1a was elected to be president of the Rajasuya yajiia performed byMaharajaYudhi�thira, Grandfather Bhi�madeva praised Lord Kr�r;�a as the greatest brahmaciir"i. Because Grandfather Bhi�madeva was a brahmaciir"i, he was quite fit to distinguish a brahmaciir"i from a vyabhiciiri Although Prthu Maharaja was ahouseholder and father of five children, he was still considered to be most controlled. One who begets Kr�r;�a consciouschildren for the benefit of humanity is actually a brahma-

970 Srimad-Bhagavatam [Canto 4, Ch. 22

ciir'i. One who simply begets children like cats and dogs is not a proper father. The word brahmaciir'i also refers to one who acts on the platform of Brahman or devotional service. In the impersonal Brahman conception, there is no activity, yet when one performs activities in connection with the Supreme Personality of Godhead, he is to be known as brahmaciiri. Thus Prthu Maharaja was an ideal brahmaciir'i and grhastha simultaneously. Vi�vakseniinuvarti�u refers to those devotees who are constantly engaged in the service of the Lord. Other devotees must follow in their footsteps. Srlla Narottama dasa Thakura said, ei chaya gosiini yiinra, mui tiinra diisa. He is prepared to become anyone's disciple who follows in the footsteps of the six Gosvamis.

Also, like all Vai�l}avas, Maharaja Prthu was devoted to cow protection, spiritual masters and qualified briihmaras. Prthu Maharaja was also very humble, meek and gentle, and whenever he performed any philanthropic work or welfare activity for the general public, he would labor exactly as if he were tending to his own personal necessities. In other words, his philanthropic activities were not for the sake of show but were performed out.ofpersonal feeling andcommitment. All philanthropic activities should be thus performed.

TEXT63

k'irtyordhva-g'itayii pumbhis trailokye tatra tatra ha pravi,stal:t karrJ.a-randhre�u str'ir-iirh riima� satam iva

k'irtyii-by reputation; iirdhva-gitayii.-by Loud declaration; pumbhif!by the general public; trailokye-all over the universe; tatra tatrahere and there; ha- certainly ; pravi�ta�-entering; karra-randhre�u- in the aural holes; str'ir-iim-of the women; riima�- Lord Riimacandra; satiimof the devotees; iva-like.

TRANSLATION

Throughout the whole universe-in the higher, lower and middle planetary systems-ftthu Maharaja's reputation was loudly declared, and all ladies and devotees heard his glories, which were as sweet as the glories of Lord Riimacandra.

971
Text63] .Prthu Maharaja's Meeting with the Four Kumaras
��chfl€1ttl��iit� ij;r ij;f � I 3lR!: •l1 � @{: mnr� ������

In this verse the words str"i�J-iim and riima� are significant. It is the practice amongst ladies to hear and enjoy the praises of certain heroes. From this verse it appears that Prthu Maharaja's reputation was so great that ladies all over the universe would hear of it with great pleasure. At the same time, his glories were heard all over theuniverse bythe devotees, andtheywereaspleasingasLord Ramacandra'sglories. Lord Ramacandra's kingdom is still existing, and recently there was a political party in India named the Ramariijya Party, which wanted to establish a kingdom resembling the kingdom of Rama. Unfortunately, modern politicians want the kingdom of Rama without Rama Himself. Although they have banished the idea of God consciousness, they still expect to establish the kingdom of Rama. Such a proposal is rejected by devotees. Prthu Maharaja's reputation was heard by saintly persons because he exactly represented Lord Ramacandra, the ideal king.

Thu,s end the Bhaktivedanta pu,rports of the Fourth Canto, Twentysecond Chapter, ofthe Srimad-Bhagavatam, entitled "King Prthu Maharaja's Meeting with the Four Kumiiras."

972 Srimad-Bhagavatam [ Canto 4, Ch. 22
PURPORT

CHAPTER TWENTY-THREE

Maharaja Prthu's Going Back Home

maitreya uviica dn�viitmiinarh pravayasam ekadii vainya iitmaviin iitmanii vardhitiise§asviinusarga� prajiipati(l. jagatas tasthu.sas ciipi vrtti-do dharma-bhrt satiim nifipiidite5variideso yad-artham iha jajiiiviin iitma-je§v iitma-jiirh nyasya virahiid rudatim iva prajiisu vimana�sv eka� sa-diiro 'giit tapo-vanam

maitr�ya� uviica- the sage Ma itreya continued to speak; drfitvii- after seeing; iitmiinam-of the body; pravayasam-old age; ekadii-once upon a time; vainya{!. - King Prthu; iitmaviin-fully conversant in spiritual education; iitmanii-by oneself; vardhita-increased; ase§a-unlimitedly; sva-

TEXTS 1-3. ��q� qlS� 5fC4�H1�*'1� sm�t� I amq;n Ueldl�'4�f�•t: �-rffir:II � II ��� � �l!ffi(ll¥(I A�41R}t�� �� ��II � II atmt�� � ft'mro'TfiR 1 �lij M1l;r:m: ��s•n'Etcfttl�II � II
973

anusarga�-creation of material opulences; prajii-pat*-a protector of citizens; jagata�-moving; tasthu�a�-not moving; ca-also; api-certainly; vrtti-da� - one who gives pensions; dharma-bhrt-one who observes the religious principles; satiim-of the devotees; ni�piidita- fully executed; isvara-of the Supreme Personality of Godhead; iide sa�-order; yat-artham -in coordination with Him; iha-in this world; jajiiiviin-performed; atma-je�u-unto his sons; atma-jam-the earth; nyasya-in dicating; virahatout of separation; rudafim iva-just like lamenting; prajasu-unto the citizens; vimana�su- unto the aggrieved; eka[l-alone ; sa-diira�-with his wife; agat-went; tapa�-vanam-in the forest where one can execute austerities.

TRANSLATION

At the last stage of his life, when Maharaja Prthu saw himself getting old, that great soul,who was King of theworld,divided whatever opulence he had accumulated amongst all kinds of living entities, moving andnonmoving. He arranged pensions for everyone according to religious principles, and after executing the orders of the Supreme Personality of Godhead, in complete coordination with Him, he dedicated hissonsunto the earth, which was considered to be his daughter. Then Maharaja Prthu left the presence of his citizens, who were almost lamenting and crying from feeling separation from the King, and went to the forest alone with his wife to perform austerities.

PURPORT

Maharaja Prthu was one of the saktyiivesa incarnations of the Supreme Personality of Godhead, and as such he appeared on the surface of the earth to execute the orders of the Supreme. As stated in Bhagavad-gztii, the Supreme Lord is the proprietor of all planets, and He is always anxious to see that in each and every planet the living entities are happily living and executing their duties. As soon as there is some discrepancy in the execution of duties, the Lord appears on earth, as confirmed in Bhagavadgitii: yadii yadii hi dharmasya gliinir bhavati bhiirata (Bg. 4.7).

Since there were so many discrepancies during the reign of King Vena, the Lord sent His most confidential devotee, Maharaja Prthu, to settle things. Therefore, after executing the orders of the Supreme Personality of Godhead and settling the affairs of the world, Maharaja Prthu was ready to retire. He had been exemplary in his governmental administration, and now he was to become exemplary in his retirement. He divided all his

974 Srimad-Bhagavatam [Canto 4, Ch. 23

property amongst his sons and appointed them to rule the world, and then he went to the forest with his wife. It is significant in this connection that it is said that Maharaja Prthu retired alone and at the same time took his wife with him. According to Vedic principles, when retiring from family life, one can take his wife with him, for the husband and wife are considered to be one unit. Thus they can both combinedly perform austerities for liberation. This is the path that Maharaja Prthu, who was an exemplary character, followed, and this is also the way of Vedic civilization. One should not simply remain at home until the time of death but should separate from family life at a timely moment and prepare himself to go back to Godhead. As a saktyavesa incarnation of God who had actually come from VaikuJ;�tha as a representative of Kr�Qa, Maharaja Prthu was certain to go back to Godhead. Nonetheless in order to set the example in all ways, he also underwent severe austerities in the tapo-vana. It appears that in those days there were many tapo-vanas, or forests especially meant for retirement and the practice of austerities. Indeed, it was compulsory for everyone to go to the tapo-vana to fully accept the shelter of the Supreme Personality of Godhead, for it is very difficult to retire from family life and at the same time remain at home.

31Ri� mmt � ���� II \l II

tatriipy adiibhya-niyamo

vaikhiinasa-susammate

iirabdha ugra-tapasi

yathii sva-vijaye purii

tatra- there; api- also; adiibhya- severe; niyama� -austerities; vaikhiinasa- rules andregulations of retired life; susammate- perfectly recognized; iirabdha� - beginning; ugra-severe ; tapasi- austerity; yathii- as much as; sva-vijaye-in conquering the world; purii-formerly.

TRANSLATION

After retiring from family life, Maharaja Prthu strictly followed the regulations of retired life and underwent severe austerities in the forest. He engaged in these activities as seriously as he had formerly engaged in leadingthe government and conquering everyone.

Text4] Maharaja Prthu's Going Back Home 975
TEXT4 �) �(CfiWfQ!!(i+� I

PURPORT

As it is necessary for one to become very active in family life, similarly, after retirement from family life, it is necessary to control the mind and senses. This is possible when one engages himself fully in the devotional service of the Lord. Actually the whole purpose of the Vedic system, the Vedic social order, is to enable one to ultimately return home, back to Godhead. The grhastha-asrama is a sort of concession combining sense gratification with a regulative life. It is to enable one to easily retire in the middle of life and engage fully in austerities in order to transcend material sense gratification once and for all. Therefore in the vanaprastha stage of life, tapasya, or austerity, is strongly recommended. Maharaja Prthu followed exactly all the rules of vanaprastha life, which is technically known as vaikhanasa-asrama. Theword vaikhiinasa-susammate is significant because in vanaprastha life the regulative principles are also to be strictly followed. In other words, Maharaja Prthu was an ideal character in every sphere of life. Mahtijano yena gata� sa pantha�: one should follow in the footsteps of great personalities. Thus by following the exemplary character of Maharaja Prthu, one can become perfect in all respects while living this life or while retiring from active life. Thus after giving up this body, one can become liberated and go back to Godhead.

TEXTS

«{Wti�l(l(: �"'fiqOrNJ"f: �I

�: ifiRri�«�l'PT�a:�II � II

kanda-mula-phaliihiira� sufikaparr-asanal;! kvacit ab-bhak§a� katicit pak§an vayu-bhak§aS tala� param

kanda-trunk; mula- ro ots; phala - fruits; ahara�-eating; SU§ka- dry; parra-leaves; asana(!-eating; kvacit- sometimes; ap-bhak§a� -drinking water; katicit-for several; pak�an-fortnights; vayu-the air; bhak§a�breathing; tata� param- thereafter.

TRANSLATION

In the tapo-vana, Maharaja Prthu sometimes ate the trunks and roots of tre�s, and sometimes he ate fruit and dried leaves, and for some weeks he drank only water. Finally he lived simply by breathing air.

976 Srimad-Bhagavatam [Canto 4, Ch. 23

In Bhagavad-gitii yogis are advised-to go to a secluded place in the forest and live alone in a sanctified spot there. By Prthu Maharaja's behavior we canunderstand thatwhen he went to theforest,he did not eat any cooked food sent from the city by some devotees or disciples. As soon as one takes a vow to live in the forest, he must simply eat roots, tree trunks, fruits,dried leaves or whatever nature provides in that way. Prthu Maharaja strictly adopted these principles for living in the forest, and sometimes he ate nothing but dried leaves and drank nothing but a little water. Sometimes he lived on nothing but air, and sometimes he ate some fruit from the trees. In this way he lived in the forest and underwent severe austerity, especially in regards to eating. In other words, overeating is not at all recommended for one who wants to progress in spiritual life. Sri Rupa Gosvami also warns (atyiihiira� prayiisas ca) that too much eating and too much endeavor are against the principles by which one can advance in spiritual life.

It is also notable that according to Vedic injunction, to live in the forest is to live in the mode of complete goodness, whereas to live in the city is to live in the mode of passion, and to live in a brothel or drinking house is to live in the mode of ignorance. However, to live in a temple is to live in Vaikul).tha, which is transcendental to all the modes of material nature. This J<.r�qa consciousness movement affords one the opportunity to live in the temple of the Lord, which is as good as Vaikul).tha. Consequently a K.r�qa conscious person does not need to go to the forest and artificially try to imitate Maharaja Prthu or the great sages and munis who used to live in the forest.

Srila Rupa Gosvami, after retiring from his minister's seat in the government, went to Vrndavana and lived beneath a tree, like Maharaja Prthu. Sincethen,manypeoplehavegone toVrndavana toimitate RupaGosvami's behavior. Instead of advancing in spiritual life, many have fallen into material habits and even in Vrndavana have become victims of illicit sex, gambling and intoxication. This J<.r�qa consciousness movement has been introduced in theWestern countries, but it is not possible forWesterners to go to the forest and practice the severe austerities which were ideally practiced by Pfthu Maharaja or Rupa Gosyami. However, Westerners or anyone else can follow in the footsteps of Srila Bhaktisiddhanta Sarasvati Thakura by living in a temple, which is transcendental to residence in a forest, and to vow to accept Kr�l)a prasiida and nothing else, follow the regulative principles, and chant sixteen rounds daily of the Hare Kr�qa mantra. In this way, one's spirituallife will never be disturbed.

Text 5) Maharaja ftthu's Going Back Home 977
PURPORT

TEXT6

� lliiCRI �m ���r€«R'ti(1U0*!f.l: I

3["ffiO?;'Il{: N��%i��m: u G.1

gri§me paiica-tapii viro varfoiisv iisiirafoiil'} munift iikafltha-magna� sisire udake stha[lpilesaya�

gr�sme-in the summer season; panca-tapii�-five kinds of heating; vira�- the hero; var�iisu -in the rainy season ; iisiira�iit- being situated within the torrents of rain; mun*-like the great sages; aka�Jtha- up to the neck; magna�-drowned; sisire-in winter; udake-within water; sthar!lilesaya�-Lying down on the floor.

TRANSLATION

Following the principles of forest living and the footsteps of the great sages and munis, Prthu Maharaja accepted five kinds of heating processes during the summer season, exposed himself to torrents of rain in the rainy season, and, in the winter, stood in water up to his neck. He also used to simply lie down on the floor to sleep.

PURPORT

These are some of the austerities executed by the jniinis and yogis, who cannot accept the process of bhakti-yoga. They must undergo such severe types of austerity in order to become purified from material contamination. Panca-tapiift refers to five kinds of heating processes. One is also enjoined to sit within a circle of fire, with flames blazing from four sides and the sun blazing directly overhead. This is one kind of panca-tapiift recommended for austerity. Similarly, in the rainy season one is enjoined to expose himself to torrents of rain and in winter to sit in cold water up to the neck. As far as bedding is concerned, the ascetic should be content with simply lying on the floor. The purpose for undergoing such severe austerities is to become a devotee of the Supreme Personality of Godhead, l<{�rya, as explained in the next verse.

978 Srimad-Bhagavatam [Canto 4, Ch. 23
TEXT 7 Rlf��rrcr ��ffl ��: 1 snfffi�: �U1'i''"H�q ��II\911

Maharaja ftthu's Going Back Home

titikfiur yata-vag danta

urdhva-reta jitanila�

iiririidhayifiu� knr;wm

acarat tapa uttamam

titikfiU� -tolerating; yata-controlling; viik-words; diinta� -controlling the senses; urdhva-retii�-without discharge of semen; jita-anila� -controlling the life air; iiririidhayifiu�- simply desiring; kmwm-Lord Kr�l).a; acarat-practice; tapa�- austerities; uttamam-the best.

TRANSLATION

Maharaja ftthu underwent all these severe austerities in order to control his words and his senses, to refrain from discharging his semina and to control the life air within his body. All this he did for the satisfaction of Kr�qa. He had no other purpose.

PURPORT

In Kali-yuga the following is recommended:

harer nama harer nama harer niimaiva kevalam

kalau nasty eva nasty eva nasty eva gatir anyathii.

In order to be recognized by Kreyqa, the Supreme Personality of Godhead, one should chant the holy name of the Lord continuously, twenty-four hours a day. Unfortunate persons who cannot accept this formula prefer to execute some type of pseudo-meditation without accepting the other processes of austerity. The fact is, however, that one must accept either the severe method of austerity described above to become purified or take to the process of devotional service recommended for pleasing the Supreme Lord, Kr�l).a. The person who is Kr�J).a conscious is most intelligent because in Kali-yuga it is not at all possible to undergo such severe austerities. We need onlyfollow great personalitieslike Lord Caitanya Mahaprabhu. In His Sikfiiifitaka, Lord Caitanya Mahiiprabhu wrote, pararh vijayate sri-kr�TJasanktrtanam: all glories to the holy names of Lord Kr�qa, which from the very beginning purify the heart and immediately liberate one. Bhavamahiidiiviigni-nirviipanam. If the real purpose of all yoga is to please Lord Kreyqa, then this simple bhakti-yoga system recommended for this age is sufficient. It is necessary, however, to engage constantly in the service of the Lord. Although Prthu Maharaja executed his austerities long before the appearance of Lord Kr�qa on this planet, his purpose was still to please Kreyqa.

Text
7)
979

There are many foolswho claimthat worship of Kreyqa began only about five thousand years ago, after the appearance of Lord Kreyqa in India, but this is not a fact. J>rthu Maharaja worshiped Kr�qa millions of years ago, for Prthu happened to be a descendant of the family of Maharaja Dhruva, who reigned for 36,000 years during the Satya-yuga age. Unless his total life span was 100,000 years, how could Dhruva MahTuaja reign over the world for 36,000 years? The point is that Kr��a worship existed at the beginning of creation and has continued to exist throughout Satya-yuga, Treta-yuga and Dvapara-yuga, and now it is continuing in Kali-yuga. As stated in Bhagavad-gitti, Kr��a not only appears in this millennium of Brahma's life, but in every millennium. Therefore worship of K[�Q.a is conducted in all millenniums. It is not that Kr�Q.a worship began only when K[�Q.a appeared on this planet five thousand years ago. This is a foolish conclusion that is not substantiated by Vedic literatures.

Also of significance in this verse are the words aririidhay�uft knrJ.am acarat tapa uttamam. Maharaja Prthu underwent severe types of austerities for the express purpose of worshiping Kr�qa. Kr�_r;�a is so kind, especially in this age, that He appears in the transcendental vibration of His holy name. As is said in the Niirada-paiicariitra, iiriidhito yadi haris tapasii tataft kim. Lf Kfeyqa is worshiped, if He is the goal of advancement, there is no need for one to execute severetypes of tapasya, because one has alreadyreached his destination.If,after executing alltypes of tapasya, one cannotreach Kr�_r;�a, allhis tapasya has no value,for without Kr�Q.a all austerityis simply wasted labor. Srama eva hi kevalam (Bhiig. 1.2.8). We should therefore not be discouragedjustbecausewe cannotgotothe forestand practice severe austerities. Our life is so short that we must strictly adhere to the principles laid down bythe Vai�ryava iiciiryas and peacefullyexecute Kr�qa consciousness. There is no need to become despondent. Narottama dasa Thakura recommends: tinande bala hari, bhaja V[ndtivana, Srf-gurU·Vai�[taVa-pade majtiiya mana. For a transcendentalblissfullife,chant the Hare Kr�_r;�a mantra, come worship the holy place of Vrndavana, and always engage in the service of the Lord, of the spiritual master, and of the Vai�Q.avas. This Kr��J.a consciousness movemenl is therefore very safe and easy. We have only to execute the order of the Lord and fully surrender unto Him. We have only to execute the order of the spiritual master, preach Kr��J.a consciousness and follow in the path of the Vai��J.avas. The spiritual master represents both Lord Kr�rya and the Vai�t;�.avas; therefore by following the instructions of the spiritualmaster andby chanting Hare Kr��J.a,everything will be all right.

980 Srimad-Bhagavatam [Canto 4, Ch. 23

tena kramiinusiddhena dhvasta-karma-mal.asaya[l, priirtiiyiimai!£ sanniruddha.sa!l-vargas chinna-bandhana�

tena-thus by practicing such austerities; krama-gradually; anu-constantly; siddhena-by perfection; dhvasta-smashed; karma-fruitive activities; mala-dirty things; iisaya[l,-desire; priirtiiyiimai[!,-by practice of prartayama-yoga, breathing exercises; san-being; niruddha-stopped; §a.tvarga[l, -the mind and the senses; chinna-bandhana!£-completely cut off from all bondage.

TRANSLATION

By thus practicing severe austerities, Maharaja Pfthu gradually became steadfast in spiritual life and completely free of all desires for fruitive activities. He also practiced breathing exercises to control his mind and senses, and by such control he became completely free from all desires for fruitive activity.

PURPORT

The word prii.[lii.yiima* is very important in this verse because the hatha-yogis and a�tiinga-yogis practice prii[liiyiima, but generally they do not know the purpose behind it. The purpose of priirtiiyiima, or mystic yoga, is to stop the mind and senses from engaging in fruitive activities. The so-called yogis who practice in Western countries have no idea of this. The aim of priir-iiyiima is not to make the body strong and fit for working hard. The aim is worship of Kr��a- In the previous verse it was specifically mentioned that whatever austerity, prii[liiyiima and mystic yoga practices Prthu Maharaja performed were performed for the sake of worshiping Kr�J;�a. Thus Prthu Maharaja serves as a perfect example for yog'is also. Whatever he did, he did to please the Supreme Personality of Godhead, Kn;J;�a.

The minds of those who are addicted to fruitive activity are always filled with unclean desires. Fruitive activities are symptomatic of our polluted desire to dominate material nature. As long as one continues to

Text 8] Maharaja Prthu's Going Back Home
TEXT 8
981

be subject to polluted desires, he has to accept one material body after another. So-called yogis, without knowledge of the real purpose of yoga, practice it in order to keep the body fit. Thus they engage themselves in fruitive activities, and thus they are bound by desire to accept another body. They are not aware that the ultimate goal of life is to approach Kr�va. In order to save such yogis from wandering throughout the different species of life,the siistras warn that inthis age suchyogic practice is simply a waste of time. The only means of elevation is the chanting of the Hare Kr�Qa mahii.-mantra.

King Prthu's activities took place in Satya-yuga, and in this age this practice of yoga is misunderstood by fallen souls who are not capable of practicing anything. Consequently the sastras enjoin: kalau nasty eva nasty eva nasty eva gatir anyathii. The conclusion is that unless the karmi"s, jiiiin"is and yogis come to the point of devotional service to Lord Kr�va, their so-called austerities and yoga have no value. Nariidhita�: if Hari, the Supreme Personalityof Godhead, is not worshiped, there is no point in practicing meditational yoga, performing karma-yoga or culturing empiric knowledge. As far as prii[liiyiima is concerned, chanting of the holy name of the Lord and dancing in ecstasy are also considered prii[liiyiima. In a previous verse, Sanatkumiira instructed Maharaja Prthu to engage constantly in the service of the Supreme Lord, Vasudeva:

yat piida-pahkaja-paliisa-viliisa-bhaktyii karmiisayarh grathitam udgrathayanti santa�

Only by worshiping Vasudeva can one become free from the desires of fruitive activities. Outside of worshiping Vasudeva, the yogis and jniinzs cannot attainfreedom from such desires. Tadvan na rikta-matayo yatayo 'pi ruddha-srotoga[liiS tam ara[lam bhaja viisudevam (Bhiig. 4.22.39). Here the word prii[liiyiima does not refer to any ulterior motive. The actual aim is to strengthen the mind and senses in order to engage them in devotional service. In the present age this determination can be very easily acquired simply by chanting the holy names-Hare Kr�Qa, Hare Kr�va, Kr�va Kr�va, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare.

982 Srimad-Bhagavatam [Canto 4, Ch. 23
TEXT9 �ptit lllr�F{ ��If�� I � �� �SR�� II� II sanat-kumiiro bhagaviin yad iihiidhyiitmikam param

sanat-kumara�-Sanat-kumara; bhagavan-most powerful; yat-that which; aha-said; adhyatmikam-spiritual advancement of life; paramultimate; yogam-mysticism; tena-by that; eva -certainly; purufiamSupreme Person; abhajat-worshiped; purufia·rfiabha�-the best of the human beings.

TRANSLATION

Thus the best amongst human beings, Maharaja Prthu, followed that path of spiritual advancement which was advised by Sanat-kumara. That is to say, he worshiped the Supreme Personality of Godhead, Kr�r:ta.

PURPORT

In this verse it is clearly said that Maharaja Prthu, practicing the priirtiiyiima-yoga system, engaged in the service of the Supreme Personality of Godhead as advised by the saint Sanat-kumara. In this verse the words purufiam abhajat puru§ar§abha!). are significant: purufiar§abha refers to Maharaja Prthu, the best amongst human beings, and purufiam refers to the Supreme Personality of Godhead. The conclusion is that the best man amongst all men engages in the service of the Supreme Person. One purufia is worshipable, and the other purufia is the worshiper. When the purufia who worships, the living entity, thinks of becoming one with the Supreme Person, he simply becomes bewildered and falls into the darkness of ignorance. As stated by Lord Kn>IJ.a in Bhagavad-gita, all living entities assembled in the battlefield, as well as Kr�IJ.a Himself, were also present in the past as individuals and would continue to be present in the future as individuals also (Bg. 2.12). Therefore the two puru§as, the living entity and the Supreme Personality of Godhead, never lose their respective identities. Actually one who is self-realized engages himself in the service of the Lord perpetually, both in this life and in the next. Indeed, for devotees there is no difference between this life and the next. Inthis life a neophyte devotee is trained to serve the Supreme Personality of Godhead, and in the next life he approaches that Supreme Person in Vaikul).�ha and renders the same devotional service. Even for the neophyte devotee, devotional service is considered brahma-bhiiyiiya kalpate. Devotional service to the Lord is never considered a material activity. Since he is acting on the brahma-bhiita platform, a devotee is already liberated. He therefore has no need to practice any other type of yoga in order to approach the brahmabhiita stage. If the devotee adheres· strictly to the orders of the spiritual

Text 9) Maharaja Ptthu 's Going Back Home yogamtenaivapurufiam abhajatpuru.sarfiabha� 983

master, follows the rules and regulations and chants the Hare Kr�rya mantra, it should be concluded that he is already at the brahma-bhuta stage, as confirmed in Bhagavad-gitii: miim ca yo 'vyabhicare{1a bhakti-yogena sevate sa gup.an samafityaitan brahma-bhuyaya kalpate

"One who is engaged in full devotional service, unfailing in all circumstances, at once transcends the modes of material nature and thus comes to the level of Brahman." (Bg. 14.26)

TEXT 10

ll��: �: � �: � I

�Rr iittRIU4¥4�� ll�oll

bhagavad-dharmip.a� sadho� sraddhaya yatata� sada bhaktir bhagavati brahmap.y ananya-vi�ayabhavat

bhagavat-dharmi{1a�-one who executes devotional service; sadho�of the devotee; sraddhaya - with faith; yatata� -endeavoring; sada-always; bhakt*-devotion; bhagavati-unto the Personality of Godhead; brahmap.ithe origin of impersonal Brahman; ananya-vi�aya - firmly fixed without deviation; abhavat-became.

TRANSLATION

Maharaja Prthu thus engaged completely in devotional service, executing the rules and regulations strictly according to principles, twenty-four hours daily. Thus his love and devotion unto the Supreme Personality of Godhead, Kt�J.la, developed and became unflinching and fixed.

PURPORT

The word bhagavad-dharmirwl:t indicates that the religious process practiced by Maharaja Prthu was beyond all pretentions. As stated in the beginning of Srimad-Bhagavatam, dharma[! projjhita-kaitavo 'tra (Bhag. 1.1.2): Religious principles which are simply pretentious are actually nothing but cheating. Bhagavad-dharmi{1a� isdescribed by Viranighavacarya as nivrtta-dharme{1a, which indicates that it cannot be contaminated by material aspiration. As described by Srila Rupa Gosviimi:

984 Srimad-Bhagavatam [Canto 4, Ch. 23

When one is not inspired by material desires and is not contaminated by the processes of fruitive activity and empiric speculation,he fully engages in the favorable service of the Lord. That is called bhagavad-dharma, or pure devotional service. In this verse the word brahmarti does not refer to the impersonal Brahman. Impersonal Brahman is a subordinate featureof the Supreme Personality of Godhead, and since impersonal Brahman worshipers desire to merge into the Brahman effulgence, they cannot be considered followers of bhagavad-dharma. After being baffled in his material enjoyment, the impersonalist may desire to merge into the existence of the Lord, but a pure devotee of the Lord has no such desire. Therefore a pure devotee is really bhagavad-dharmi.

It is clear from this verse that Maharaja Prthu was never a worshiper of the impersonal Brahman but was at all times a pure devotee of the Supreme Personality of Godhead. Bhagavati brahmarti refers to one who isengagedin devotional service to the Personality of Godhead. A devotee's knowledge of the impersonal Brahman is automaticallyrevealed, and he is not interested in merging into the impersonal Brahman. Maharaja Prthu's activities in devotional service enabled him to become fixed and steady in the discharge of devotional activities without having to take recourse to karma, jiiiina or yoga.

TEXT 11

(!�FA{

tasyiinayii bhagavata� parikarma-suddhasattviitmanas tad-anusamsmara�Jiinupurtyii

jiiiinam viraktimad abhun nisitena yena ciccheda samsaya-padam nija-fiva-kosam

tasya-his; anayii-by this; bhagavatafl-of the Supreme Personality of Godhead; parikarma- activities in devotional service; suddha-pure, transcendental; sattva-existence; iitmana�-of the mind; tat-of the Supreme Personality of Godhead; anusarhsmararta-constantly remembering; anupurtyii -being perfectly done; jiiiinam-knowledge; virakti-nonattachment; mat-possessing; abhut-became manifested; nisitena-by

Text 11] Maharaja �thu
anyiibhilii.sitii-sunyam jiiiina-karmiidy-aniivrtam iinukulyena knT,liinusilanam bhaktir uttamii 985
's Going Back Home
� mr���� �
��: q"�I
�������������

sharpened activities; yena - by which; ciccheda-hecome separated; sam5aya-padam-position of doubtfulness; nija - own; jiva-kosam-encagement of the living entity.

TRANSLATION

By regularly discharging devotional service, ftthu Maharaja became transcendental in mind and could therefore constantly think of the lotus feet of the Lord. Because of this, he became completely detached and attained perfect knowledge by which he could transcend all doubt. Thus he was freed from the clutches of false ego and the material conception of life.

PURPORT

In the .Narada-paiicaratra, devotional service to the Lord is likened unto a queen. When a queen gives an audience, many maidservants follow her. The maidservants of devotional service are material opulence, liberation and mystic powers. The karmis are very much attached to material enjoyment; the jfianis are very anxious to become freed from material clutches; and the yogis are very fond of attaining the eight kinds of mystic perfection. From the .Narada-paiicaratra we understand that if one attains the stage of pure devotional service, he also attains all the opulences derived from fruitive activities, empiric philosophical speculation and mystic yogic practice. Srila Bilvamari.gala Thakura therefore prayed in his Krgw-karrtlimrta: "My dear Lord, if I have unflinching devotion to You, You become manifest before me personally, and the results of fruitive activity and empiric philosophical speculation-namely religion,economic development,sense gratificationand liberation-become like personal attendants and remain standing before me as if awaiting my order." The idea here is that the Fianis, by culture of brahma-vidya, spiritual knowledge, struggle very hard to get out of the clutches of material nature, hut a devotee, by dint of his advancement in devotional service, automatically becomes detached from his material body. When the devotee's spiritual body begins to manifest, he actually enters into his activities in transcendental life.

At present we have contacted a material body, material mind and material intelligence, but when we become free from these material conditions, our spiritual body, spiritual mind and spiritual intelligence become manifest. In that transcendental state, a devotee attains all the benefits of karma, jiiana and yoga. Although he never engages in fruitive activities or empiric speculation to attain mystic powers, automatically

986 Srimad-Bhagavatam [Canto 4, Ch. 23

mystic powers appear in his service. A devotee does not want any kind of material opulence, but such opulence appears before him automatically. He does not have to endeavor for it. Because of his devotional service, he automatically becomes brahma-bhuta. As stated before, this is confirmed in Bhagavad-gztii:

miim ca yo 'vyabhiciirer.ta bhakti-yogena sevate sa gul)iin samatztyaitiin brahma-bhuyiiya kalpate

"One who is engaged in full devotional service, unfailing in all circum· stances, at once transcends the modes of material nature and thus comes to the level of Brahman." (Bg. 14.26)

Because of his regular discharge of devotional service, a devotee attains the transcendental stage of life. Since his mind is transcendentally situated, he cannot think of anything but the lotus feet of the Lord. This is the meaning of the word sarhsmara{la-anupurtyii. By constantly thinking of the lotus feet of the Lord, the devotee immediately becomes situated in suddha-sattva. Suddha-sattva refers to that platform which is above the modes of material nature, including the mode of goodness. In the material world, the mode of goodness is considered to be representative of the highest perfection, but one has to transcend this mode and come to the stage of suddha-sattva, or pure goodness, where the three qualities of material nature cannot act.

Srila Visvanatha Cakravarti Thakura gives the following example: If one has strong digestive power, after eating he automatically lights a fire within his stomach to digest everything and does not need to take medicine to aid his digestion. Similarly, the fire of devotional service is so strong that a devotee does not need to act separately to attain perfect knowledge or detachment from material attractions. AFiiinzmay become detached from material attractions by prolonged discussions on subjects of knowledge and may in this way finally come to the brahma-bhiita stage, but a devotee does not have to undergo so much trouble. By virtue of his devotional service, he attains the brahma-bhuta stage without a doubt. The yog!s and jn iinzs are always doubtful about their constitutional position; therefore they mistakenly think of becoming one with the Supreme. However, a devotee's relationship with the Supreme becomes manifest beyond all doubt, and he immediately understands that his position is that of eternal servant of the Lord. The jniinis and yogis may

Text ll) Maharaja }1thu 's Going Back Home 987

think of attammg liberation without rendering devotional service, but actually this is not possible because their intelligence is not as pure as that of a pure devotee. In other words, the jiiiinis and yogis cannot become factually liberated unless theybecome elevated to the position of devotees.

Aruhya krcchrerta pararh padarh tata� patanty adho 'nadrta-yu�madanghraya� (Bhiig. 10.2.32). The jiiiinis and yogis may rise to the highest position, Brahman realization, but because of their lack of devotion unto the lotus feet of the Lord, they again fall down into material nature. Therefore jiiiina and yoga should not be accepted as the real processes for liberation. By discharging devotional service, Maharaja Prthu automatically transcended all these positions. Since Maharaja Prthu was a saktyiiveia incarnation of the Supreme Lord, he did not have to act in any way to attain liberation. He came from the V aikul).tha world, or spiritual sky, in order to execute the will of the Supreme Lord on earth. Consequently he was to return home, back to Godhead, without having to execute jiiiina, yoga or karma. Although Prthu Maharaja was eternally a pure devotee of the Lord, he nonetheless adopted the process of devotional service in order to teach the people in general the proper process for executing the duties of life and ultimately returning home, back to Godhead.

TEXT 12

�'Rffi'lfTfflf.t&­

chinniinya-dhir adhigatiitma-gatir nirihas tat tatyaje 'cchinad idarh vayunena yena

tavan na yoga-gatibhir yatir apramatto yavad gadiigraja-kathiisu ratirh na kuryat

chinna-being separated; anya-dhilt-all other concepts of life (thebodily concept of life); adhigata-being firmly convinced; atma-ga t *-ultimate goal of spiritual life; nin1w�-desireless; tat-that; tatyaje-gave up; acchinat-he had cut; idam-this; vayunena- with the knowledge; yenaby which; tavat-so long; na-never; yoga-gatibhi�-the practice of the mystic yoga system; yati�-thepracticer; apramatta�-without anyillusion; yavat-so long; gadagraja-of Kr�qa; kathiisu-words ; ratim-attraction; na-never; kuryat-do it.

988 Srimad-Bhagavatam [Canto 4, Ch. 23
� ���� ��HNICIN�da-WI��II��II
(ij���SR0;c(G:(�ir.J I

When he became completely free from the conception of bodily life, Maharaja P,.-thu realized Lord 1(,.-�qa sitting in everyone's heart as the Paramatma. Being thus able to get all instructions from Him, he gave up all other practices of yoga and jiiana. He was not even interested in the perfection of the yoga and jiiana systems, for he thoroughly realized that devotional service to 1(,.-�J.la is the ultimate goal of life and that unless the yogis and jiianis become attracted to K,.-�r_la-katha [narrations about Kr�J.la], their illusions concerning existence can never be dispelled.

PURPORT

As long as one is too much absorbed in the bodily conception of life, he becomes interested in many different processes of self-realization, such as the mystic yoga system or the system utilizing the speculative empiric methods. However, when one understands that the ultimate goal of life is to approach Kr�l}a, he realizes Kr�l}a within everyone's heart and therefore help everyone who is interested in Kr�rya consciousness. Actually the perfection oflife depends on one's inclination to hear about Kr�rya. It is therefore mentioned in this verse: yavad gadagraja-kathasu ratim na kuryat. Unless one becomes interested in Kr�rya, in His pastimes and activities, there is no question of liberation by means of yoga practice or speculative knowledge.

Having attained to the stage of devotion, Maharaja Prthu became uninterestedinthe practices ofpiana and yoga andabandonedthem. Thisisthe stage of pure devotional life as described by Rupa Gosvami: anyabhila�itasunyam jiiana-karmiidy-aniivrtam/ anukulyena kn'1anuSilanam bhaktir uttama. Real jnana means understanding that the living entityistheeternal servant of the Lord. This knowledge is attained after many, many births, as confirmed in Bhagavad-gi'ta: bahunam janmanam ante jiianavan mam prapadyate (Bg. 7.19). In the paramaharhsa stage of life, one fully realizes Kr�rya as everything: vasudevat£ sarvam iti sa mahatma sudurlabhat£. When one understandsfullythat Kr�l}ais everything andthatKr�rya consciousness is the highest perfection of life, he becomes a paramahamsa, or mahatma. Such a mahatma or paramahamsa is very rare to find. A paramahamsa or pure devoteeis never attracted by hatha-yoga or speculative knowledge. He is simply interested in the unalloyed devotional service of the Lord. Sometimes one who is formally addicted to these processes tries to perform devotional service and the jiitina and yoga practices at the same time, but as soon as one comes to the unalloyed stage of devotional service, he is

Text 12) Maharaja Ptthu's Going Back Home 989 TRANSLATION

able to give up all other methods of self-realization. In other words, when one firmly realizes ��qa as the supreme goal, he is no longer attracted by mystic yoga practice or the speculative empirical methods of knowledge.

TEXT 13

� � etror�: , � � � �� �� qle€1(4{_ ������

evam sa vira-pravara[l. samyojyiitmiinam iitmani brahma-bhuto dglham kiile tatyiija svam kalevaram

evam- thus; sa[l.-he; vira-pravara[l.-the chief of the heroes; samyojyaapplying; iitmanam-mind; iitmani-unto the Supersoul; brahma-bhuta[l.being liberated; drgham- firmly; kiile-in due course of time; tatyiijagave up; svam-own; kalevaram-body.

TRANSLATION

In due course of time, f'rthu Maharaja was able to fix his mind firmly upon the lotus feet of Kr�tJ.a, and thus, completely situated on the brahmabhiita platform, he gave up the material body.

PURPORT

According to a Bengali proverb, whatever spiritual progress one makes in life will be tested at the time of death. In Bhagavad-gitii it is also confirmed: yam yam viipi smaran bhiivam tyajaty ante kalevaram/ tam tam evaiti kaunteya sadii tad-bhiiva-bhiivitaJ:t (Bg. 8.6 ).Those who are practicing Kr�qa consciousness know that their examination will be held at the time of death. If one can remember Kr11qa at death, he is immediately transferred to Goloka Vrndavana, or Kr�qaloka, and thus his life becomes successful. Prthu Maharaja, by the grace of Kr�qa, could understand that the end of his life was near, and thus he became veryjubilant and proceeded to completely give up his body on the brahma-bhuta stage by practicing the yogic process. It is thoroughly described in the following verses how one can voluntarily give up this body and return home, back to Godhead. The yogic process practiced by Prthu Maharaja at the time of death accelerates the giving up of this body while one is in sound health physically and mentally. Every devotee desires to give up the body while it is sound physicallyand mentally. Thisdesirewasalsoexpressedby King Kulasekhara in his Mukunda-miilii-stotra:

990 Srimad-Bhagavatam [Canto 4, Ch. 23·

Maharaja Prthu's Going Back Home

kr§T}a tvadiya-padapankaja-panjariintam adyaiva me visatu rruinasa-raja-haritsa�

prarta-prayarta-samaye kapha-vata-pitta* kartthavarodhana-vidhau smara[Larit kutas te

King Kulasekhara wanted to give up his body while in a healthy state, and he thus prayed to Kr�11a to let him die immediately while he was in good health and while his mind was sound. When a man dies, he is generally overpowered by mucus and bile, and thus he chokes. Since it is very difficult to vibrate any sound while choking, it is simply by Kr�9a's grace that one can chant Hare Kr�l}a at the time of death. However, by situating oneself in the muktasana position, a yogi can immediately give up his body and go to whatever planet he desires. A perfect yogi can give up his body whenever he desires through the practice of yoga.

TEXT 14

wn+1:Jf

sampi�ya payurit ptir§[!ibhyarit vayum utsiirayan chana* nabhyarit ko§the§v avasthapya hrd-ura�-karttha-sir§a[!i

sampi�ya-by blocking; payum - the door of the anus; ptir§[!ibhyam-by the calves; vayum - the air which goes up; utsarayan - pushing upward; sanai[t -gradually ; nabhyam-by the navel; ko§the§u-in the heart and in the throat; avasthapya-fixing up; hrt-in the heart; ura�-upwards; kaf!tha-throat ; sir§a[!i-between the two eyebrows.

TRANSLATION

When Maharaja Prthu practiced a particular yogic sitting posture, he blocked the doors of his anus with his ankles, pressed his right and left calves and gradually raised his life air upward, passing iton to the circle of his navel, up to his heart and throat, and finally pushed it upward to the central position between his two eyebrows.

PURPORT

The sitting posture described herein is called muktiisana. In the yoga process, after following the strict regulative principles controlling sleeping,

Text 14]
991
�qr�qpjqlf�RJjtO�Jfl;HW?;{§�! I
���tt�lttt \�:m�
11�\lll

eating and mating, one is allowed to practice the different sitting postures. The ultimate aim of yoga isto enable one to give up this bodyaccording to his own free will. One who has attained the ultimate summit of yoga practice can live in the body as long as he likes, or, as long as he is not completely perfect, leave the body to go anywhere within or outside the universe. Some yogis leave their bodies to go to the higher planetary systems and enjoy the material facilities therein. However,intelligent yogis do not wish to waste their time within this material world at all; they do not care for the material facilities in higher planetary systems but are interested in going directly to the spiritual sky, back home, back to Godhead.

Fromthe description in this verse,it appears that Maharaja Prthu had no desire to promote himself to the higher planetary systems. He wanted to return home immediately, back to Godhead. Although Maharaja Prthu stopped all practice of mystic yoga after realizing Kr�IJ.a consciousness, he nonetheless took advantage ofhis previous practice and immediately placed himself on the brahma-bhuta platform in order to accelerate his return to Godhead. The aim of this particular system of iisana, known as the sitting posture for liberation, or muktiisana, is to attain success in ku[l�alinicakra and. gradually raise the life from the muliidhara-cakra to the sviidhi§thiina-cakra, then to the ma[lipura-cakra, the aniihata-cakra, the viSuddha-cakra, and finally to the iijiiii-cakra. When the yogi reaches the iijiiii-cakra, between the two eyebrows, he is able to penetrate the brahmarandhra, or the hole in his skull, and go to any planet he desires up to the spiritual kingdom of Vaikur:ttha, or Kriiqaloka. The conclusion is that one hastocometothe brahma-bhiita stage for goingbackto Godhead. However, those who are in Kr�r:ta consciousness, or who are practicing bhakti-yoga (sravarzam kirtanam vi§flO� smarar-am piida-sevanam), can return to Godhead without even practicing the muktiisana process. The purpose of muktiisana practice is to come to the brahma-bhuta stage, for without being on the brahma-bhuta stage, one cannot be promoted to the spiritual sky. As stated in Bhagavad-gitii: miim ca yo 'vyabhiciirer-a bhakti-yogena sevate/ sa gu[liin samatityaitiin brahma-bhuyiiya kalpate (Bg. 14.26). The bhakti-yogl, practicing bhakti-yoga, is always situated on the brahmabhuta stage (brahma-bhuyiiya kalpate). If a devotee is able to continue on the brahma-bhuta platform, he enters the spiritual sky automatically after death and returns to Godhead. Consequently a devotee need not feel sorry for not having practiced the kur-�alini-cakra or not penetrating the six cakras one after another. As far as Maharaja Prthu was concerned, he had already practiced this process, and since he did not want to wait for the time when his death would occur naturally, he took advantage of the �at-

992 Srimad-Bhagavatam [Canto 4, Ch. 23

cakra penetration process and thus gave up the body according to his own free will and immediately entered the spiritual sky.

TEXT 15

m�� d �rN stifrurr� �:�: 1

� ttttff f�ffi �t{ �����\'!�II��II

utsarpayarhs tu tarh miirdhni

krameruivesya ni[lsprha[l viiyurh viiyau k§itau kiiyarh tejas tejasy ayiiyujat

utsarpayan-thus placing; tu-but; tam-the air; murdhni-on the head; kramerta- gradually; iivesya-placing ; n*sprha[l, - being freed from all material desires; vayum-the air portion of the body; viiyau-in the total air covering the universe; k§itau-in the total covering of earth; kayam-this material body; teja[l- the fire in the body; tejasi-in the total fire of the material covering; ayuyujat-mixed.

TRANSLATION

In this way, Ptthu Maharaja gradually raised his air of life up to the hole in his skull, whereupon he lost all desire for material existence. Gradually he merged his air of life with the totality of air, his body with the totality of earth, and the fire within his body with the totality of fire.

PURPORT

When the spiritual spark, which is described as one ten-thousandth part of the tip of a hair, is forced into material existence, that spark is covered by gross and subtle material elements. The material body is composed of five gross elements-earth, water, fire, air and ether-and three subtle elements-mind, intelligence and ego. When one attains liberation, he is freed from these material coverings. Indeed, success in yoga involves getting free from these material coverings and entering into spiritual existence. Lord Buddha's teachings of nirvarta are based on this principle. Lord Buddha instructed his followers to give up these material coverings by means of meditation and yoga. Lord Buddha did not give any information about the soul, but if one follows his instructions strictly, he will ultimately become free from the material coverings and attain nirvarta.

When a living entity gives up the material coverings, he remains a spirit soul. This spirit soul must enter into the spiritual sky to merge into the Brahman effulgence. Unfortunately, unless the living entity has informa-

Text 15] Maharaja ftthu's Going Back Home 993

tion of the spiritual world and the VaikuQ�has, there is a 99.9 percent chance of his falling down again into material existence. There is, however, a small chance of being promoted to a spiritual planet from the Brahman effulgence, or the brahmajyoti. This brahmajyoti is considered by impersonalists to be without variety, and the Buddhists consider it to be void. In either case, whether one accepts the spiritual sky as being without variety or void, there is none of the spiritualbliss which is enjoyed in the spiritual planets, VaikuJ;�thas or Kr�Qaloka. In the absence of varieties of enjoyment, the spirit soul gradually feels an attraction to enjoy a life of bliss, and not having any information of Kr�qaloka or Vaikuf)�haloka, he naturally falls down to material activities in order to enjoy material varieties.

TEXT 16

khany akase dravam toye yatha-sthanam vibhligasa?J, k�itim ambhasi tat tejasy ado viiyau nabhasy amum

khiini-the different holes inthe bodyfor the sense organs; akiise-in the sky; dravam-the liquid substance; to ye- in the water; yathii-sthiinamaccording to proper situation; vibhiigasa?J,-as they are divided; k;sitimearth; ambhasi-in the water; tat-that; tejasi-in the fire; ada?J, -the fire; viiyau-in the air; nabhasi-in the sky; amum-that.

TRANSLATION

In this way, according to the different positions of the various parts of the body, 1\thu Maharaja merged his bodily air with the air of the sky, his bodily liquids, such as blood and various secretions, with the totality of water, and he merged earth with water, then water with fire, fire with air, air with sky, and so on.

PURPORT

In-this verse two words are very important: yathii-sthiinarh vibhiigasafl.. In $rimad-Bhiigavatam, Second Canto, Chapter Five, Lord Brahma clearly explained to Narada how the creation took place, and he explained one step after another the proper divisions of the senses, the controller of the senses, the objects of the senses, and the material elements, and he also

994 Srimad-Bhagavatam [Canto 4, Ch. 23

explained how theyare created one after another: the air from the sky, the fire from the air, the water from the fire, the earth from the water, etc. It is important to knowthoroughlythe process of creation as it appliestothis cosmic manifestation. Similarly, this body is also created according to the same process by the Supreme Lord. The Personality of Godhead, after entering the universe, creates the cosmic manifestations one after another. Similarly, the living entity, after entering a womb of a mother, also collects his gross and subtle bodies, taking ingredients from the totality of sky, air, fire, water and earth. The words yathti-sthiinarh vibhiigasa� indicate that one should knowthe process of creation and should meditate upon the creative process inversely and thus become free from material contamination.

TEXT 17

indriye�u manas tiini tanmiitre�u yathodbhavam bhutiidiniimuny utknya mahaty iitmani sandadhe

indriye�u-in the sense organs; mana�-the mind; tiini-the sense organs; tanmiitre�u-in the objects of the senses;yatha-udbhavam-wherefrom they generated; bhuta-iidinii-by the five elements; amuni-all those sense objects; utkr�ya-taking out; mahati-in the mahat-tattva; iitmani-unto the ego;sandadhe-amalgamated.

TRANSLATION

He amalgamated the mind with the senses and the senses with the sense objects, according to their respective positions, and he also amalgamated the material ego with the total material energy, mahat-tattva.

PURPORT

In respect to the ego, the total material energy is sundered in two parts-one agitated by the mode of ignorance, and the other agitated by the modes of passion and goodness. Due to agitation by the mode of ignorance, the five gross elements are created. Due to agitation by the mode of passion, the mind is created, and due to agitation by the mode of goodness, false egoism or identification with matter is created. The mind is protected by a particular type of demigod. Sometimes the mind

Text 17] Maharaja Prthu's Going Back Home 995
��
��� wit� �l«t��1 ll,rnf'�l�� �lfR � 11�\911

(manaM is also understood to have a controlling deity or demigod. In this way the total mind, namely the material mind controlled by material demigods, was amalgamated with the senses. The senses, in turn, were amalgamated with the sense objects. The sense objects are forms, tastes, smells, sounds, etc. Sound is the ultimate source of the sense objects. The mind was attracted by the senses and the senses by the sense objects, and all of them were ultimately amalgamated in the sky. The creation is so arranged that cause and effect follow one after the other. The merging process involves amalgamating the effect with the original cause. Since the ultimate cause in the material world is the mahat-tattva, everything was gradually wound up and amalgamated with the mahat-tattva. This may he compared to sunyavada, or voidism, in that this is the process for cleansing the real spiritual mind, or consciousness.

When the mind is completely washed of all material contamination, the pure consciousness acts. The sound vibration from the spiritual sky can automaticallycleanseallmaterialcontaminations, as confirmedby Caitanya Mahaprabhu: ceto-darparta-marjanam. Weneed onlytake the advice of Lord Caitanya Mahaprabhu and chant the Hare Kreyqa mantra to cleanse the mind of all material contamination, and this may be considered the summary of this difficult verse. As soon as the whole material contamination is washed away by this process of chanting, all desires and reactions to material activities become immediately vanquished, and real life, peaceful existence, begins. In this age of Kali it is very difficult to adopt the yogic process mentioned in this verse. Unless one is very expert in such yoga, the best course is to adopt the ways and means of Lord Caitanya Mahaprabhu, sri-kr§TJ-a-sankirtanam. Thus one can gloriously become freed from all material contamination by the simple process of chanting Hare Kr'll)a, Hare Kreyqa, Kreyqa Kr'll)a, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare. Just as life in this material world has its beginning in material sound, similarly a spiritual life has its beginning in this spiritual sound vibration.

996 Srimad-Bhagavatam [Canto 4, Ch. 23
18 d �utf� � �w'tl+t� �I d ��'ffili�+t«l'4��ttl �I �nr�RIJf ��SiSf(l�st(: 11��11
mayamaye nyadhat
TEXT
tarh sarva-gurta-vinyasarh jive

Maharaja frthu's Going Back Home

tarh canusayam atma-stham asav anusayi puman

jiiana-vairagya-viryerta

svariipa-stho 'jahat prabhu�

tam-unto Him; sarva-gur-a-vinyasam-the reservoir of all qualities; jiveunto the designations; mayamaye-the reservoir of all potencies; nyadhatplaced; tam-that; ca- also; anusayam-designation; atma-stham- situated in self-realization; asau-he; anusayi-the living entity; puman-the enjoyer; jiiana- knowledge; vairagya- renunciation; viryera-by the prowess of; svariipa-stha� - being situated in one's constitutional position; ajahatreturned back home; prabhu�- the controller.

TRANSLATION

frthu Maharaja then offered the total designation of the living entity unto the supreme controller of illusory energy. Being released from all the designations by which the living entity became entrapped, he became free by knowledge and renunciation and by the spiritual force of his devotional service. In this way, being situated in his original constitutional position of l<f�Q.a consciousness, he gave up this body as a prabhu, or controller of the senses.

PURPORT

As stated in the Vedas, the Supreme Personality of Godhead is the source of material energy. Consequently He is sometimes called miiyiimaya, or the Supreme Person who can create His pastimes through His potency known as the material energy. The fiva, or the individual living entity, becomes entrapped by the material energy by the supreme will of the Supreme Personality of Godhead. In Bhagavad-g"itii we understand:

Tsvara{t sarva-bhutiiniirh

hrd-dese 'rjuna tifithati

bhriimayan sarva-bhutiini yantriiru�hiini miiyayii

"The Supreme Lord is situated in everyone's heart, 0 Arjuna, and is directing the wanderings of all living entities, who are seated as on a machine, made of the material energy." (Bg. 18.61)

lsvara, the Supreme Personalityof Godhead,issituatedwithintheheartof all conditioned souls, and by His supreme will the living entity or individual

Text 18]
997

soul gets the facility to lord it over material nature in various types of bodies, which are known as yantra, or the moving vehicle offered by the total material energy, miiyii. Although the individual living entity (jiva) and the Lord are both situated within the material energy, the Lord is directing the movements of the jiva soul by offering him different types ofbodies throughthe material energy,and thus the living entityis wandering throughout the universes in various forms of body and becomes implicated in different situations, partaking of the ·reactions of fruitive activities.

When Prthu Maharaja became spiritually powerful by the enhancement of his spiritual knowledge, jiiana and renunciation of material desires, he became a prabhu, or master of his senses (sometimes calledgosviimior sviimi). This means that he was no longer controlled by the influence of material energy. When one is strong enough to give up the influence of material energy, he iscalled prabhu. In this versethe word svarupastha� is also very significant. The real identity of the individual soul lies in understanding or attaining the knowledge that he is eternally a servant of Kr�J;J.a. This understanding is called svarupopalabdhi. By culturing devotional service, the devotee gradually comes to understand his actual relationship with the Supreme Personality of Godhead. This understanding of one's pure spiritual position is called svarii.popalabdhi, and when one attains that stage he can understand howhe is relatedwith the Supreme Personalityof Godhead as a servant or friend, or as a parent or conjugal lover. This stage of understanding is called svarupastha[l.. Prthu Maharaja realized this svarupa completely, and it will be clear in the later chapters that he personally left this world, or this body, by riding on a chariot sent from Vaikut;�tha.

In this verse the word prabhu is also significant. As statedbefore,when one is completely self-realized and acts according to that position, he can be called prabhu. The spiritualmasteris addressed as"Prabhupada"because he is a completely self-realized soul. Theword piida means "position," and Prabhupada indicates that he is given the position of prabhu, or the Supreme Personality of Godhead, for he acts on behalf of the Supreme Personalityof Godhead. Unless one is a prabhu, or controller of the senses, he cannot act as spiritual master. He is authorized by the Supreme Prabhu, or Lord Kr�Qa. In his verses praising the spiritualmaster, Srila Visvanatha Cakravarti J'hakura writes:

sakfiad-dharitvena samasta-sastrair uktas tathii bhiiv_yata eva sadbhi[l.

"The spiritual master is honored as much as the Supreme"Lord becausehe

998 Srimad-Bhagavatam [Canto 4, Ch. 23

is the most confidential servitor of the Lord." Thus Pfthu Maharaja can also be called Prabhupada, or, as described herein, prabhu. Another question may be raised in this connection. Since Prthu Maharaja was a power incarnation of the Supreme Personality of Godhead, saktyiivesa-avatiira, why did he have to execute the regulative principles in order to become a prabhu? Because he appeared on this earth as an ideal king and because it is the duty of the king to instruct the citizens in the execution of devotional service, he followed all the regulative principles of devotional service in order to teach others. Similarly, Caitanya Mahaprabhu, although l<.reyq.a Himself, taught us how to approach l<.reyqa as a devotee. It is said: iipani acari' bhakti sikhainu savare. Lord Caitanya Mahaprabhu instructed others in the process of devotional service by setting the example Himself through His own personal actions. Similarly, Pfthu Maharaja, although a §aktyiivesa-avatiira incarnation, still behaved exactly as a devotee in order to achieve the position of prabhu. Furthermore, svarilpastha� means complete liberation. As it is said, hitviinyathii rupam svarupena avasthit*: when a living entity abandons the activities of miiyii and attains the position from which he can execute devotional service, his state is called svarupastha�, or complete liberation.

TEXT 19

31Rt�tq �u�ir �q�;� � 1 titiql�� :;:a �qf{+trf �;:f �: II��II

arcir nama maha-raji'ii

tat-patny anugata vanam sukumary atad-arha ca yat-padbhyam sparsanarh bhuval)

arci[l nama-of the name Arci; maha-rajiii-the Queen; tat-patni-the wife of Maharaja Prthu;anugata-who followed her husband;vanam-in the orest;sukumari- very delicate body;a-tat-arha-who did not deserve;caalso; yat-padbhyiim-by the touch of whose feet; sparsanam- touching; bhuva�-on the earth.

TRANSLATION

The Queen, the wife of Pfthu Maharaja, whose name was Arci, followed her husband into the forest. Since she was a queen, her body was very delicate. Although she did not deserve to live in the forest, still she voluntarily touched her lotus feet to the ground.

Text 19] Maharaja frthu's Going Back Home 999

PURPORT

Because Prthu Maharaja's wife was the Queen and also a daughter of a king, she never experienced walking on the ground because queens used to never come out of the palace. They certainly never went to the forests and tolerated all the difficulties of living in the wilderness. In Vedic civilization there are hundreds of similar examples of such renunciation on the part of queens and dedication to the husband. The goddess of fortune, mother Sita, followed her husband Ramacandra when He went to the forest. Lord Ramacandra went to the forest in compliance to the order of His father Maharaja Dasaratha, but mother Sita was not so ordered. Nonetheless, she voluntarily accepted the path of her husband. Similarly, Gandhari, the wife of King Dhrtara��ra, also followed her husband into the forest. Being the wives of great personalities like J>rthu, Lord Ramacandra and Dhrtara�tra, these were ideal, chaste women. Such queens also instructed the general people by showing them how to become a chaste wife and follow the husband in every stage of life. When'the husband is king, she sits beside him as the queen, and when he goes to the forest, she also follows, despite having to tolerate all kinds of difficulties in living in the forest. Therefore it is said here (a-tad-arha) that although she did not want to touch her feet to the ground, she nonetheless accepted all difficulties when she went to the forest with her husband.

ativa bhartur vrata-dharma-ni�thaya susru�aya car�a-deha-yiitraya navindatartim parikarsitiipi sii

preyaskara-sparsana-miina-nirvrtitt

ativa - very much; bhartu[t-of the husband; vrata-dharma-vow to serve him; ni�thayii-by determination; susru�aya-by serving; ca-also; iir�a-like the great saintly sages; deha-body; ytitraya -living condition; na-did not; avindata-perceive; artim-any difficulty; parikarsitii api-although transformed to become lean and thin; sa-she; preyaskara- very pleasing; sparsana-touching; miina-engaged; nirvrti[t-pleasure.

1000 Srimad-Bhagavatam [Canto 4, Ch. 23
�ij��f.iw;n
:�n1��1'1ttl 1
lff«��eufq m
TEXT 20 3Ritcr
��
;nf.t��uffl
W:r��o:r�r-tf.fiftn

Although she was not accustomed to such difficulties, Queen Arci followedherhusbandintheregulativeprinciplesoflivingintheforestlike great sages. She lay down on the ground and ate only fruits, flowersand leaves,andbecauseshewasnotfitfortheseactivities,shebecamefrailand thin. Yet because of the pleasure she derived in serving her husband, she didnotfeelanydifficulties.

PURPORT

The words bhartur vrata-dharma-niflthayii indicate that a woman's duty or religious principle is to serve her husband in all conditions. In Vedic civilization a man is taught from the beginning of his life to become a brahmaciiri:, then an ideal grhastha, then viinaprastha, then sannyiisi:, and the wife is taught just to follow the husband strictly in all conditions of life. After the period of brahmacarya, a man accepts a householder's life, and the woman is also taught by her parents to be a chaste wife. Thus when a girl and boy are united, both are trained for a life dedicated to a higher purpose. The boy is trained to execute his duty in accordance with the higher purpose of life, and the girl is trained to follow him. The chaste wife's duty is to keep her husband pleased in householder life in all respects, and when the husband retires from family life, she is to go to the forest and adopt the life of viinaprastha, or vana-viisi:. At that time the wife is to follow her husband and take care of him, just as she took care of him in householder life. But when the husband takes the renounced order of life, namely sannyiisa, the wife is to return home and become a saintly woman, setting an examplefor her childrenand daughters-in-law andshowing them how to live a life of austerity.

When Caitanya Mahaprabhu took sannytisa, His wife, Vi�pupriya-devi, although only sixteen years old, also took the vow of austerity due to her husband's Leaving home. She chanted her beads, and after finishing one round, she collected one grain of rice. In this way, as many rounds as she chanted, she would receive the same number of rice grains and then cook em and so take prastida. This is called austerity. Even today in India, widows, or women whose husbands have taken sannyiisa, follow the principles of austerity, even though they live with their children. Prthu Maharaja's wife, Arci, was steadily determined to execute the duty of a wife, and while her husband was in the forest, she followed him in eating onlyfruits and Leaves and Lying down on the ground. Since a woman's body is considerably more delicate than a man's, Queen Arci became very frail and thin. Parikarsitti. When one engages in austerities, his body generally becomes lean and thin. Becoming fat is not a very good qualification in

Text20] Maharaja Prthu'sGoingBack Home 1001
TRANSLATION

spiritual life because a person who is engaged in spiritual life must reduce the comforts of the body-namely eating, sleeping and mating-to a minimum. Although QueenArci became very thin from living in theforest according to regulative principles, she was not unhappy because she was enjoying the honor of serving her great husband.

TEXT 21

� �qiSIIRcte�e�•uR'

�: 'lfil044t�m �: 1

lite� fftifiitq �� '11 ��

�l+itttitqt�i(B:(1t!JM II'{�II

deharh vipanniikhila-cetaniidikarh patyul;t prthivyii dayitasya ciitmanal;t iilak§ya kiiicic ca vilapya sii sati citiim athiiropayad adrisiinuni

deham-body; vipanna-completely failing; akhila-all; cetana- feeling ; iidikam-symptoms; patyul;t-of her husband; prthivyii l;t-the world; dayitasya-of the merciful; ca iitmanal;t-also of herself; iilak§ya- by seeing; kiiicit-very little; ca-and; vilapya- lamenting ; sii-she; sati-the chaste; citiim-unto the fire; atha-now; iiropayat-placed; adri-hill; siinuni-on thetop.

TRANSLATION

When Queen Arci saw that her husband, who had been so merciful to her and the earth, no longer showed symptoms of life, she lamented for a little while and then built a fiery pyre on top of a hill and placed the body of her husband on it.

PURPORT

After seeing all the life symptoms in her husband stop, the Queen lamented for a while. The word kiiicit means "for a little while." The Queen was completely aware that her husband was not dead, although the symptoms of life-action, intelligence and sense perception-had ceased. As stated in Bhagavad-gttii:

dehino 'smin yathii dehe kaumiirarh yauvanarh jarii

tathii dehiintara-priiptir

dhiras tatra na muhyati

1002 Srimad-Bhagavatam [Canto 4, Ch. 23

"As the embodied soul continually passes, in this body, from boyhood to youth to old age, the soul similarly passes into anotherbodyat death. The self-realized soul is not bewildered by such a change." (Bg. 2.13)

When a living entity transfers from one body to another, a process generally known as death, a sane man does not lament, for heknows that the living entity is not dead but is simply transferred from one body to another. The Queen should have been afraid of being alone in the forest with the body of her husband, but since she was a great wife of a great personality, she lamented for a while but immediately understood that she had many duties to perform. Thus instead of wasting her time in lamentation, she immediately prepared a fierypyre·on top of a hill and then placed the body of her husband on it to be burned.

Maharaja Prthu is described here as dayita, for he was not only the king of the earth, but he treated the earth as his protected child. Similarly, he protected his wife also. It was the duty of the king to give protection to everyone, especially to the earth or land which he ruled, as well as the citizens and his family members. Since Prthu Maharaja was a perfect king, he gave protectionto everyone,and thereforeheisdescribed here as dayita.

TEXT

vidhiiya krtyarit hradin"i-jaliiplutii

dattvodakarit bhartur udiira-karrnaf!aft

natvii divi-sthiirits tri-dasiims trift par'itya

vivesa vahnirit dhyiiyat'i bhartr-padau

vidhaya-executing; krtyam-the regulative function; hradini-in the water of the river; jala-iipluta-taking bath completely; dattva udakamoffering oblations of water; bhartu[t-of her husband; udara-karmarwftwho was so liberal; natva-offering obeisances;divi-sthan-situated in the sky; tri-dasan-the thirty million demigods; trift-three times; parityacircumambulating;vivesa- entered; vahnim- thefire; dhyayati-whilethinking of; bhartr-of her husband;padau-the two lotus feet.

Text 22) Maharaja Prthu's Going Back Home 1003
22 � � (�;f\�:t{IH�I t:+flt:Etl fi�G:I�t: I � � � ctft� fl�l(l ����II

TRANSLATION

After this, the Queen executed the necessary funerary functions and offered oblations of water. After bathing in the river, she offered obeisances to various demigods situated in the sky in the different planetary systems. She then circumambulated thefireand,whilethinking ofthe lotusfeetofherhusband,entereditsflames.

PURPORT

The entrance of a chaste wife into the flames of the pyre of her dead husband is known as saha-gamana. This means that it is customary for the wife to die with her husband. This system of saha-gamana has been practiced in Vedic civilization from time immemorial. Even after the British period in India this practice was rigidly observed, but soon it degraded to·the point that even when the wife was not strong enough to enter the fire of her dead husband the relatives would force her to enter. Thus this practice had to be stopped, but even today there are still some solitary cases where a wife will voluntarily enter the fire and die with her husband. Even after 1940 we personally knew of a chaste wife who died in this way.

TEXT 23

vilokyiinugatiim siidhvim

prthum v"ira-va ram patim tu.stuvur vara-dii devair

deva-patnya[! sahasrasa[!

vilokya-by observing;anugatam-dying after the husband;siidhvim-the chaste woman; prthum-of King Prthu; vira-varam-the great warrior; patim-husband;tu�_tuvu�-offered prayers;vara-dii�-able to give benediction; devaib,-by the demigods; deva-patnyal;-the wives of the demigods; sahasrasal;-in thousands.

TRANSLATION

After observing this brave act performed by the chaste wife Arci, the wife of the great King Prthu, many thousands of the wives of the demigods, along with their husbands, offered prayers to the Queen,for theywereverymuchsatisfied.

1004 Srlmad-Bhagavatam [Canto 4, Ch. 23
�q it'rol� qfij" I
-� ���: �: 11��11

Maharaja Ptthu's Going Back Home

TEXT 24

kurvatya[l kusumiisiiram tasmin mandara-siinuni nadatsv amara-turye.su

gnwnti sma parasparam

kurvatya�-just showering;kusuma-llstiram-showers of flowers;tasminin that; mandara-of the Mandara hill; stinuni-on the top; nadatsuvibrating; amar-a-turye§u-beating of the drums of the demigods;grrtanti sma-they were talking;parasparam-amongst themselves as follows.

TRANSLATION

At that time the demigods were situated on the top of Mandara Hill, and all their wives began to shower flowers on the funeral pyre and began to talk amongst themselves as follows.

TEXT 25

devya ucu[l

aho iyarh vadhur dhanyii

yii caivarh bhu- bhujiirh patim

sarviitmanii patim bheje

yajiiesam srir vadhur iva

devya� ucu�-the wives of the demigods said; aho-alas; iyam- this ; vadhu� - the wife; dhanyii-most glorious; yii-who ; ca-also; evam-as; bhu-of the world;bhujtim- of all the kings;patim-the king;sarvtitmantiwith full understanding; patim- unto the husband; bheje-worshiped; yajiiesam-unto Lord Vi�I).U; sn[l-the goddess of fortune; vadhu� - wife; iva-like .

Text 25)
.r�:
1 ;cwq¥4(\\.�:t �� �
tU'4•e•( m4t"'t��a�
qwc�� 11 '\lll
1005

TRANSLATION

The wives of the demigods said: All glories to Queen Arci! We can see that this Queen of the great King Prthu, the Emperor of all the kings of the world, has served her husband with mind, speech and body exactly as the goddess of fortune serves the Supreme Personality of Godhead, Yajfiesa or Vi��u.

PURPORT

In this verse the words yajnesarh snr vadhur iva indicate that Queen Arci served her husband just as the goddess of fortune serves the Supreme Personality of Godhead Vi9l)U. We can observe that even in the history of this world, when Lord Kr�qa, the Supreme Vi9QU, was ruling over Dvaraka, Queen Rukmir;ti, who was the chief of all Kr�qa's queens, used to serve Lord Kr�qa personally in spite of having many hundreds of maidservants to assist her. Similarly, the goddess of fortune in the Vaikur:t�ha planets also serves Narayar;ta personally, although there are many thousands of devotees prepared to serve the Lord. This practice is also followed by the wives of the demigods, and in days past the wives of men also followed this same principle. In Vedic civilization the husband and wife were not separated by such man-made laws as divorce. We should understand the necessity for maintaining family life in human society and should thus abolish this artificial law known as divorce. The husband and wife should live in Kwp consciousness and follow the footsteps of Lak9mi-Narayar;ta, or Kr�T).a-Rukmir:ti. In this way peace and harmony can be possible within this world.

TEXT 26

�����II

saifia nunarh vrajaty urdhvam

anu vainyam patim satz

pasyatasman atztyarcir

durvibhavyena karmara

sa-she; e§a-this; nunam-certainly; vrajati-going; urdhvam-upwards; anu-following; vainyam-the son of Vena; patim-husband; sati-chaste; pasyata-just see; asman-us; atitya-overpassing; arcil).-of the name Arci; durvibhavyena-by inconceivable; karmarii-activities.

1006 Srimad-Bhagavatam [Canto 4, Ch. 23
h ;t!f � -mt m 1

The wives of the demigods continued: Just see how this chaste lady, Arci, by dint of her inconceivable pious activities, is still following her husband upwards, as far as we can see.

PURPORT

Both Prthu Maharaja's airplane and the airplane carrying Queen Arci were passing out of the vision of the ladies of the higher planetary systems. These ladies were simply astonished to see how Prthu Maharaja and his wife achieved such an exalted position. Although they were the wives of the denizens of the higher planetary system and Prthu Maharaja was an inhabitant of an inferior planetary system (the Earth), the King, along with his wife, passed beyond the realms of the demigods and went upward to Vaikur;t�haloka. The word urdhvam (upwards) is significant here, for the ladies speaking were from the higher planetary systems, which include the moon, sun and Venus up to Brahmaloka, or the highest plan�t. Beyond Brahmaloka is the spiritual sky, and in that spiritual sky there are innumerable Vaikur;t�halokas. Thus the word iirdhvam indicates that the Vaikur;t�ha planets are beyond or above these material planets, and it was to these Vaikur;t�ha planets that Prthu Maharaja and his wife were going. This also indicates that when Prthu Maharaja and his wife, Arci, abandoned their material bodies in the material fire, they immediately developed their spiritual bodies and entered into spiritual airplanes which could penetrate the material elements and reach the spiritual sky. Since they were carried by two separate airplanes, it may be concluded that even after being burnt in the funeral pyre they remained separate individual persons. In other words, they never lost their identity or became void, as imagined by the impersonalists.

The ladies in the higher planetary systems were capable of seeing both downwards and upwards. When they looked down they could see that the body of Prthu Maharaja was being burnt and that his wife, Arci, was entering into the fire, and when they looked upwards they could see how they were being carried in two airplanes to the Vaiku�:t�halokas. All of this is possible simply by durvibhavyena karmarui, inconceivable activity. Prthu Maharaja was a pure devotee, and his wife, Queen Arci, simply followed her husband. Thus they can both be considered pure devotees, and thus they are capable of performing inconceivable activities. Such activities are not possible for ordinary men. Indeed, ordinary men cannot even take to the devotional service of the Lord, nor can ordinary women

Text 26] Maharaja Prthu's Going Back Home 1007
TRANSLATION

maintain such vows of chastity and follow their husbands in all respects. A woman does not need to attain high qualifications, but if she simply follows in the footsteps of her husband, who must be a devotee, then both husband and wife attain liberation and are promoted to the VaikuQ.�halokas. This is evinced by theinconceivable activities of Maharaja Prthuandhiswife.

TEXT 27

te�iimduriipam kimtv anyan martyiiniim bhagavat-padam

bhuvi lol.iiyu�oye vai nai_skarmyam siidhayanty uta

te�am-of them; durapam-difficult to obtain; kim-what; tu-but; anyat-anything else; martyanam-of thehuman beings; bhagavat-padamthe kingdom of God; bhuvi-in theworld;lola-flickering; ayu§a[l-span of life; ye-those; vai-certainly; nai§karmyam-the path of liberation; sadhayanti-execute; uta-ex actly.

TRANSLATION

In this material world, every human being has a short span of life, but those who are engaged in devotional service go back home, back to Godhead, for they are actually on the path of liberation. For such persons, there is nothing which is not available.

PURPORT

In Bhagavad-gita Lord Kr�qa says: anityam asukham lokam imani prapya bhajasva mam (Bg. 9.33). The Lordheredeclaresthat thismaterial world is full of miseries (asukham) and atthesame time is very flickering (anityam). Therefore one's only duty is to engage himself in devotional service. This is the best end to which human life can be put. Those devotees who are constantly engaged in the service of the lotus feet of the Lord achieve not only all material benefits but also all spiritual benefits, forat theend oflifetheygoback home, back to Godhead. Their destination is described in this verse as bhagavat-padam. Theword padam means "abode," and bhagavat means "the Supreme Personality of God-

1008 Srimad-Bhagavatam [Canto 4, Ch. 23
� �ft ��"l�i-rif4ilq��l( I 'CR t"1leltnit� �'¥Ri m�� II �\911

head." Thus the destination of the devotees is the abode of the Supreme Personality of Godhead.

In this verse the word na4karmyam, which means transcendental knowledge, is also significant. Unless one comes to the platform of transcendental knowledge and offers devotional service to the Lord, he is not perfect. Generally the processes of jiiiina, yoga and karma are executed life after life before one gets a chance to render pure devotional service to the Lord. This chance is given by the grace of a pure devotee, and it is in this way only that one can actually attain liberation. In the context of this narration, the wives of the demigods repented because although they had the opportunity of a birth in a higher planetary system, a lifetime spanning many millions of years and all material comforts, they were not as fortunate as PJ;thu Maharaja and his wife, who were actually surpassing them. In other words, Prthu Maharaja and his wife scorned promotion to the higher planetary systems and even to Brahmaloka because the position which they were attaining was incomparable. In Bhagavad-gita the Lord affirms, abrahma-bhuvanal lokal;t punar avartino 'rjuna: "From the highest planet in the material world to the lowest, all are places of misery wherein repeated birth and death take place." (Bg. 8.16) In other words, even if one goes to the highest planet, Brahmaloka, he has to return to the miseries of birth and death. In the Ninth Chapter of Bhagavad-gita, Lord Kr�qa also asserts:

te tam bhuktva svarga-lokarh visalarh k�irte purtye martya-lokarh visanti

"When they have thus enjoyed heavenly sense pleasure, they return to this mortal planet again." (Bg. 9.21) Thus after exhausting the results of pious activities, one has to come again to the lower planetary systems and begin a new chapter of pious activities. It is therefore said in SrimadBhagavatam, nai§karmyam apy acyuta-bhava-varjitam: "The path of liberation is not at all secure unless one attains the devotional service of the Lord." (Bhiig. 1.5.12) Even if one is promoted to the impersonal brahmajyoti, he runs every chance of falling down into this material world. If it is possible to fall down from the brahmajyoti, which is beyond the higher planetary systems in this material world, then what can be said of the ordinary yogis and karmis who can only be elevated to the higher material planets? Thus the wives of the denizens of the higher planetary systems did not very much appreciate the results of karma, jiiiina and yoga.

Text 27] Maharaja Prthu's Going Back Home 1009

TEXT 28 6� �.Fti��iNI -:a'

6CQjlqqnf � � ftm ����11.

sa vancito batiitma-dhruk krcchre[la mahatii bhuvi

l.abdhviipavargyam manu.§yam

vifiayefiu vifia}jate

sa[l.-he; va iicita[l.-cheated ; bata-certainly;atma-dhruk-enviousofhimself; krcchrera-with great difficulty; mahata-by great activities; bhuviin this world; l.abdhva-by achieving; apavargyam-the path of liberation; manu§yam-in the human form of life; vi§aye§u-in the matter of sense gratification; vi§ajjate-becomes engaged.

TRANSLATION

Any person who engages himself within this material world in performing activities that necessitate great struggle, and who, after obtaining a human form of life-which is a chance to attain liberation from miseries-undertakes the difficult tasks offruitiveactivities,mustbe considered to be cheatedandenvious ofhisownself.

PURPORT

In this material world people are engaged in different activities simply to achieve a little success in sense gratification. The karmi's are engaged in performing very difficult activities, and thus they open gigantic factories, build huge cities, make big scientific discoveries, etc. In other words, they are engaged in performing very costlysacrifices in order to be promoted to the higher planetary systems. Similarly, yogis are engaged in achieving a similar goal by accepting the tedious practices of mystic yoga. ]nanis are engaged in philosophical speculation in order to gain release from the clutches of material nature. In these ways everyone is engaged inperforming very difficult tasks simply for the gratification of the senses. All of these are considered to be engaged in sense gratificatory activities (or vifiaya) because they all demand some facility for material existence. Actually the results of such activities are temporary, as K.r��a Himself proclaims in Bhagavad-gita: antavat tu phal.am te§am: "The fruits [of those who worship the demigods] are limited and temporary." (Bg. 7.23) Thus the fruits of the activities of the yogis, karmis and jnanis are

1010 Srimad-Bhagavatam [Canto 4, Ch. 23 .

ephemeral. Moreover, Kr�qa says, tad bhavaty alpa-medhasam: "They are simply meant for men of small intelligence." (Bg. 7.23) The word vi�aya denotes sense gratification. The karmis flatly state that they want sense gratification. The yogis also want sense gratification, but they want it to a higher degree. It is their desire to show some miraculous results through the practice of yoga. Thus they strive very hard to achieve success in becoming smaller than the smallest or greater than the greatest, or in creating a planet like the earth, or, as scientists, by. inventing so many wonderful machines. Similarly, the jiiiinzs are also engaged in sense gratification, for they are simply interested in be<;oming one with the Supreme. Thus the aim of all these activities is sense gratification to a higher or a lower degree. The bhaktas, however, are not interested in sense gratificatory practices; they are simply satisfied to get an opportunity to serve the Lord. Although they are satisfied in any condition, there is nothing they cannot obtain because they are purely engaged in the service'of the Lord.

. The wives of the demigods condemn the performers of sense gratificatory activities as vaiicita, cheated. Those so engaged are actually killing themselves (atma-M). As stated in Srzmad-Bhcigavatam:

nr-deham adyarh su-labham su-durlabham

plavarh su-kalparh guru-kar[la-dharam

mayanukulena nabhasvateritarh

puman bhatiabdhim na taret sa atma-ha (Bhcig. 11.20.17)

When one wants to cross a large ocean, he requires a strong boat. It is said that this human form of life is a good boat by which one can cross the ocean of nescience. In the human form of life one can obtain the guidance of a good navigator, the spiritual master. He also gets a favorable wind by the mercy of Kr�qa, and that wind is the instructions of Kr�qa. The human body is the boat, the instructions of Lord Kr�qa are the favorable winds, and the spiritual master is the navigator. The spiritual master knows well how to adjust the sails to catch the winds favorably and steer the boat to its destination. If, however, one does not take advantage of this opportunity, he wastes the human form of life. Wasting time and life in this way is the same as committing suicide.

The word labdhvcipavargyam is significant in this verse because, according to .Tiva Gosvami, apavargyam, or the path of liberation, does not refer to merging into the impersonal Brahman but to salokyadi-siddhi which

Text 28] Maharaja J>rthu 's Going Back Home lOll

means attaining the very planet where the Supreme Personality of Godhead resides. There are five kinds of liberation, and one is called sayujya-mukti, or merging into the existence of the Supreme or the impersonal Brahman effulgence. However, since there is a chance of one's falling down again into the material sky from the Brahman effulgence, Srila Jiva Gosvami advises that in this human form of life one's only aim should be to go back home,back to Godhead. The words sa vancita� indicate that once a person has obtained the human form of life, he is actually cheated if he does not make preparations to go back home, back to Godhead. The position of all nondevotees who are not interested in going back to Godhead is very much lamentable, for the human form of life is meant for executing devotional service and nothing else.

TEXT 29

maitreya uviica stuvati�v amara-stri"�u pati-lokarh gatii vadhu� yam vii iitma-vidiim dhuryo vainya� priipiicyutiisraya�

maitreya� uviica-the great sage Maitreya continued to speak; stuvat�suwhile glorifying; amara-str�su-by the wives of the denizens of heaven; pati-lokam-the planet where the husband had gone; gata-reaching; vadhiltt-the wife; yam- where; va-or; atma-vidam-of the self-realized souls; dhurya�-the topmost; vainya�-the son of King Vena (Prthu Maharaja); prapa-obtained; acyuta-asraya�-under the protection of the Supreme Personality of Godhead.

TRANSLATION

The great sage Maitreya continued speaking: My dear Vidura, when the wives of the denizens of heaven were thus talking amongst themselves, Queen Arci reached the planet which her husband, Maharaja Prthu, the topmost self-realized soul, had attained.

1012 Srimad-Bhagavatam [Canto 4, Ch. 23
'tfUftcqil(«f1 qRIJl+fi mn if{: I 1i�311€t1HaJ���:snq1�1�:11�'11
��!Ii3'<fR

According to Vedic scriptures, a woman who dies with her husband, or enters into the fire in which her husband is burning, also enters the same planet her husband attains. In this material world there is a planet known as Patiloka, just as there is a planet known as Pitrloka. But in this verse the word pati-loka does not refer to any planet within this material universe, for Prthu Maharaja, being topmost amongst self-realized souls, certainly returned home, back to Godhead, and attained one of the Vaikui,l�ha planets. Queen Arci also entered patiloka, but this planet is not in the material universe, for she actually entered the planet which her husband attained. In the material world also, when a woman dies with her husband, she again unites with him in the next birth. Similarly, Maharaja Prthu and Queen Arci united in the Vaikui,l�ha planets. In the Vaikui,ltha planets there are husbands and wives, but there is no question of their giving birth to children nor having sex life. In the Vaikui,l�ha planets both husbands and wives are extraordinarily beautiful, and they are attracted to one another, but they do not enjoy sex life. Indeed, they consider sex not to be very relishable because both husband and wife are always absorbed in KwJ.a consciousness and in glorifying and chanting the glories of the Lord.

According to Bhaktivinoda 'fhakura also, a husband and wife can turn the home into a place as good as Vaikui,l�ha, even while in this material world. Being absorbed in Kr�qa consciousness, even in this world husband and wife can live in Vaikui,l�ha simply by installing the Deity of the Lord within the home and serving the Deity according to the directions of the sastras. In this way, they will never feel the sex urge. That is the test of advancement in devotional service. One who is advanced in devotional service is never attracted by sex life, and as soon as one becomes detached from sex life and proportionately attached to the service of the Lord, he actually experiences living in the Vaikui,l�ha planets. In the ultimate issue, there is actually no material world, but when one forgets the service of the Lord and engages himself in the service of his senses, he is said to be living in the material world.

Text 30] Maharaja Ptthu 's Going Back Home 1013
PURPORT
TEXT 30 "4f.(f•�•(tsm �: � li•N"Et¥4: , � � �R64C:I¥4�rot� � II� o II itthambhutiinubhiivo 'sau prthu� sa bhagavattama�

itthambhiita-thus; anubhiiva�-very great, powerful; asau-that; prthu�-King Prthu; sa�-he;bhagavattama�-the best among the lords; kl"rtitam-described; tasya-his; caritam-character; uddiima-very great; c aritasya-one whopossesses suchqualities;te-to you.

TRANSLATION

Maitreya continued: The greatest of all devotees, Maharaja Pflhu, was very powerful, and his character was liberal, magnificent and magnanimous. Thus I have described him to you as far as possible.

PURPORT

In this verse the word bhagavattama� is very significant, for the word bhagavat is used especiallyto referto the SupremePersonalityof Godhead, as the word bhagaviin (the Supreme Personality of Godhead) is derived from the word bhagavat. Sometimes, however, we see that the word bhagavlin is used for great personalities like Lord Brahma, Lord Siva and Niirada Muni. This is the case with Prthu Maharaja, who is described here asthe best of the bhagaviins, or the best of the lords. A person can be so addressed only if he is a great personality who exhibits extraordinary and uncommon features, or who attains the greatest goal after his disappearance, or who knows the difference between knowledge and ignorance. In other words,the word bhagaviin should not be used for ordinary persons.

TEXT 31

'I

��ill�"'��tliA

yaidarhsu-mahatpur.yarh

sraddhayiivahita�pa,thet sriivayecchrr.uyiidviipi

saprtho�padavl"miyiit

ya�-anyone; idam-this ; su-mahat-very great; pu!lyam-pious; sraddhayii- with great faith; avahita�-with great attention; pathetreads; sriivayet-explains; sr r.uyiit-hears ; vii- or; api-certainly; sa�-that person; prtho�-of King ptthu; padav'i'm-situation;iyiit-attains.

1014 Srimad-Bhagavatam k""irtitarhtasyacaritam uddiima-caritasyate [Canto 4, Ch. 23
� t\'lC�fRi � I
� �:q((4\f1Ni<( ����H

Any person who describes the great characteristics of King P�thu with faith and determination-whether he reads or hears of them himself or helps others to hear of them-is certain to attain the very planet whichMaharaja P�thu attained. In other words, such a person also returns home to the Vaikui;t�ha planets, back to Godhead.

PURPORT

In the execution of devotional service, sravar-arh kirtanarh vi�r-o� is especially stressed. This means that bhakti, or devotional service, begins by hearing and chanting about Vi�J;lU. When we speak of Vi�I').U, we also refer to that which relates to Vi�J;lU. In the Siva Purar-a, Lord Siva recommends Vi�I).U worship to be the topmost worship, and better than Vi�I;tU worshipis worship of the Vai�I).ava or anything thatis related to Vi�l').u.The fact is explained herein that hearing and chanting about a Vai�I;tava is as good as hearing and chanting about Vi�I;tu, for Maitreya has explained that anyone who hears about Prthu Maharaja with attention also attains the planet which Maharaja Prthu attained. There is no duality between Vi�l').u and the Vai�I).ava,andthis is called advaya-jiiiina. A Vai�I;tava is asimportant as Vi�Q.u, and therefore Srila Visvanatha Cakravarti Thakura wrote in his Gurv-a§.taka:

siik§iid-dharitvena samasta-siistrair uktas tathii bhiivyata eva sadbh* kintu prabhor yaft priya eva tasya vande guroft sri-carar-iiravindam

"The spiritual master is honored as much a� the Supreme Lord because he is the most confidential servitor of the Lord. This is acknowledgedin all revealed scriptures and is followed by all authorities. Therefore I offer my respectful obeisances unto the lotus feet of my spiritual master, who is a bona fide representative of Sri Hari."

The supreme Vai�I;tava is the spiritual master, and he is nondifferent from the Supreme Personality of Godhead. It is said that sometimes Lord Caitanya Mahiiprabhu used to chant the names of the gopis. Some of the Lord's students tried to advise Him to chant the name of Kr�11a instead, but upon hearing this Caitanya Mahaprabhu became very angry with His students. The controversy on this subject reached such a point that after this incident Caitanya Mahiiprabhu decided to take sannyiisa because He was n<;>t taken very seriously in His grhastha-iisrama. The point is that since Sri Caitanya Mahaprabhu chanted the names of the gopis, worship of the gopis or the devotees of the Lord is as good as devotional service

Text 31] Maharaja �thu's Going Back Home 1015
TRANSLATION

rendered directly to the Lord. It is also stated by the Lord Himself that devotional service to His devotees is better than service offered directly to Him. Sometimes the sahajiyii class of devotees are only interested in Kt"�qa'spersonalpastimestotheexclusionoftheactivitiesofthedevotees. This type of devotee is not onaveryhighlevel;onewhoseesthedevotee andtheLordonthesamelevelhasfurtherprogressed.

TEXT 32

;rmuft ill�if'�((ft �ij�tiJ\qftt: I m:qOo{�:$Pf�JQ'ij'«flfiNI(I��I

brahmarto brahma-varcasv""i rajanyo jagat""i-pati� ooisya� pa,than vit-pat* syac chudra� sattamatiim iyiit

briihmarta�-the brahmat)as; brahma-varcasvi-one who has attained the power of spiritual success; riijanya�-the royalorder; jagati-pat*-the king of the world; vaisya�-the mercantile class of men; pathan-by reading; vit-patifl-becomes master of the animals; syiit-becomes; siidra�-the laborer class of men; sattamatiim-the position of a great devotee; iyiit-attains.

TRANSLATION

If one hears of the characteristics of Prthu Maharaja and is a brahmat;ta, he becomes perfectly qualified with brahminical powers; if he is a k�atriya, he becomes a king of the world; if he is a vaisya, he becomes a master of other vaisyas and many animals; and if he is a sudra, he becomes the topmost devotee.

PURPORT.

In Srimad-Bhiigavatam it is recommended that one should become a devotee regardless of one's condition. Whether one is without desire (akiima), or with desire (sakiima), or whether one desires liberation (mok§a-kiima), he is advised to worship the Supreme Lord andexecute devotional service untoHim. Bysodoing,oneattainsallperfectioninany field of life. The process of devotional service-especially hearing and chanting-is so powerful that it can bring a person to the perfectional stage.Inthisverse briihmartas, k§atriyas, vaisyas and sudras arementioned, but here it should be understood that that reference is to the briihmarta

1016 Srimad-Bhagavatam [Canto 4, Ch. 23

who is born in a brahminical family, the k§atriya who is born in a k§atriya family. the vaisya who is born in a vaiSya family and the sudra in a sudra family. But whether one is a briihmar-a, k§atriya, vaisya or sudra, he can attain perfection simply by hearing and chanting.

To take birth in a family of brahmar-as is not the ultimate finishing touch; one must have the power of a brahmar-a, which is called brahmatejas. Similarly, taking birth in a royal family is not the all in all; one must possess the power to rule the world. Similarly, taking birth as a vaisya is not all; one must possess hundreds or thousands of animals (specifically cows) and rule over other vaiSyas as Nanda Maharaja did in Vrndavana. Nanda Maharaja was a vaisya who possessed 900,000 cows and ruled over many cowherd men and boys. A person who is born in a sudra family can become greater than a brahmar-a simply by accepting devotional service and giving aural reception to the pastimes of the Lord and His devotees.

TEXT 33

fSr:

�: ij311it<tit

tri� krtva idam iikarr-ya naro nary athavadrta apraja� su-prajatamo nirdhano dhanavattama�

II��II

tr*-thrice; krtvaQ.-repeating ; idam-this; akarr-ya-hearing; nara/;!man; nan-woman; athavii-or; iidrtii-in great respect; apraja�-one who has no children;su-prajatama�-surrounded by many children; nirdhana�without any money; dhanavat-rich; tama�-the greatest.

TRANSLATION

It doesn't matter whether one is a man or woman. Anyone who, with great respect, hears this narration of Maharaja Prthu, will become the father of many children if he is without children, and will become the richest of men if he is without money.

PURPORT

Materialistic persons who are very fond of money and great families worship different demigods to attain their desires, especially Goddess Durga, Lord Siva and Lord Brahma. Such materialistic persons are called

Text 33) Maharaja P�thu's Going Back Home 1017
� (i('ll� � •U+ti41SSWI I
�
'4Wfi4'(1'1:

sry-aisvarya-prajepsava[l.. Sn means beauty, aisvarya means riches, prafo means chil�ren and ipsava[l. means desiring. As described in the Second Canto of Snmad-Bhiigavatam, one has to worship various demigods for different types of benedictions. However, here it is indicated that simply by hearing of the life and character of Maharaja Prthu, one can have both riches and children in enormous quantities. One simply has to read and understand the history, the life and activities of Prthu Maharaja. It is advised that one read them at least three times. Those who are materially afflicted will so benefit by hearing of the Supreme Lord and His devotees that they need not go to any demigod. The word su-prajatama[l. (surrounded by many children) is very significant in this verse, for one may have many children but may not have any qualified children. Here, however, it is stated (su-prajatama[l.) that all the children thus attained would be qualified in education, wealth, beauty and strength-everyth�ng complete.

TEXT 34

31YU!4f\�:

aspafi{a-kzrtil;t su-yasa murkho bhavati pa[l{iita[l. idarh svasty-ayanarh purhsiim amangalya-niviira[lam

aspa�ta-kirti[l.-unmanifested reputation; su-yasii[l.-very famous; murkha[l.-illiterate; bhavati-becomes; par-{iita[l-learned; idam-this; svasti-ayanam-auspiciousness; purhsiim-of the men; amangalya-inauspiciousness; niviirar-am-prohibiting.

TRANSLATION

Also, one who hears this narration three times will become very reputable if he is not recognized in society, and he will become a great scholar if he is illiterate. In other words, hearing of the narrations of Prthu Maharaja is so auspicious that it drives away all bad luck.

PURPORT

In the material world, everyone wants some profit, some adoration and some reputation. By associating in different ways with the Supreme Personality of Godhead or His devotee, one can very easily become opulent in

1018 Srimad-Bhagavatam [Canto 4, Ch. 23
���: I � ���wi ieliiiitrNfZAI(UI(11�\lll
�

every respect. Even if one is not known or recognized by society, he becomes very famous and important if he takes to devotional service and preaching. As far as education is concerned, one can be�omerecognized in society as a great learned scholar simply by hearing Srimad-Bhagavatam and Bhagavad-gitii, wherein the pastimes of the Lord and His devotees are described.This materialworld is full of dangersat every step,but a devotee has no fear because devotional service is so auspicious that it automatically counteracts all kinds of bad luck. Since hearing about Prthu Maharaja is one of the items of devotional service (srava[!am), naturally hearing about him brings all good fortune.

TEXT 35

dhanyam yasasyam iiyufiyam svargyam kali-maliipaham

dharmiirtha-kiima-mok:Sii[!iim samyak siddhim abhipsubhi[l sraddhayaitad anusriivyam catur[!iim kiira[!am param

dhanyam-the source of riches; yasasyam-the source of reputation; iiyu�yam-the source of an increased span of life; svargyam-the source of elevation to the heavenly planets; kali-of the age of Kali; mala-apahamdecreasing the contamination; dharma-religion;artha-economic development; kama-sense gratification; mok�ii[!iim-of liberation; samyak-completely; siddhim- perfection; abhipsubh*-by those desiring; sraddhayawith great respect; etat-this narration; anusravyam-must one hear; catur[Lcim-of the four; kcira[Lam-cause; param-ultimate.

TRANSLATION

By hearing the narration of Prthu Maharaja, one can become great, increase his duration of life, gain promotion to the heavenly planets and counteract the contaminations of this age of Kali. In addition, one can promote the causes of religion, economic development, sense gratification and liberation. Therefore from all sides it is advisable for a materialistic person who is interested in such things to read and hear the narrations of the life and character of Prthu Maharaja.

Text 35) Maharaja Prthu's Going Back Home 1019
����¥tl90af�4ifa¥ttJSN(( I I �· � 'R(11�'-\11

PURPORT

By reading and hearing the narrations of the life and character of P�thu Maharaja, one naturally becomes a devotee, and as soon as one becomes a devotee, his material desires automatically become fulfilled. Therefore it is recommended in Srl:mad-Bhiigavatam: akiimab- sarva-kiimo vii mok�a-kiima udiira-dhi/:t/ tivrer-a bhakti-yogena yajeta puru�am param (Bhiig. 2.3.10). It is recommended that if a person wants to return home, back to Godhead, or wants to become a pure devotee (akiima), or wants some material prosperity (sakiima or sarva-kiima), or wants to merge into the existence of the SupremeBrahmaneffulgence (mok�a-kiima), he is recommended totake to thepathofdevotionalserviceandhearandchantof Lord Vi�r;tu or of His devotee. This is the sum and substance of all Vedic literatures. Vedais ca sarvair aham eva vedyo (Bg. 15.15). The purpose of Vedic knowledge is to understand Kt�I}a and His devotees. Whenever we speak of Kr�qa, we refer to His devotees also, for He is not alone. He is never nirvise�a or siinya, without variety or zero. Kr�qa is full of variety, and as soon as Kr�qa is present, there cannot be any question of void.

vijayabhimukho riijii

srutvaitad abhiyiiti yiin balirit tasmai haranty agre riijiinab- prthave yathii

vijaya-abhimukhab--one who is about to start for victory; nijii-king; srutvii-hearing; etat-this; abhiyiiti-starts; yiin-on the chariot; balimtaxes; tasmai-unto him; haranti-present; agre-before; riijiina!t-other kings;prthave-unto King l>fthu;yathii-as it was done.

TRANSLATION

If a king, who is desirous of attaining victory and ruling power, chants the narration of Prthu Maharaja three times before going forth on his chariot, all subordinate kings will automatically render all kinds of taxes unto him-as they rendered them unto Maharaja Prthu-simply upon his order.

1020 Srimad-Bhagavatam [Canto 4, Ch_ 23

Since a k�atriya king naturally desires to rule the world, he wishes to make all other kings subordinate to him. This was also the position many years ago when Prthu Maharaja was ruling over the earth. At that time he wasthe only emperor on this planet. Even five thousand years ago, Maharaja Yudhi��hira and Maharaja Parik�it were the sole emperors of this planet. Sometimes the subordinate kings rebelled, and it was necessary for the emperor to go and chastise them. This process of chanting the narrations of the life and character- of Pfthu Maharaja is recommended for conquering kings if they want to fulfill their desire to rule the world.

TEXT 37

muktanya-sango bhagavaty amaliirh bhaktim udvahan vainyasya caritarh pu[lyarh srrtuyac chravayet pa,thet

mukta-anya-sanga�- being freed from all material contamination; bhagavati-unto the Supreme Personality of Godhead; amalam-unalloyed; bhaktim-devotional service; udvahan- carrying out; vainyasya-of the son of Maharaja Vena;caritam-character;pur-yam-pious;srrt uyat-must hear; sravayet-must induce others to hear;pathet-and go on reading.

TRANSLATION

A pure devotee who is executing the different processes of devotional service may be situated in the transcendental position, being completely absorbed in Kt�IJ.a consciousness, but even he, while discharging devotional service, must hear, read and induce others to hear about the character and life of Prthu Maharaja.

PURPORT

There is a type of neophyte devotee who is very anxious to hear about the pastimes of the Lord, especially the nisa-lila chapters in SrimadBhiigavatam. Such a devotee should know by this instruction that the pastimes of Pfthu Maharaja are nondifferent from the pastimes of the Supreme Personality of Godhead. An ideal king, Pfthu Maharaja exhibited

Text 37] Maharaja Prthu's Going Back Home 1021
PURPORT
�6� +t•l��i4ef +tfitiiR( I
�
sti!J441-otliJ�€'1ad\"�""
��
�

all talents in showing how to rule the citizens, how to educate them, how to develop the state economically, how to fight enemies, how to perform great sacrifices (yajiias ), etc. Thus it is recommended for the sahajiya, or the neophyte devotee,to hear, chant and get others to hear about the activities of J>tthu Maharaja, even though one may think himself to be in the transcendental position of advanced devotional service.

TEXT 38

�:q*fl�ifltf� 44lfl41(1<=i'4f(q4ii(I

�'664\kt¥4�

micitrav'iryiibhihitam

mahan-miihiitmya-sucakam asmin krtam atimartyam

piirthav'im gatim iipnuyiit

vaicitrav'irya-0 son of Vicitravirya (Vidura); abhihitam-explained ; mahat-great; miihiitmya- greatness; sucakam-awakening ; asmin-in this; krtam-performed; atimartyam-uncommon; piirthav'im-in connection with Prthu Maharaja; gatim-advancement, destination; iipnuyiit-one should achieve.

TRANSLATION

The great sage Maitreya continued: My dear Vidura, I have as far as possible spoken the narrations about Prthu Maharaja, which enrich one's devotional attitude. Whoever takes advantage of these benefits also goes back home, back to Godhead, like Maharaja Ptthu.

PURPORT

The word sriivayet, mentioned in a previous verse, indicates that one should not only read for himself, but should also induce others to read and hear. That is called preaching. Caitanya Mahaprabhu recommended this practice: yare dekha, tare kaha 'kr�TJa'-upadesa (Cc. Madhya 7.128). "Whomever you meet, simplytalk with him about the instructions given by Kr�tJ.a or tell him of narrations about l<[�p.a." Prthu Maharaja's history of devotional service is as potent as narrations about the activities of the Supreme Personality of Godhead. One should not make distinctions between the pastimes of the Lord and the activities of Prthu Maharaja, and whenever it is possible a devotee should attempt to induce others to hear about Prthu Maha6ija. One should not only read of his pastimes for one's

1022 Srimad-Bhagavatam [Canto 4, Ch. 23
�
qp.{cff•rRt44tta41(II��II

own benefit but should induce others to read and hear about them also. In this way everyone can be benefited.

TEXT 39

�(tttf4(+ti«UI

anudinam idam iidare[Ul srrwan prthu-caritarh prathayan vimukta-sangal].

bhagavati bhava-sindhu-pota-piide sa ca nipu[!iim labhate ratim manu§ya�

anudinam-day after day; idam-this; iidare�a - with great respect; Sf[lOOn-hearing; prthu-caritam-the narration of Prthu Maharaja; prathayan-chanting; vimukta- liberated; sanga� -association; bhagavatiunto the Supreme Personality of Godhead; bhava-sindhu-the ocean of nescience; pota-the boat; pade-whose lotus feet; sa� - he; ca-also; nipu�am-complete; labhate-achieves; ratim-attachment; manu§ya�-the person.

TRANSLATION

Whoever, with great reverence and adoration, regularly reads, chants and describes the history of Maharaja Prthu's activities will certainly increase unflinching faith and attraction for the lotus feet of the Lord. The Lord's lotus feet are the boat by which one can cross the ocean of nescience.

PURPORT

The word bhava-sindhu-pota-pade is significant in this verse. The lotus feet of the Lord are known as mahat-padam; this means that the total source of material existence rests on the lotus feet of the Lord. As stated in Bhagavad-gita (Bg. 10.8), aharit sarvasya prabhava[l.: everything is emanating from Him. This cosmic manifestation, which is compared to an ocean of nescience, is also resting on the lotus feet of the Lord. As such, this great ocean of nescience is minimized by a person who is a pure devotee. One who has taken shelter of the lotus feet of the Lord need not cross over the ocean because he has already crossed it by virtue of his position at the Lord's lotus feet. By hearing and chanting of the glories

Text 39] Maharaja Prthu's Going Back Home 1023
� 'l� �
�� ��6ql\ �
.q:l
� ����:����II

of the Lord or the Lord's devotee, one can become firmly fixed in the service of the lotus feet of the Lord. This position can also be achieved very easily by narrating the history of the life of Prthu Maharaja regularly every day. The word vimukta-sanga{l. is also significant in this connection. Because we associate with the three qualities of material nature, our position in this material world is full of dangers, but when we engage in the devotional service of the Lord by the process of sraVa[lam and kirtanam, we immediately become vimukta-sanga, or liberated.

Thus end the Bhaktivedanta purports of Fourth Canto, Twenty-third Chapter, of the Srimad-Bhagavatam, entitled "Mahanija Prthu's Going Back Home."

1024 Srimad-Bhagavatam [Canto 4, Ch. 23

maitreya[l. uvtica- Maitreya continued to speak; vijittisva[l.-of the name Vijitasva; adhirtijti-the emperor; tisit-became; prthu-putra�-the son of Maharaja "Pfthu; prthu-sravti�-of great activities; yaviyobhyafl - unto the younger brothers; adadtit-offered; kti§!hti�-different directions; bhratrbhya�-unto the brothers; bh rtitr-vatsala�-very affectionate to the brothers.

TRANSLATION

The great sage Maitreya continued: Vijitasva, the eldest son of Maharaja J>rthu, who had a reputation like his father, became emperor and gave his younger brothersdifferent directions of the world to govern, forhe was very affectionate toward his brothers.

PURPORT

After describing the life and character of Maharaja Prthu in the previous chapter, the great sage Maitreya began to speak about the sons and grandsons in the genealogical line of the Prthu dynasty. After the death of Maharaja Prthu, his eldest son, Vijitasva, became emperor of the world.

�q�
I 444\��si(l(k�lm�+lir�Rtl � 11
CHAPTER TWENTY-FOUR Chanting thesong sungbyLordSiva TEXT l
�.n�s��:�:
maitreya uvtica vijittisvo 'dhirtijtisit prthu-putra� prthu-sravti� yaviyobhyo 'dadtit kti§thti bhrtitrbhyo bhratr-vatsalafl.
1025

King Vijitiisva was very affectionate toward his younger brothers, and therefore he wanted them to rule different directions of the world. From time immemorial the eldest son generally becomesking after the death of thepreviousking. Whenthe PiiJ;�gavas ruled theearth, Maharaja Yudhi��hira, the eldest son of King Piil)gu, became emperor, and his younger brothers assisted him. Similarly, King Vijitasva's younger brothers were appointed to govern the different directionsof the world.

TEXT2

haryak§ayadisat pracirh dhiimrakesaya dak§i'[lam pratic"irh vrka-sanijnlf_ya turyarh dravi[!ase vibhuft

haryak§aya-unto Haryak�; adisat-delivered; priicim-eastern; dhiimrakesaya- unto Dhumrakesa; dak§i'[lam-the southern side; pratic im- the western side; vrka-sarhjiiaya- unto his brother whose name was Vrka; turyam-the northern side; dravi[!ase- unto another brother of his named DraviQ.a; vibhuft-the master.

TRANSLATION

Maharaja Vijitasva offered the eastern part of the world to his brother Hary�a, the southern part to Dhfunrakesa, the western part to Vrka, and the northern part to Dravil)a.

3lq€tf"'l�'il� ftmf�� ijij++t\1�II � II

antardhana-gatirh sakriil

labdhvantardhana-sarhjiiitaft

apatya-trayam adhatta

sikha[!!iinyarh su-sammatam

1026 Srimad-Bhagavatam [Canto 4, Ch. 24
tlf����stt;ff 't{iltftl� �ftlum(I � t�� {!ttl
"�ot� fiti: II � II
TEXT 3 �� �stltes���i(Q"<t: I

antardhana-of disappearance; gatim-achievement; sakrat-from King Indra; labdhva-getting; antardhana-of the name; samjiiitafi,-so nomi':1-ated; apatya-children; trayam-three; adhatta-begot; sikhar!finyam-in Sikhal)ginl, his wife; su-sammatam-approved by everyone.

TRANSLATION

Formerly, Maharaja Vijitasva pleased the King of heaven, Indra, and from him received the title Antardhiina. His wife's name was Sikhru;t«;fini, and by her he begot three good sons.

PURPORT

Maharaja Vijitasva was known as Antardhana, which means "disappearance." He received this title from Indra, and it refers to the time when Indra stole Maharaja Ptthu's horse from the sacrificial arena. Indra was not visible to others when he was stealing the horse, but Maharaja Prthu's son, Vijitasva, could see him. Yet despite his knowing that Indra was taking away his father's horse, he did not attack him. This indicates that Maharaja Vijitasva respected the right persons. Although Indra was stealing the horse from his father, Vijitasva knew perfectly well that Indra was not an ordinary thief. Since Indra was a great and powerful demigod and servant of the Supreme Personality of Godhead, Vijitasva purposefully excusedhimdue to sentiment only, even though Indra was acting wrongly. Thus Indra became very pleased with Vijitasva at that time. The demigods have the great mystic power of being able to appear and disappear according to their will, and since Indra was very pleased with Vijitasva, he bestowed this mystic power upon him. Thus Vijitasva became known as Antardhana.

TEXT4

'ftCAi: l'fc{llR� W':qft�w.n Ffl

Clfim�Jiql��qosu: qy.,.,rn JRn: 11 \l 11 pavakafi. pavamanas ca sucirityagnayafi. pura vasi§tha-sapadutpannafi. punar yoga-gatimgatafi.

piivaka{l-of the name Pavaka; pavamiina.h-of the name Pavamiina; caalso; suci{l-of the name Suci; iti-thus; agnaya{l-the fire-gods; pura-

Text4]
1027
Chanting the Song Sung by Lord Siva

formerly; vasi�tha- the great sage Vasi��ha; sapat-by being cursed; utpanna� -now born as such; puna� -again; yoga-gatim-the destination of mystic yoga practice; gata� -attained .

TRANSLATION

The three sons of Maharaja Antardhana were named Pavaka, Pavamana and Suci. Formerly these three personalities were the demigods of fire, but due to the curse of the great sage Vasi��ha, they became the sons of Maharaja Antardhana. As such, they were as powerful as the fire-gods, and they attained the destination of mystic yoga power, being again situated as the demigods of fire.

PURPORT

In Bhagavad-gitii it is stated (Bg. 6.41-43) that one who falls down from yoga practice is elevated to the heavenly planets, and after enjoying the material facilities there he again comes down to the earthly planet and takes birth in a very rich family or a very pious briihmara family. Thus it is to be understood that when demigods fall down, they come to earth as sons of very rich and pious families. In such families, the living entity gets an opportunity to execute Kr�qa consciousness and thereby gain promotion to his desired goal. The sons of Maharaja Antardhana had been the demigods in charge of fire, and they again regained their former position and by mystic power returned to the heavenly planets.

TEXT5

� �

�\'.fi'1¥tN�� I

� ���t �§:1'1� WI �tim;{ II � II

antardhano nabhasvatyam havirdhanam avindata

ya indram asva-hartaram

vidvan api na jaghniviin

antardhanaft-the king of the name Antardhana; nabhasvatyam-unto his wife Nabhasvati; havirdhanam-of the name Havirdhana; avindataobtained; yaft-who; indram-King Indra; asva-hartiiram-who was stealing

1028 Srimad-Bhagavatam [Canto 4, Ch. 24

the horse of his father; vidviin api-although he knew it; na jaghniviin-did not kill.

TRANSLATION

Maharaja Antardhana had another wife named Nabhasvati, and by her he was happy to beget another son named Havirdhina. Since Maharaja Antardhana was very liberal, he did not kill Indra while the demigod was stealing his father's horse at the sacrifice.

PURPORT

It is understood from various scriptures and Puriirws that the King of heaven, Indra, was very expert in stealing and kidnapping. He couldsteal anything without being visible to the proprietor, and he could kidnap anyone's wife without being detected. Once he raped the wife of Gautama Muni by using his disappearing art, and similarly by becoming invisible he stole the horse of Maharaja P�thu. Although in human society such activities are considered abominable, the demigod Indra was not considered to be degraded by them. Although Antardhana could understand that King Indra wa� stealing the horse from his father, he did not kill him, for he knew that if one who is very powerful sometimes commits an abominable act, it should be disregarded. In Bhagavad-gitii it is clearly stated:

api cet suduracaro

bhajate miim ananya-bhiik

siidhur eva sa mantavya[t samyag vyavasito hi sa[!.

"Even if one commits the most abominable actions, if he is engaged in devotional service, he is to be considered saintly because he is properly situated." (Bg. 9.30)

Thus even if a devotee commits an abominable act, he should be considered a siidhu, or a pious man, because of hisunflinching devotion to the Lord. The devotees of the Lord never willingly commit any sinful act, but sometimes they commit something abominable due to their previous habits. Such acts should not be taken very seriously, however, because the devotees of the Lord are very powerful, whether they are on the heavenlyplanets oron thisplanet.If by chancethey commitsomething abominable,it should not be taken into accountbut should be overlooked.

Text 5] Chanting the Song Sung by
Siva 1029
Lord

riijiiiirh vrttim kariidiinadaf1!ia-sulkiidi-diiruf1iim manyamiino dirgha-sattravyiijena visasarja ha

riijiiiim-of the kings; vrttim-source of livelihood; kara-taxes; adanarealization; dap!ia-punishment; sulka-fines; iidi-etc.; diirupiim- which are verysevere; manyamiina{l- thinking like that; dirgha-long; sattra-sacrifice; vyiijena-on the plea; visasarja-gave up; ha-in the past.

TRANSLATION

Whenever Antardhana, the supreme royal power, had to exact taxes, punish his citizens, and fine them severely, he was not willing to do so. Consequently he retired from the execution of such duties and engaged himself in the performance of different sacrifices.

PURPORT

It is clear herein that the king sometimes has to perform duties which are not very desirable just because he is the king. Similarly, Arjuna was not at all willing to fight because fighting or killing one's own kinsmen and family members is not at all desirable. Nonetheless the kpatriyas had to perform such undesirable actions as a matter of duty. Maharaja Antardhana was not very happy while exacting taxes or punishing the citizens for their criminal activities; therefore, on the plea of performing sacrifices, he retired from the royal majestic power at a very early age. TEXT7

tatriipi harhsarh puru§arh

paramiitmiinam iitma-drk

yajarhs tal-lokatiim iipa

kusalena samiidhinii

1030 Srimad-Bhiigavatam [Canto 4, Ch. 24
�!ffl ���G\0��<!qi(��'{
TEXT6
I �r.ft �n� � 8: II � II
mfq � �� tmi���t•, I ��EM1+414 ���W{ �+tTN.lt II \911

tatrapi- despite his engagement; harhsam-one who kills the distress of hiskinsmen; puru§am-untotheSupremePerson; paramatmanam-themost beloved Supersoul; atma-drk-onewhohas seen or acquiredself-realization; yajan-by worshiping; tat-lokatam-achieved the same planet; apaachieved; ku salena-very easily; samadhina-always keeping himself in ecstasy.

TRANSLATION

Although Maharaja Antardhiina was engaged in performing sacrifices, because he was a self-realized soul he very intelligently rendered devotional service to the Lord, ·who eradicates all the fears of His devotees. By thus worshiping the Supreme Lord, Maharaja Antardhiina, rapt in ecstasy, attained His planet very easily.

PURPORT

Sincesacrifices are generally performed by fruitive actors,it is especially mentioned here (tatrapi) that although Maharaja Antardhana was externally engaged in performing sacrifices, his real business was rendering devotional service by hearing and chanting. In other words, he was performing the usual sacrifices by the method of smikirtana-yajna, as recommended herein:

sravartarh kirtanarh vifo[l0/1 smara.nam pada-sevanam arcanarh vandanarh dasyarh sakhyam atma-nivedanam (Bhag. 7.5.23)

Devotional service is called kirtana-yajiia, and by practicing the sankirtana-yajiia, one is very easily elevated to the planet where the Supreme Lord resides. Out of the five kinds of liberations, achieving the same planet where the Lord resides and living with the Lord there is called salokya liberation.

TEXTS

havirdhanad dhavirdhani

vidurasiita §at sutan

barhi§adarh gayarh suklarh

k!§IJ-arh satyarh jitavratam

havirdhanat-from Havirdhiina; havirdhani-the name of the wife of Havirdhiina; vidura-0 Vidura; asiita-gave birth; §at-six; sutan-sons;

Text 8] Chanting the Song Sung by Lord Siva 1031
��;ft f®� ��I �� rri ����'{_II� II

barhi§adam-of the name Barhi�at; gayam-of the name Gaya; suklamof the name Sukla; k[§T)am-of the name Kw).a; satyam-of the name Satya; jitavratam-of the name Jitavrata.

TRANSLATION

Havirdhana, the son of Maharaja Antardhana, had a wife named Havirdhani, who gave birth to six sons named Barhi�at, Gaya, Sukla, Kr�J1.a, Satya and Jitavrata.

TEXT9

-��tR:�:I &41�1�,; f.ttu11� �! :q �II Q..ll

barhi§at su-mahabhiigo hiivirdhiini[l prajapati[l kriya-kiiruJe�u ni§rato yoge§U ca kurudvaha

barhi�at-of the name Barhi�at; su-mahiibhiiga[l-very fortunate; hiivirdhiini[l-of the name Havirdhani; prajiipati[l,-the post of Prajapati; kriyiikar{i.e§u-in the matter of fruitive activities; ni§[liita[l,-being merged in; yoge§u-in mystic yoga practices; ca-also; kurudvaha-0 best of the Kurus (Vidura).

TRANSLATION

The great sage Maitreya continued: My dear Vidura, Havirdhiina's very powerful son named Barhi�at was very expert in performing various kinds of fruitive sacrifices, and he was also expert in the practice of mystic yoga. By his great qualifications, he became known as Prajiipati.

PURPORT

In the beginning of the creation there were not many living entities, and consequently the very powerful living entities or demigods were appointed as prajapatis in order to beget children and increase the population. There are many prajiipatis-Brahma, Dak�a and Manu are sometimes known as prajapatis-and Barhi�at, the son of Havirdhiina, became one of them.

1032 Srimad-Bhagavatam [Canto 4, Ch. 24
� ��� Nij��H I su�hui: ���� C�ij��� 11 �f.II
TEXT 10

yasyedarh

deva-yajanam anuyajnarh vitanvatafi. pracinagraifi. kusair asid iistrtarh vasudhii-talam

yasya- whose; idam- this; deva-yajanam- satisfying the demigods by sacrifices; anuyajnam-continually sacrificing; vitanvatafi.-executing; pracina-agraifi.-keeping the kusa grass facing towards the eastern side; kusaifi.-the kusa grass; asit-remairied; iistrtam-scattered; vasudha-talamall over the surface of the globe.

TRANSLA TION

Maharaja Barhiljat executed many sacrifices all over the world. He scattered kusa grasses and kept the tops of the grasses pointed eastward.

PURPORT

As stated in the previous verse (kriya-ka[!{ie§u ni§T]fitaM, Maharaja Barhi�at dived very deeply into the fruitive activities of sacrifice. This means that as soon as he finished one yajna in one· place, he began performinganother yajna inthe immediate vicinity. At the presentmoment there is a similar need to perform sankirtana-yajna all over the world. The Krilf).a consciousness movement has started performing sankirtana-yajna in different places, and it has been experienced that wherever sankirtanayajna is performed, many thousands of people gather and take part in it. Imperceptible auspiciousness achieved in this connection should be continued all over the world. The members of the K.r�pa consciousnessmovement should perform sankirtana-yajiia one after another, so much so that all the people of the world will either jokingly or seriously chant Hare K.r�Qa, Hare K.r�Qa, K.r�Qa K.r�Qa, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare, and thus they will derive the benefit of cleansing the heart. The holy name of the Lord (Harer nama) is so powerful that whether it is chanted jokingly or seriously the effect of vibrating this transcendental sound will be equally distributed. It is not possible at the present moment to perform repeated yajnas as Maharaja Barhi�at performed,but it is within our means to perform sankirtana-yajfia, which does not cost anything. One can sit down anywhere and chant Hare Kr�Qa, Hare Kr�Qa, Kr�Qa Kn:>pa, Hare Hare/ Hare Rii.ma, Hare Rama, Rama Rama, Hare Hare. If the surface of the globe is overflooded with the chanting of the Hare Kr�Qa mantra, the people of the world will be very, very happy.

Text 10] Chanting the Song Sung by Lord Siva
1033

stimudrirh devadevokttim upayeme satadrutim ytirh vik§ya ctiru-sarvtingirh kisorirh su§thv-alankrtam parikramantim udvtihe cakame 'gni� sukim iva

stimudrim-unto the daughter of the ocean; devadeva-ukttim-being advised by the supreme demigod, Lord Brahma; upayeme- married; satadrutim-of the name Satadruti;ytim-whom; Vik§ya- seeing; caru-very attractive; sarva-angim-all the features of the body; kiso rim-youthful; su§thu-sufficiently; alank_rttim-decorated with ornaments; parikramanti"m-circumambulating; udviihe-in the marriage ceremony; cakamebecame· attracted; agn* - the fire-god;sukim-unto Suki;iva-like.

TRANSLATION

Maharaja Barhi�at-henceforward known as Pracinabarhi-was ordered by the supreme demigod Lord Brahma to marry the daughter of the ocean named Satadruti. Her bodily features were completely beautiful, and she was very young. She was decorated with the proper garments, and when she came into the marriage arena and began circumambulating it, the firegod Agni became so attracted to her that he desired her company, exactly as he had formerly desired to enjoy Suki.

PURPORT

In this verse the word su§thv-alankrtam is significant. According to the Vedic system, when a girl is married, she is very profusely and gorgeously decorated with costly saris and jewelry, and during the marriage ceremony the bride circumambulates the bridegroom seven times. After this, the bridegroom and bride look at one another and become attracted for life. When the bridegroom finds the bride verybeautiful, the attraction between them immediately becomes very strongly fixed. As stated in SrimadBhtigavatam, men and women are naturally attracted to one another, and when they are united by marriage that attraction becomes very strong. Being so strongly attracted, the bridegroom attempts to set up a nice homestead and eventually a good field for producing grains. Then children come,

1034 Srimad-Bhagavatam
[Canto 4, Ch. 24

then friends and then wealth. In this way the male becomes more and more entangled in the material conceptions of life, and he begins to think, "This is mine," and "It is I who am acting." In this way the illusion of material existence is perpetuated.

The words sukim iva are �lso significant, for the fire-god Agni became attracted by the beauty of Satadruti while she was circumambulating the bridegroom Pracinabarhi, just as he had previously been attracted to the beauty of Suki, the wife of Saptar�i. When the fire-god had been presentlong ago at the assembly of Saptar�i, he was attracted by the beauty of SulO when she was circumambulating in the same way. Agni's wife, named Svaha, took the form of Suki and enjoyed sex life with Agni. Not only the fire-god Agni but the heavenly god lndra and sometimes even Lord Brahma and Lord Siva-all very highly situated demigods-are subject to being attracted by sex at any time. The sex drive is so strong in the living entities that the whole material world is running on sex attraction only, and it is due to sex attraction that one remains in the material world and is obliged to accept different types of bodies. The attraction of sex life is more clearly explained in the next verse.

TEXT 12

�af.tfutW1i1(in: 1

�:

vibudhasura-gandharvamuni-siddha-naroragalt

vijitalt suryaya dikfiu

kvarwyantyaiva niipurai[l

vibudha-learned; asura-the demons; gandharva-the denizens of Gandharvaloka; muni-great sages; siddha-the denizens of Siddhaloka; nara-the inhabitants of the earthly planets;uragii!J,-denizens of Nagaloka; vijitii!J,-captivated; suryaya-by the new bride; dik�u-in all directions; kva!Wyantyii-tinkling; eva-only;nupurai�-by her ankle bells.

TRANSLATION

While Satadruti was thus being married, the demons, the denizens of Gandharvaloka, the greatsages, and the denizens of Siddhaloka, the earthly plan�ts and Nagaloka, although highly exalted, were all captivated by the tinkling of her ankle bells.

PURPORT

Generally a woman becomes more beautiful when, after an early marriage, she gives birth to a child. To give birth to a child is the natural func-

Text 12] Chanting the Song Sung by Lord Siva 1035
���..,·��4,��: ������

tion of a woman,and therefore awomanbecomes more and more beautiful as she gives birth to one child after another. In the case of Satadruti, however, she was so beautiful that she attracted the whole universe at her marriage ceremony. Indeed, she attracted all the learned and exalted demigods simply by the tinkling of her ankle bells. This indicates that all the demigods wanted to see her beauty completely, but they were not able to see it because she was fully dressed and covered with ornaments. Since they could only see the feet of Satadruti, they became attracted by her ankle bells, which tinkled as she walked. In other words, the demigods became captivated by her simply by hearing the tinkling of her ankle bells. They did not have to see her complete beauty. It is sometimes understood that a person becomes lusty just by hearing the tinkling of bangles on the hands ofwomen, or the tinkling of ankle bells, orjust by seeing a woman's sari. Thus it is concluded that woman is the complete representation of miiyii. Although Visvamitra Muni was engaged in practicing mystic yoga with closed eyes, his transcendental meditation was broken when he heard the tinkling of bangles on the hands of Menaka. In this way Visvamitra Muni became a victim of Menaka and fathered a child who is universally celebrated as Sakuntala. The conclusion is that no one can save himself from the attraction of woman, even though he be an exalted demigod or an inhabitant of the higher planets. Only a devotee of the Lord, who is attracted by K.f�;r].a, can escape the lures of woman. Once one is attracted by Kr�l).a, the illusory energy of the world cannot attract him.

TEXT 13 .

�: 'ijif41 � I

t!iN•UqEHU: � ��n �:

priic"inabarhi�afl putriifl 5atadrutyiim dasiibhavan

tulya-niima-vratiifl sarve dharma-sniitiifl pracetasafl

II��II

priicinabarh4afJ.-of King Pracinabarhi; putrli.�-sons; satadrutyiim-in the womb of Satadruti; daia-ten; abhavan-became manifest; tulyaequally; nama-name; vratii�- vow; sarve- all; dharma-religiosity; sniitii�completelymergedin; pracetasa�-al1 ofthem being designated as Pracetas.

TRANSLATION

King Pracinabarhi begot ten children in the womb of Satadruti, and all of them were equally endowed with religiosity, and all of them were known as the Pracetas.

1036 Srimad-Bhagavatam [Canto 4, Ch. 24

The word dharma-sniitii� is significant, for the ten children were all merged in the practice of religion. In addition, they possessed all good qualities. One is supposed to be perfect when one is perfectly religious, perfect in the execution of one's vows to render devotional service, perfect in knowledge, perfect in good behavior and so on. All the Pracetas were on the same level of perfection.

TEXT 14

ftms�:

sti511Qif

�ijit�Q«''IM

�sulit¥tiN'-l

pitriid�.tii� prajii-sarge tapase 'rrw-vam iiviSan dasa-var�a-sahasriiri tapasiircarits tapas-patim

I

pitrii-bythe father; adip_tii{l.- being ordered by; praja-sarge-in the matter of begetting children; tapa se - for executing austerity; arravam-in the ocean; aviSan-entered; dasa-var�a-ten years; sahasriiri-such thousands; tapasii-by their austerity; iircan-worshiped; tapa�-of austerity; patimthe master.

TRANSLATION

When all these Pracetas were ordered by their father to marry and beget children, they all entered the ocean and practiced austerities and penances for ten thousand years. Thus they worshiped the master of all austerity, the Supreme Personality of Godhead.

PURPORT

Sometimes great sages and ascetics enter the Himalayan Mountains in order to find seclusion from the turmoil of the world. It appears, however, that all the Pracetas, the sons of Pracinabarhi, entered the depths of the ocean to perform austerity in a secluded place. Since they performed austerities for tenthousand years, this incident took place in the Satya-yuga, when people used to live for a hundred thousand years. It is also significant that by their austerity they worshiped the master of austerity Sri Kp;;J;ta, the Supreme Personality of Godhead. If one wants to perform austerities and penances in order to attain the supreme goal, one must attain the favor of the Supreme Personality of Godhead. If one achieves the favor of the

Text 14] Chanting the Song Sung by Lord Siva 1037
PURPORT
aqmss.,f(ijq�f6(II�VII

Supreme Lord, it is to be understood that he has finished all kinds of austerities and penances and has attained efficiency in their execution. On the other hand, if one does notattainthe perfect stage of devotional service, all austerities and penances actually have no meaning, for without the Supreme Lord no one canattain the highest results derived from performing them. As stated in Bhagavad-gTtii, Lord Sri Kr�J)a is the master of all penances and sacrifices.

bhoktiirarh yapia-tapasiirh sarva-loka-mahesvaram suhrdarh sarva-bhutiiniirh

jiiiitvii miirh siintim rcchati

"The sages, knowing Me as the ultimate purpose of all sacrifices and austerities, the Supreme Lord of all planets and demigods, and the benefactor and well-wisher of all living entities, attain peace from the pangs of material miseries." (Bg. 5.29)

In Snmad-Bhiigavatam it is also stated that even if a person is born in a family of cart�iilas-the lowest birth one can get in human society-he is glorious if he chants the holy names of the Lord, for it is to be understood that by such chanting a devotee definitely proves that he underwent all kinds of austerities in his previous life. By the grace of Lord Caitanya, one who chants the mahii-mantra (Hare Kp�q.a, Hare Kr�q.a, Kr�q.a Kr�q.a, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare) attains the highest perfectional stage which had previously been attained by people who entered the ocean and executed austerities for ten thousand years. In this age of Kali, if a person does not take advantage of chanting the Hare Kr�r:ta mantra, which is offered as a great concession to the fallen human beings of this age, it isto be understood that he will become very much bewildered by the illusory energy of the Lord.

yad u.ktarh pathi dr§tena girisena pras'idatii tad dhyiiyanto japantas ca pujayantas ca sarhyatiift

1038 Srimad-Bhagavatam [Canto 4, Ch_ 24
.TEXT15 � qf\r m ftl�.. 5141((�11 , 6:(*0f144;ffl �fJI '@�W'<ffJI �: 11��11

yat- that; uktam .

-said ; pathi-on the way; dr�tena-while meeting; girisena- by Lord Siva; pras"idatii- being very much satisfied; tat- that; dhyayanta[l-meditating; japanta[l ca-chanting also; pujayanta[l caworshiping also; samyata[l-with great control.

TRANSLATION

When all the sons of Pracinaharhi left home to execute austerities, they met Lord Siva, who, out of great mercy, instructed them about the Absolute Truth. All the sons of Pracinabarhi meditated upon the instructions, chanting and worshiping them with great care and attention.

PURPORT

Itis clear that to perform austerities or penances, or,forthat matter,any form of devotional service, one has to be guided by a spiritual master. Here it is clearly stated that the ten sons of Maharaja Pracinabarhi were favored by an appearance of Lord Siva, who, out of great kindness, gave them instructions regarding the execution of austerities. Lord Siva actually became the spiritual master of the ten sons, and in turn his disciples took his words so seriously that simply by meditating upon his instructions (dhyiiyanta�) theybecame perfect. This is the secret of success. Afterbeing initiated and receivingthe orders ofthe spiritual master, the disciple should unhesitatingly think abouttheinstructions or orders of the spiritual master and should not . allow himself to be disturbed by anything else. This is also the verdict of Srila Visvanatha Cakravartl Thakura, who, while explaining a verse of Bhagavad-gita (vyavasayatmika buddhir ekeha kuru-nandana, Bg. 2.41), points out that the order of the spiritual master is the life substance of the disciple. The disciple shouldn't consider whether he is going back home, back to Godhead; his first business should be to execute the order of his spiritual master. Thus a disciple should always meditate on the order of the spiritual master, and that is perfectional meditation. Not onlyshould he meditate upon that order, but he should find out the means by which he can perfectly worship and execute it.

Text 16] Chanting the Song Sung by Lord Siva 1039
TEXT 16 (ij�� st�c:tei �UJ�s�� (1f11: 1 � �: stlc:t(c:t.U i1SF1 �II��II

Srimad-Bhagavatam

vidura uviica pracetasiim giritrerta yathiiszt pathi sahgamn� yad utiiha hara[l, pritas tan no brahmnn vadiirthavat

vidura[l, uviica-Vidura inquired; pracetasiim-of all the Pracetas; giritrerta-by Lord Siva; yathii-as and as; iiszt-it was; pathi-on the road; sahgamn[l,-meeting; yat-which; utiiha-said; hara[l,-Lord Siva; prita[l,being pleased; tat-that; na[l,-unto us; brahmnn-0 great briihmnf!a; vadaspeak; arthavat-with clear meaning.

TRANSLATION

Vidura asked Maitreya: My dear brahmai:Ia, why did the Pracetas meet LordSivaon the way? Please tell me how themeeting happened, how Lord Siva became very pleased with them, and how he instructed them. Certainly such talks are important, and I wish that you will please be merciful upon me and describe them.

PURPORT

Whenever there are some important talks between a devotee and the Lord or between exalted devotees, one should be very much curious to hear them. At the meeting of Naimi�arai:Iya, where Suta Gosvami spoke Snmnd-Bhiigavatam to all the great sages, Suta Gosvami was also asked about the talks between Maharaja Parik�it and Sukadeva Gosvami, for the sages believed that the talks between Sukadeva Gosvami and Maharaja Parik�it must have been as important as the talks between Lord Kt!!IJ.a and Arjuna. As everyone is still eager to learn the subject of Bhagavad-gl:tii in order to become perfectly enlightened, Vidura was similarly eager to learn from the great sage Maitreya about the talks between Lord Siva and the Pracetas.

TEXT

1040
[Canto 4, Ch. 24
17 �: � milt � �uRunl( I �� � �«''l'lt1+t¥ilf�ll�\9ll sahgamn[l, khalu viprarfie siveneha Sarl:ririim durlabho munayo dadhyur asangiid yam abhl:psitam

sahgama � - association; khalu-certainly; viprar�e- 0 best of the brahmal)as; sivena-along with Lord Siva; iha-in this world; sariril)iimthose who are encagedin material bodies; durlabha.lt-very rare; munaya�great sages; dadhyu�-engaged themselves in meditation; asangat-being detached from anything else;yam-unto whom ; abh'ipsitam-desiring.

TRANSLATION

The great sage Vidwa continued: 0 best of the brahma�;tas, it is very difficult for living entities encaged within this material body to have personal contact with Lord Siva. Even great sages who have no material attachments do not contact him, despite their always being absorbed in meditation to attain his personal contact.

PURPORT

Since Lord Siva does not incarnate himself unless there is some special reason, it is very difficult for an ordinary person to contact him. However, Lord Siva does descend on a special occasion when he is ordered by the Supreme Personality of Godhead. In this regard, it is stated in the Padma Purii�a that Lord Siva appeared as a briihma�a in the age of Kali to preach the Mayavada philosophy, which is nothing but a type of Buddhist philosophy. It is stated in Padma Purafla:

miiyiivadam asac-chastrarh pracchannarh bauddham ucyate mayaiva vihitarh devi kalau brahma'}a-miirtina

Lord Siva, speaking to Parvati Devi, foretold that he would spread the Mayavada philosophy in the guise of a sannyas"ib�ahmal)a just to eradicate Buddhist philosophy. This sannyiis"i was Sr'ipada Sarikaracarya. In order to overc?me tht; effects of Buddhist philosophy and spread Vedanta philosophy, Srlpii.da Sarikarii.cii.rya had tomake somecompromise with the Buddhist philosophy, and as such he preached the philosophy of monism, for it was required at that time. Otherwise there was no need for his preaching Mayavada philosophy. At the present moment there is no need for Mayavada philosophy nor Buddhist philosophy, and Lord Caitanya rejected both of them.This Kr�Qa consciousness movement is spreading the philosophy of Lord Caitanya and rejecting the philosophy of both classes of Mayavada. Strictly speaking, both Buddhist philosophy and Sarikara's philosophy are but different types of Mayavada dealing on the platform of material existence.Neither of these philosophies hasspiritual significance. There is spiritual significance only after one accepts the philosophy of

Text 17] Chanting the Song Sung by Lord Siva 1041

Bhagavad-gi:tii, which culminates in surrendering unto the Supreme PersonalityofGodhead.GenerallypeopleworshipLord Sivaforsome material benefit, and although they cannot see him personally, they nonetheless derivegreat materialprofit byworshipinghim.

TEXT 18

311€+11(1qtsf'tt�@4�ill!h��� I

���:qdij���: 11��11

atmanimo 'piyastvasya

loka-kalpasyaradhase

saktyayuktovicarati

ghorayabhagavanbhava[l

atmarama[l-self-satisfied;api-although heis;ya[l-onewhois;tu-but; asya-this; loka-material world; kalpasya-when manifested; riidhase-for the matter of helping its existence;saktya-potencies;yukta[l-being engaged; vicarati-heacts;ghoraya-verydangerous;bhagavan-His Lordship; bhava[l-Siva.

TRANSLATION

Lord Siva, the most powerful demigod, second only to Lord Vi�1_1u, is self-sufficient. Although he has nothing to aspire for in the material world, for the benefit of those in the material world he is always busily engaged everywhere and is accompanied by his dangerous energies like Goddess Kiili and Goddess Durga.

PURPORT

Lord Siva is known as the greatest devotee of the SupremePersonality of Godhead. He is also known as vaiHwvanarh yatha sambhu[l, the best of all types of Vai�Qavas. Consequently Lord Siva has a Vai�Qava sampradaya, the disciplic succession known as Rudra-sampradaya. .lust as there is a Brahma-sampradiiya coming directly from Lord Brahma, theRudra-sampradiiyacomesdirectlyfrom Lord Siva.AsstatedinSrzmadBhagavatam, Lord Siva is one of the twelve great personalities. This refers to the twelve great authorities who preach God consciousness. The name Sambhu means Lord Siva. His disciplic succession is also known as the Vi�1_1usvami-sampradaya, and the current Vi�Qusviimisampradiiya is also known as the Vallabha-sampradiiya. The current Brahma-sampradiiya is known as the Madhva-Gaw;J.iya-sampradaya. Even though Lord Siva appeared to preach Mayavadaphilosophy, at theendof

1042 Srimad-Bhagavatam [Canto 4, Ch. 24

his pastime in the form of Sankariicarya, he preached the Vai!'pava philosophy: bhaja govindam bhaja govindam bhaja govindam miiljha-mate. Hestressedworshiping Lord Kr�l).a orGovinda threetimesinthis verseand especially warned his followers that they could not possibly achieve deliverance or mukti simply by wordjugglery andgrammaticalpuzzles. If one is actually serious to attain mukti, hemust worship Lord Kr§pa. That is Sripiida Sari.kariicarya's last instruction.

Herein it is mentioned that Lord Siva is always accompanied by his material energy (saktya ghoraya). Material energy-Goddess Durga or Goddess Kali-is always under his control. Goddess Kali and Durga serve him by killing all the asuras or demons. Sometimes Kali becomes so infuriated that she indiscriminately kills allkinds of asuras. There is a popular picture of Goddess Kali in which she wearsa garland composed of the heads of the asuras and holds in her left hand a captured head andinher right hand a great khaljga, or chopper, for killing asuras. Great wars are symbolic representations of Kali's devastation of the asuras and are actuallyconducted bythe GoddessKalr.

snti-sthiti-pralaya-sadhana-saktir eka chliyeva yasya bhuvanani bibharti durgii (Bs. 5.44)

Asuras, however, try to pacify the Goddess Kiili or Durga by worshiping her in material opulence, but when the asuras become too intolerable, Goddess Kiili does not discriminate in killing them wholesale. Asuras do notknowthe secret of the energy<?f Lord Siva,andtheyprefer to worship Goddess Kiili or Durga or Lord Siva for material benefit. Due to their demonic character, they are reluctant to surrender to Lord Kr�qa, as indicated by Bhagavad-gita:

na mam du§krtino miiqhafi. prapadyante naradhamtifl. mayayapahrta-jiiana asuram bhavam tisrita[l. (Bg. 7.15)

Lord Siva'sduty is verydangerous becausehehasto employthe energy of Goddess Kiili (or Durga). In another popular picture the Goddess Kali issometimes seen standing onthe prostrate body of Lord Siva, which indicates that sometimes Lord Sivahas to falldown flatinorder to stop Goddess Kiili from killing the asuras. Since Lord Siva controls thegreat material energy (Goddess Durga), worshipers of Lord Siva attain very opulent positions within this material world. Under Lord Siva's direction, a

Text 18] Chanting the Song Sung by Lord Siva 1043

worshiper of Lord Siva gets all kinds of material facilities. In contrast, a Vai�Q.ava, or worshiper of Lord Vi�Q.U, gradually becomes poorer in material possessionsbecause Lord Vi�Q.U does not trick His devotees into becoming materially entangled by possessions. Lord Vi�Q.U gives His devotees intelligence from within, as stated in Bhagavad-gita:

te�arh satata-yuktanarh

bhajatarh priti-piirvakam

dadami buddhi-yogarh tarh

yena mam upayanti te

"To those who are constantly devoted and worship Me with love, I give. the understanding by which they can come to Me." (Bg. 10.1 0)

Thus Lord Vi�Q.U gives intelligence to His devotee so that the devotee can make progress on the path back home, back to Godhead. Since a devotee has nothing to do with any kind of material possession, he does not come under the control of Goddess Kali or the Goddess Durgii.

Lord Siva is also in charge of the tamo-gurw, or the mode of ignorance inthis material world.Both Lord Brahmii and Lord Siva areincarnations of Lord Vi�I)U, but Lord Brahma is in charge of the creation whereas Lord Siva is in charge of the destruction, which he carries out with the help of his material energy, Goddess Kali or Goddess Durga. Thus in this verse Lord Siva is described as being accompanied by dangerous potencies (saktya ghoraya), and that is the actual position of Lord Siva.

TEXT 19

�5FT i!<fR

�: fqgqifl ftmos� �: I

� �

!fti��N�It(f�: ����II

maitreya uvii.ca

pracetasal;l. pitur vii.kyarh sirasii.dii.ya sii.dhaval;l. diSarh praficirh prayayus tapasy ii.drta-cetasal;l.

maitreyal;l. u vii.ca-the great sage Maitreya continued to speak; pracetasal;l.-all the sons of King Pracinabarhi; pitul;l.-of the father; vii.kyamwords; sirasii.-on the head; adii.ya-accepting; sadhaval;l.-all pious; disam-

1044 Srimad-Bhagavatam [Canto 4, Ch. 24

direction; prat"ic"im-western; prayayu�-went away; tapasi-in austerities; adrta-accepting seriously; cetasa�-in the heart.

TRANSLATION

The great sage Maitreya continued: My dear Vidura, because of their pious nature, all the sons ofPracinabarhi very seriously accepted the words of their father with heart and soul, and with these words on their heads, they went toward the west to execute their father's order.

PURPORT

. In this verse sadhava� (meaning pious or well behaved) is very impor· tant, especially at the present moment. It is derived from the word sadhu. A perfect sadhu is one who is always engaged in the devotional service of the Supreme Personality of Godhead. Priicinabarhi's sons are described as sadhava� because of their complete obedience to their father. The father, king and spiritual master are supposed to be representatives of the Supreme Personality of Godhead, and as such they have to be re· spected as the Supreme Lord. It is the duty of the father, Lhe spiritual master and the king to regulate their subordinates in such a way that they ultimately become fully unalloyed devotees of the Supreme Lord. That is the duty of the superiors, and it is the duty of the subordinates to obey Lheir orders perfectly and in a disciplined way. The word sirasa (on their heads) is also significant, for the Pracetas accepted the orders of their father and carried them on their heads, which means they ac· cepted them in complete surrender.

TEXT 20

sa samudram upa visti'rrwm

apasyan su-mahat sara[!

mahan-mana iva svaccham

prasanna-salilasayam

sa samudram-almost near the ocean;upa-more or less; vistirr;wm-very wide and long; apasyan-they saw; su-mahat-very great; sara[l.-reservoir of water; mahat-great soul; mana[l.-mind; iva-like; su-accham-clear; prasanna-joyful; salila-water;tisayam-taken shelter of.

Text 20] Chanting the Song Sung by Lord Siva 1045
��uf¥4q�q( ij¥4��: I � JRf'5R'lks€SI�tl'( ll�oll

TRANSLATION

While traveling, the Pracetiis happened to see a great reservoir of water which seemed almost as big as the ocean. The water of this lake was so calm and quiet that it seemed like the mind of a great soul, and its inhabitants, the aquatics, appeared to be very peaceful and happy to be under the protection of such a watery reservoir.

PURPORT

The word sasamudra means "near the sea." The reservoir of water was like a bay, for it was not very far from the sea. The word upa, meaning "more or less," is used in many ways, as in the word upapati, which indicates a husband "more or less," that is to say a lover who is acting like a husband. Upa also means greater, smaller or nearer. Considering all these points, the reservoir of water which was seen by the Pracetiis while they were traveling was actually a large bay or lake. And unlike the sea or ocean, which has turbulent waves, this reservoir was very calm and quiet. Indeed, the water was so clear that it seemed like the mind of some great soul.There may be many great souls-jiiiin"is, yog"is and bhaktas, or pure devotees, are also called great souls-but they are very rarely found. One can find many great souls amongst yog"is and jiiiin"is, but a truly great soul, a pure devotee of the Lord who is fully surrendered to the Lord, is very rarely found (sa mahatma sudurlabha[l,, Bg. 7.19). A devotee's mind is always calm, quiet and desireless because he is always anyiibhilii.�itii-sunyam, andhe has no desire other than to serve Kr�t;�a as His personal servant, friend, father, mother or conjugal lover. Due to his association with Knn}a, a devotee is always very calm and cool. It is also significant that within that reservoir all the aquatics were also very calm and quiet. Because the disciples of a devotee have taken shelter of a great man, they become very calm and quiet and are not agitated by the waves of the material world.

This material world is often described as an ocean of nescience. In such an ocean, everything is agitated. The mind of a great devotee is also like an ocean or a very large lake, but there is no agitation. As stated in Bhagavad-g"itii: vyavasiiyiitmikii buddhir ekeha kuru-nandana (Bg. 2.41). Those who are fixed in the service of the Lord are not agitated by anything. It is also stated in Bhagavad-g"ita: yasminsthitona du�khena guru[!li.pi vicalyate (Bg. 6.22). Even if he suffers some reversals in life, a devotee is never agitated. Therefore whoever takes shelter of a great soul or a greatdevotee becomes pacified.In the Caitanya-caritiimrta it is stated:

1046 Srimad-Bhagavatam [Canto 4, Ch. 24

kmJ.a-bhakta-ni�kiima, ataeva 'santa'(Cc.Madhya 19.149). A devotee of Lord Kr�J;la is always peaceful because he has no desire, whereas the yogis, karmis and jnanis have so many desires to fulfill. One may argue that the devotees have desires, for they wish to go home, back to Godhead, but such a desire does not agitate the mind. Although he wishes to go back to Godhead, a devotee is satisfied in any condition of life. Consequently the word mahan-mana� is used in this verse to indicate that the reservoir of water was as calm and quiet as the mind of a great devotee.

TEXT 21

41efil�qel'�qil:;a.lii4(1Eti(f!l.

nila-raktotpalambhojakahliirendivariikaram

harhsa-sarasa-cakriihvakiirart!lava-nikujitam

nita-blue; rakta-red; utpala-lotus; ambhoja-born from the water; kahlara-another kind of lotus; indivara-another kind of lotus; akaramthe mine; hamsa-swans; sarasa-cranes; cakrahva-the ducks of the name; kiira!l!iava-birds of the name; nikujitam-vibrated by their sounds.

TRANSLATION

In that great lake there were different types of lotus flowers. Some of them were bluish, and some of them were red. Some of them grew at night, some in the day, and some, like the indivara lotus flower, in the evening. Combined together, the lotus flowers filled the lake so full that the lake appeared to be a great mine of such flowers. Consequently on the shores there were swans and cranes, cakravaka, kara�«}.ava and other beautiful water birds, standing about.

PURPORT

The word iikaram (mine) is significant in this verse, for the reservoir of water appeared Like a mine from which different types of lotus flowers were produced. Some of the lotus flowers grew during the day, some at night and some in the evening, and accordingly they had different names and different colors. All these flowers were present on that lake, and because the lake was so calm and quiet and filled with lotus flowers, superior

Text 21] Chanting the Song Sung by Lord Siva 1047
I ������

birds, like swans, cakraviikas and kiira[l!iavas, stood on the shores and vibnited their different songs, making the entire scene attractive and beautifuL As there are different types of human beings, according to the association of the three qualities of material nature, there are similarly different types of birds, bees, trees, etc. Everything is divided according to the three qualities of material nature. Birds like swans and cranes, who enjoy clear waters and lotus flowers, are different from crows, who enjoy filthy places. Similarly, there are persons who are controlled by the modes of ignorance and passion and those who are controlled by the mode of goodness. The creation is so varied that there are always varieties found in every society. Thus on the bank of this lake all the superior birds lived to enjoy that atmosphere created by that great reservoir filled with lotus flowers.

TEXT 22

matta-bhramara-sausvaryahnta-roma-latanghripam padma-kosa-rajo dik§u

vik§ipat-pavanotsavam

matta-mad; bhramara-bumblebees; sausvarya-with great humming; hnta-joyfully; roma-hair on the body; lata-creepers; anghri-pam-trees; padma-lotus flower; kosa-whorl; raja{l-saffron; dik§u-in all directions; vik§ipat-throwing away; pavana-air; utsavam-festivaL

TRANSLATION

There were various trees and creepers on all sides of the lake, and there were mad bumblebees humming all about them. The trees appeared to be very jolly due to the sweet humming of the bumblebees, and the saffron, which was contained in the lotus flowers, was being thrown into the air. These all created such an atmosphere that it appeared as though a festival were taking place there.

PURPORT

Trees and creepers are also different types of living beings. When bumblebees come upon trees and creepers to collect honey, certainly such plants become very happy. On such an occasion the wind also takes advantage of

1048 Srimad-Bhagavatam [Canto 4, Ch. 24
I ' � Nfttq�q;ftttt!iff( 11��11
¥4'iW¥4«(h_cc4c:tit¥4e61¥Mqt(

the situation by throwing pollen or saffron contained in the lotus flowers. All this combines with the sweet vibration created by the swans and the calm of the water. The Pracetas consider such a place to he like a con�inuous festiv!ll. From this description it appears that the Pracetas reached Sivaloka, which is supposed to he situated near the Himalayan Mountains.

TEXT 23

tatra gandharvam akarrya divya-marga-manoharam visismyu raja-putras te mrdanga-paravady anu

tatra-there; gandharvam-musical sounds; akar(lya-hearing; divyaheavenly; marga-symmetrical ; manoharam-beautiful; visismyu{l.- they became amazed; raja-putra{l.-all the sons of King Barhi�at; te-all of them; mrdanga- drums; parwva-kettledrums; adi-all together; anu-always.

TRANSLATION

The sons of the king became very much amazed when they heard vibrations from various drums and kettledrums along with other orderly musical sounds pleasing to the ear.

PURPORT

In addition to the various flowers and living entities about the lake,there were also many musical vibrations. The void of the impersonalists, which has no variegatedness, is not at all pleasing compared to such a scene. Actually one has to attain the perfection of sac-cid-ananda, eternity, bliss and knowledge. Because the impersonalists denythese varietiesof creation, they cannot actually enjoy transcende':ltal bliss. The place where the Pracetas arrived was t�e abode of Lo�d Siva. Impersonalists are generally worshipers of Lord Siva, but Lord Siva is never without variety in his abode. Thus wherever one goes, whether to the planet of Lord Siva, Lord Vi�r:tu or Lord Brahma, there is variety to be enjoyed by persons full in knowledge and bliss.

Text 23] Chanting
1049
the Song Sung by Lord Siva
(N f<Olf¥41•i1fitlt(( I �Rt� ��� 'l�fC4UiiJIIQ3����II

tarhy eva sarasas tasman ni§kramantam sahanugam upagiyamanam amarapravaram vibudhanugai�

tapta-hema-nikayabham siti-kar-tham tri-locanam prasada-sumukharh vik§ya prar-emurjata-kautuka�

tarhi-in that very moment; eva-certainly; sarasa�-from the water; tasmat-therefrom; ni§kramantam-coming out; sahanugam-accompanied by great souls;upagiyamanam-glorified bythefollowers; amara-pravaramthe chief of the demigods; vibudha-anugai{t-followed by his associates; tapta-hema-molten gold; nikayabham-bodily features; siti-ka[!tham-blue throat; tri-locanam-with three eyes; prasada-merciful; su-mukhambeautiful face;vik�ya-seeing;pra[!emuft-offeredobeisances;jata-aroused; kautukaft-being amazed by the situation.

TRANSLATION

The Pracetas were fortunate to see Lord Siva, the chief of the demigods, emerging from the water with his associates. His bodily luster was just like molten gold, his throat was bluish, and he had three eyes, which looked very mercifully upon his devotees. He was accompanied by many musicians who were glorifying him. As soon as the Pracetas saw Lord Siva, they immediately offered their obeisances in great amazement and fell down at the lotus feet of the lord.

PURPORT

The word vibudhanugaift indicates that Lord Siva is always accompanied by the denizens of the higher planets, known as Gandharvas and Kinnaras. They are very expert in musical science, and Lord Siva is worshiped by

1050 Srimad-Bhagavatam [Canto 4, Ch. 24
�Cf
�q·n�+tlwt+t+t(SI€4�
<�a�+tM4il�l.t
f'lit:q-.4( 1 Sl(ii(WJ(cf
TEXT 24-25
(1((1(ij�I�Gfil+t� (1(1�•14( I
��: ������
ftrreWJ6
Ef� Sl.qi�fij4itg4il: II �'-\11

them constantly.In pictures, Lord Siva is generally painted white,hut here we find that the color of his skin is not exactly white hut is like molten gold, or a glowing yellowish color. Because Lord Siva is always very, very merciful, his name is Asuto�a. Amongst all the demigods, Lord Siva can he pacifiedeven bythelowestclassofmen,whoneedonlyofferhimobeisances and leaves of a bael tree. Thus his name is Asuto�a, which means that he is pleased very quickly.

Generally those who are veryfond of material prosperity approach Lord Siva for such benediction. The lord, being very merciful, quickly awards all the blessingsthe devoteeasks of him.The demons takeadvantageof this leniency and sometimes take benedictions from Lord Siva which can be very dangerous to others. For instance, Vrkasura took a benediction from Lord Siva by which he could kill everyone he touched on the head. Although Lord Siva sometimes very liberally gives such benedictions to his devotees, the difficulty is that the demons, being very cunning, sometimes want to experiment improperly with such benedictions. For instance, after receiving his benediction, Vrkasura tried to touch the head of Lord Siva. Devotees of Lord Vi�l).U, however, have no desire for such benedictions,andLord Vi�l).U does not give His devotees benedictions which would cause disturbance to the whole world.

TEXT 26

sa tan prapannarti-haro bhagavan dharma-vatsala� dharma-jiian sila-sampannan prita� pritan uvaca ha

sa�-Lord Siva; tan- them; prapanna-iirti-hara,h-one who drives away all kinds of dangers; bhagatxin-the lord; dharma-vatsala{t-very much fond of religious principles; dharma-jiian-persons who are aware of religious principles; sila-sampannan-very well behaved; prita�-being pleased; pritan-of very gentle behavior;utxica-talked with them;ha-in the past.

TRANSLATION

Lord Siva became very pleased with the Pracetas because generally Lord Siva isthe protector of pious persons and persons of gentle behavior. Being very much pleased with the princes, he began to speak as follows.

Text 26] Chanting the Song Sung by Lord Siva 1051
«��� �:1 •�.i'tee+t4'111.Jffif: � II��II

PURPORT

The Supreme Personality of Godhead, Vi�l).U or l<flliJ.a, is known as bhakta-vatsala, and herein we find Lord Siva described as dharma-vatsala. Of course the word dharma-vatsala refers to a personwho lives according to religious principles. That is understood. Nonetheless, these two words have additional significance. SometimesLord Siva has to deal withpersons who arein themodes ofpassion andignorance.Suchpersonsare notalways very much religious and pious in their activities, but since they worship Lord Siva for some material profit, they sometimes obey the religious principles. As soon as Lord Siva sees that his devotees are following religious principles, he benedicts them. The Pracetas, sons of Praci.nabarhi, were naturally very pious and gentle, and consequently Lord Siva was immediately pleased with them. Lord Siva could understand that the princes were sons of Vai�l).avas, and as such Lord Siva offered prayers to the Supreme Personality of Godhead as follows.

TEXT 27

31iJtiiN� � � � � � 11�\911

sn-rudra uviica

yuyam ved4adaft putrii viditarh vas cikir�itam anugrahiiya bhadrarh va evarh me darsanarh krtam

sri-rudra{t uvaca-Lord Siva began to speak; yuyam-all of you; vedi�adaft-of King Pracinabarhi; putriift-sons; viditam-knowing; vaftyour; cikir�itam-desires; anugrahiiya-for the matter of showing you mercy; bhadram-all good fortune unto you; vaft-all of you; evam-thus; me-my; dadanam-audience; krtam-you have done.

TRANSLATION

Lord Siva said: You are all the sons of King Pracinabarhi, and I wish all good fortune to you. I also know what you are going to do, and therefore I am visible to you just to show my mercy upon you.

1052 Srimad-Bhagavatam [Canto 4, Ch. 24
��\RR ���:�
� ttf��l

By these words Lord Siva indicates that what the princes were going to do was known to him. It is a fact that they were going to worship Lord Vi�T,lU by severe austerities and penances. Knowing this fact, Lord Siva immediately became very pleased, as apparentby the next verse. This indi· cates that a person who is not yet a devotee of the Supreme Personality of Godhead but who desires to serve the Supreme Lord receives the benedic· tions of the demigods, headed by the chief demigod, Lord Siva. Thus a devoteeof the Lorddoes not needto try toplease the demigodsseparately. Simply by worshiping the Supreme Lord, a devotee can please all of them. Nor does he have to ask the demigods for material benedictions, for the demigods, being pleased with the devotee, automatically offer him everything that he needs. The demigods are servants of the Lord, and they are always prepared to help a devotee in all circumstances. Therefore Srila Bilvamangala Thakura said that if one has unalloyed devotion for the Supreme Lord, the goddess of liberation is ready to serve him, to say nothing of the gods of material opulences. Indeed, all the demigods are simply waiting for an opportunity to serve the devotee. Thus there is no need for a devotee of l<.f�l}a to endeavorfor material opulence or liberation. By being situated in the transcendental position of devotional service, he receives all the benefits of dharma, artha, kiima and mok�a.

TEXT 28

�: qt mt: �lff;cgun4\qij�al( 1 � � �: � 6Pit � � ������

ya� pararh rarhhasa� siik�iit tri-gu[liij fiva-samjfiitiit

bhagavantam viisudevam prapanna� sa priyo hi me

ya�-anyone; param-transcendental; ramhasa�-of the controller; siik�iit-directly; tri-gu!liit-from the three modes of material nature;jivasamjiiitiit-living entities called by the name fivas; bhagavantam-unto the Supreme Personality of Godhead; viisudevam-unto Kr�:t;�.a; prapanna�surrendered;sa�-he;priya�-very dear;hi-undoubtedly;me-of me.

Text 28) Chanting the Song Sung by Lord Siva 1053
PURPORT

Lord Siva continued: Any person who is surrendered to the Supreme Personality of Godhead, .Kr�f,la, the controller of everything-material nature as well as the living entity-is actually very dear to me.

PURPORT

Now Lord Siva explains the reason he has personally come before the princes. It is because all the princes are devotees of Lord Kr�l)a. As stated in Bhagavad-gita:

bahunam janmanam ante jiianaviin mam prapadyate vasudeva� sarvam iti sa mahatma sudurlabha�

"After many births and deaths, he who is actually in knowledge surrenders unto Me, knowing Me to be the cause of all causes and all that is. Such a great soul is very rare." (Bg. 7.19)

Lord Siva is rarely seen by common men, and similarly a person who is fully surrendered unto Vasudeva, Kr�l)a, is also very rarely seen because a person who is fully surrendered unto the Supreme Lord is very rare (sa mahatma sudurlabha�). Consequently Lord Siva came especially to see the Pracetas because they were fully surrendered unto the Supreme Personality of Godhead, Vasudeva. Vasudeva is also mentioned in the beginning of Snmad-Bhagavatam in the mantra: om namo bhagavate vasudeviiya. Since Vasudeva is the ultimate truth, Lord Siva openly proclaims that one who is a devotee of Lord Vasudeva, who is surrendered to Lord Kr�Q.a, is actually very dear to him. Lord Vasudeva, Kr�Q.a, is worshipable not only by ordinary living entities but by demigods like Lord Siva, Lord Brahma and others. Yam brahma varur;tendra-rudra-maruta� stunvanti divya* stavai� (Bhiig. 12.13.1). Kr�l)a is worshiped by Lord Brahma, Siva, Varul)a, Indra, Candra and all other demigods. That is also the situation with a devotee. Indeed, one who takes to Kr�l)a consciousness immediately becomes very dear to anyone who is simply finding out and beginning to understand what Kr�l)a consciousness actually is. Similarly, all the demigods are also trying to find out who is actually surrendered to Lord Vasudeva. Because the Praceta princes were surrendered to Vasudeva, Lord Siva willingly came forth to see them.

Lord Vasudeva, or Kr�l)a, is described in Bhagavad-gitii as Puru�ottama. Actually He is the enjoyer (puru�a) and the Supreme (uttama) as well. He

1054 Srimad-Bhagavatam [Canto 4, Ch. 24
TRANSLATION

is the enjoyer of everything-the prakrti and the puru�a. Being influenced by the three modes of material nature, the living entity tries to dominate material nature, but actually he is not the puru�a (enjoyer) but is prakrti, as described in Bhagavad-g"ita:

apareyam itas tv anyarh prakrtirh viddhi me param jlva-bhiitarh mahii-biiho yayedarh dharyate jagat

"Besides this inferior nature, 0 mighty-armed Arjuna, there is a superior energyof Mine,which are allliving entitieswho are strugglingwith material nature and are sustaining the universe." (Bg. 7.5)

Thus the jiva, or living entity, is actually prakrti, or the marginal energy of the Supreme Lord. Being associated with material energy, he tries to lord it over the material nature. This is also confirmed in Bhagavad-g"ita:

mamaivarhso jiva-loke

jiva-bhuta[l sanatana[l mana[!, .safithan"indriyari prakrti-sthiini karfiati

"The living entities in this conditioned world are My eternal, fragmental parts. Due to conditioned life, they are struggling very hard with the six senses, which include the mind." (Bg. 15. 7)

By endeavoring to dominate material nature, the living entity simply struggles hard for existence. Indeed, he struggles so hard to enjoy himself that he cannot even enjoy the material resources. Thus he is sometimes called prakrti, or jlva, for he is situated in the marginal potency. When the living entity is covered with the three modes of material nature, he is called jiva-sarhjnita. There are two kinds of living entities: one is called k�ara, and the other is akfiara. K�ara refers to those who have fallen down and become conditioned, and akfiara refers to those who are not conditioned. The vast majority of living entities live in the spiritual world and are called akfiara. They are in the position of Brahman, pure spiritual existence.They aredifferent fromthose whohave beenconditioned by the three modes of material nature.

Being above both the k§ara and ak�ara, Lord l(r�qa is described in Bhagavad-g"ita as Puru�ottama:

Text 28) Chanting the Song Sung by
Siva 1055
Lord

yasmat k§aram afito 'ham

ak§arad api cottamal;t ato 'smi loke vede ca prathital;t puru§ottamal;t

"Because I am transcendental, beyond both the fallible and the infallible, and because I am the greatest, I am celebrated both in the world and in the Vedas as that Supreme Person." (Bg. 15.18)

The impersonalists may say that :l<r�qa is the impersonal Brahman, but actuallythe impersonalBrahmanis subordinate to Kr�Qa, as also confirmed in Bhagavad-gita:

brahmar-o hi prati�thaham

amrtasyavyayasya ca sasvatasya ca dharmasya

sukhasyaikantikasya ca

"And I am the basis of the impersonal Brahman, which is the constitutional position of ultimate happiness, and which is immortal, imperishable and eternal." (Bg. 14.27)

That K.[�l)a is the source of the impersonal Brahman is also confirmed in Brahma-sarithita: yasya prabha prabhavato jagadar-�a-ko.ti (Bs. 5.40). The impersonal Brahman is nothing but the effulgence or bodily rays of Kr�qa, and in those bodily rays there are innumerable universes floating. Thus in all respects :l<r�qa is the Supreme Lord, and Lord Siva is very satisfied with those who are completely surrendered to Him. Complete surrender is desired by K_r�qa, as He indicates in the last chapter of Bhagavad-gzta:

sarva-dharman parityajya mam ekam sarar-am vraja

aharit tvarit sarva-papebhyo mok§ayi§yiimi mii suca!;t

"Abandon all varietiesof religion and just surrender unto Me. I shall deliver you from all sinful reaction. Do not fear." (Bg. 18.66)

The word sak�iit, meaning "directly," is very significant.There are many so-called devotees, but actually they are only karmzs and jniinzs, for they are not directly devotees of Lord K_r�qa. The karmzs sometimes offer the results of their activities to Lord Vasudeva, and this offering is called

1056 Srimad-Bhagavatam
[Canto 4, Ch. 24

karmiirpa[Lam. These are considered to be fruitive activities, �or the karmis consider Lord Vi�QU to be one of the demigods like Lord Siva and Lord Brahma. Because they consider Lord Vigm to be on the same level with the demigods, they contend that surrendering to the demigods is as good as surrendering unto Vasudeva. This contention is denied herein because if it were true, Lord Siva would have said that surrender unto him, Lord Vasudeva, Vigm or Brahma is the same. However, Lord Siva does not say this because he himself surrenders unto Vasudeva, and whoever else surrenders unto Vasudeva is very, very dear to him. This is expressed herein openly. The conclusion is that a devotee of Lord Siva is not dear to Lord Siva, but a devotee of Lord Kr�Qa is very dear to Lord Siva.

TEXT 29

sva-dharma-ni�.tha!J sata-janmabh* pumiin

viriiicatiim eti tata� param hi miim avyiikrtarh bhiigavato 'tha vai�[!avarh padam yathiiham vibudhii� kalatyaye

sva-dharma-ni�.tha�-one who is situated in his own dharma or occupation; sata-janmabh*-for one hundred births; pumiin-a Living entity; viriiicatiim-the post of Lord Brahma; eti-gets; tata�-thereafter; param-above; hi-certainly; miim-attains Me; avyiikrtam-without deviation; bhiigavata�-unto the Supreme Personality of Godhead; atha-therefore; vai�[!avam-a pure devotee of the Lord; padam-post; yatha-as; aham-l; vibudhii�-demigods; kalii-atyaye-after the annihilation of the material world.

TRANSLATION

A person who executes his occupational duty properly for one hundred births becomes qualified to occupy the post of Brahma, and if he becomes more qualified, he can approach Lord Siva. A person who is directly surrendered to Lord Kt�11a or Vi�QU in unalloyed devotionalservice is immediately promoted to the spiritual planets. Lord Siva and other demigods attain these planets after the destruction of this material world.

Text 29] Chanting the Song Sung byLord Siva 1057
��4f.ta: �a�;:qflt: � FetfQaaa�ftr �: 'ftf(�1 3(Gqltd �S'f �� � � �: ��lflt4 II�Q..II

PURPORT

The highest perfection of the evolutionary process, as described by the Vai�':lava poet Jayadeva Gosvami, is given herein. Pralaya-payodhi-jale dhrtaviin asi vedam. The evolutionary process begins from the point of devastation (pralaya) when the whole universe is filled with water. At that time there are many fishes and other aquatics, and from these aquatics evolve creepers, trees, etc. From these, insects and reptiles evolve, and from them birds, beasts, and then human beings. Finally civilized human beings evolve, and at present these civilized human beings are at a junction where they can make further evolutionary progress in spiritual life. Here it is stated (sva-dharma-ni§tha�) that when a living entity comes to a civilized form of life, there must be sva-dharma, social divisions according to one's work and qualifications. This is indicated in Bhagavad-gTtii:

ciitur-varr-yam maya Sf§ tam gu!ta-karma-vibhiigasa�

(Bg. 4.13)

In civilized human society there are the divisions of briihmalfa, k�atriya, vaisya and 5udra, and everyone must properly execute his occupational duty in accordanceto his division.Here it is described (sva-dharma-n�tha�) that it doesn't matter whether one is a briihmar-a, k§atriya, vaisya or sudra. If one sticks to his position and properly executes his particular duty, he is considered a civilized human being. Otherwise he is no better than an animal. It is also mentioned herein that whoever executes his occupational duty (sva-dharma) for one hundred births (for instance, if a briihmarta continues to act as a bnihmar-a), becomes eligible for promotion to Brahmaloka, the planet where Lord Brahmii lives. There is also a planet called Sivaloka, or Sadiisivaloka, which is situated in a marginal position between the spiritual and material worlds. If, after being situated in Brahmaloka, one becomes more qualified; he is promoted to Sadiisivaloka. Similarly, when one becomes even more qualified, he can attain the Vaikm:tthalokas. The Vaikul)thalokas are targets for everyone, even the demigods, and they can be attained by a devotee who has no desire for material benefit. As indicated in Bhagavad-gTtii, one does not escape material miseries even if he is elevated to Brahmaloka.

1058 Srimad-Bhagavatam [Canto 4, Ch. 24
"According to the three modes of material nature and the work ascribed to them, the four divisions of human society were created by Me."

iibrahma-bhuvaniil lokiiJ:!.

punar iivartino 'rjuna

miim upetya tu kaunteya

punar janma na vidyate

"From the highest planet in the material world down to the lowest, all are places of misery wherein repeated birth and death take place. But one who attains to My abode, 0 son of Kunti, never takes birth again." (Bg. 8.16)

Similarly, one is not very safe even if he is promoted to Sivaloka, because the planet of Sivaloka is marginal. However, if one attains Vaiku.t:t�haloka (miim upetya tu kaunteya punar janma na vidyate, Bg. 8.16), he attains the highest perfection of life and the end of the evolutionary process. In other words, it is confirmed herein that a person in human society who has developed consciousness must take to Kr�.t:ta consciousness in order to be promoted to Vaiku.t:t�haloka, or Kr�t;taloka, immediately after leaving the body. As stated in Bhagavad-gitii:

janma karma ca me divyam evam yo vetti tattvataJ:!.

tyaktvii deharh punar janma naiti miim eti so 'rjuna

"One who knows the transcendental nature of My appearance and activities does not, upon leaving the body, take his birth again in this material world, but attains My eternal abode, 0 Arjuna." (Bg. 4.9)

A devotee who is fully in Kf�f,la consciousness, who is not attracted by any other loka, or planet, including Brahmaloka and Sivaloka, is immediately transferred to Krwaloka (miim eti). That is the highest perfection of life and the perfection of the evolutionary process.

Text 30] Chanting
the Song Sung by Lord Siva
1059
¥11tlit<llTf 6P;n; � �� I 41 �il�•wt;:qlsm�11� o 11
yuyam
stha
yathii
TEXT 30 3N
atha bhiigavatii
priyii[l.
bhagaviin
na mad bhiigavatiiniim ca preyiin anyo 'sti karhicit

atka-therefore; bhtigavata�-devotees; yuyam-all of you;priya�-very dear to me;stha-you are;bhagavan-the Supreme Personality of Godhead; yatha-as; na-neither; mat-than me;bhagavatanam-of the devotees; caalso;preyan-very dear;anya�-others;asti-there is;karhicit-at any time.

TRANSLATION

You are all devotees of the Lord, and as such I appreciate that you are as respectable as the Supreme Personality of Godhead Himself. I know in this way that the devotees also respect me and that I am dear to them. Thus no one can be as dear to the devotees as I am.

PURPORT

It is said (vai�(lavanam yatha sambhufr.) that Lord Siva is the best of all devotees; therefore all devotees of Lord "Kffil}a are also devotees of Lord Siva. 1n Vrndavana there is Lord Siva's temple called Goplsvara. The gop"is used to worship not only Lord Siva but Katyayan1 or Durga as well, but their aim was to attain the favor of Lord K{�qa. A devotee of Lord Kr�IJ.a does not disrespect Lord Siva but worships Lord Siva as the most exalted devotee of Lord K{�qa. Consequently whenever a devotee worships Lord Siva, he prays to him to achieve the favor of K{�qa, and he does not request material profit. In Bhagavad-gita it is said that generally people worship demigods for some material profit. Kamais tais tair hrtajnanafr. (Bg. 7.20). Driven by material lust, they worship demigods, but a devotee never does so, for he is never driven by material lust. That is the difference between a devotee's respect for Lord Siva and an asura's respect for him. The asura worships Lord Siva, takes some benediction from him, misuses the benediction and ultimately is killed by the Supreme Personality of Godhead, who awards him liberation.

Because Lord Siva is a great devotee of the Supreme Personality of Godhead, he loves all the devotees of the Supreme Lord. Lord Siva told the Pracetas that because they were devotees of the Lord, he loved them very much. Lord Siva was not only kind and merciful to the Pracetas;anyone who is a devotee of the Supreme Personality of Godhead is very dear to Lord Siva. Not only are the devotees dear to Lord Siva, but he respects them as much as he respects the Supreme Personality of Godhead. Similarly, devotees of the Supreme Lord also worship Lord Siva as the most dear devotee of Lord Kr�va. They do not worship him as a separate Personality of Godhead. It is stated in the list of niima-apariidhas that it is an offense t.o think that the chanting of the name of Hari and the chanting of Hara or Siva are the same. The devotees must always know that Lord Vi�t:�u is the Supreme Personality of Godhead and that Lord Siva is His devotee.

1060 Srimad-Bhagavatam [Canto 4, Ch. 24

A devotee shouldbe offeredrespect onthelevel ofthe Supreme Personality of Godhead, and sometimes even more respect. Indeed, Lord R_ama, the Personality of Godhead Himself, sometimes worshiped Lord Siva. If a devotee is worshiped by the Lord, why should a devotee not be worshiped by other devotees on the same level with the Lord? This is the conclusion. From this verse it appears that Lord Siva benedicts the asuras simply for the sake of formality. Actually he loves one who is devoted to the Supreme Personality of Godhead.

TEXT 31

idam viviktam japtavyam pavitram mangalam param

n*sreyasa-karam ciipi srii.yatiim tad vadiimi vaft

idam-this;viviktam-very, particular;japtavyam-always to be chanted; pavitram-very pure; maltgalam-auspicious; param-transcendental; n*sreyasa-karam-verybeneficial;ca-also;api-certainly; sruyatam-please hear; tat-that ; vadiimi-1 am speaking;vaft-unto you.

TRANSLATION

Now I shall chant one mantra which is not only transcendental, pure and auspicious but is the best prayer for anyone who is aspiring to attain the ultimate goal of life. When I chant this mantra, please hear it carefully and attentively.

PURPORT

The word viviktam is very significant. No one should thinkof the prayers recited by Lord Siva as being sectarian;rather, they are very confidential, so much so that anyone desiring the ultimate prosperity or auspicious goal of life must take the instructions of Lord Siva and pray to and glorify the Supreme Personality of Godhead as Lord Siva himself did.

Text 32] Chanting the Song Sung by Lord Siva 1061
������� f.l:� �� ��� �:
11��11
�qiffl"( �wcn�'<G:ttl ,, �: 1 �� Uiil�=:lii'IRtttUNU ": II��II
TEXT 32

Srimad-Bhagavatam

maitreya uviica

ity anukrosa-hrdayo

b.hagaviin iiha tiin chiva�

baddhiinjalin riija-putriin

niiriiya[La-paro vaca�

maitreya� uviica-the great saint Maitreya continued to speak; iti-thus; anukrosa-hrdaya�-very kindhearted; bhagaviin-the lord; aha-said ; tanunto the Pracetas; siva�-Lord Siva; baddha-aiijalin-who were standing �th folded hands; riija-putriin-the sons of the king; niiriiya[La-paraft-Lord Siva, the great devotee of NarayaJ)a; vaca�-words.

TRANSLATION

The great sage Maitreya continued: Out of his causeless mercy, the exalted personality, Lord Siva, a great devotee of Lord NarayaQa, continued to speak to the King's sons, who were standing with folded hands.

PURPORT

Lord Siva voluntarily came to benedict the sons of the King as well as do something beneficial for them. He personally chanted the mantra so that the mantra would be more powerful, and he advised that the mantra be chanted by the King's sons (riija-putras). When a mantra is chanted by a g�;eat devotee, the mantra becomes more powerful. Although the Hare ��:r;ta mahii-mantra is powerful in itself, a disciple upon initiation receives the mantra from his spiritual master, for when the mantra is chanted by the spiritual master, it becomes more powerful. Lord Siva advised the sons of the King to hear him attentively, for inattentive hearing is offensive.

TEXT 33

,ft�� �'<(

�U\m ut·l��: 11��11

sn-rudra uviica

jitarh ta iitma-vid-varya­

svastaye svastir astu me bhavatiiriidhasii riiddharh

sarviitmii iitmane nama�

1062
[Canto 4, Ch. 24
ftRt � �tcf�{ij� ((4�«tl it I

sri-rudra� uvaca-Lord Siva began to speak; jitam- all glories; te-unto You; atma-vit-self-realized; varya- the best; svastaye-unto the auspicious; svasti�-auspiciousness ; astu-let there be; me-of me; bhavata-by You; aradhasa-bytheall-perfect; raddham -worshipable; sarvatma- the Supreme Soul; atmane-unto the Supreme Soul; nama�-obeisances.

TRANSLATION

Lord Siva addressed the Supreme Personality of Godhead with the following prayer: 0 Supreme Personality of Godhead, all glories unto You. You are the most exalted of all self-realized souls. Since You are always auspicious for the self-realized, I wish that You will be auspicious for me. You are worshipable by virtue of the all-perfect instructions which You give. You are the Supersoul; therefore I offer my obeisances unto You as the supreme living being.

PURPORT

As long as a devotee is inspired by the Lord to offer the Lord a prayer, the devotee immediatelyglorifies the Lord in thebeginning by saying, "All gloriesunto You,my Lord." The Lord is glorified because He is considered to be the chief of all self-realized souls. As said in the Vedas (nityo nityiiniim cetanas cetaniiniim, Ka_tha, 2.2.13), the Supreme Being, the Personality of Godhead, is the chief living being amongst all living beings. There are different kinds of individual living beings-some of them are in this material world, and some are in the spiritual world. Those who are in the spiritual worldare known to be completely self-realized because on the spiritual platform the living entity is not forgetful of his service to the Lord. Therefore in the spiritual world all those who are in the devotional service of the Lord are eternally fixed, for they understand the position of the Supreme Being, as well as their individual constitution. Thus amongst self-realized souls, the Lord is known as the perfectly self-realized soul. Nityo nityiiniim cetanas cetaniiniim. When the individual soul is fixed in his knowledgeoftheLordas the Supreme Bein ,he actuallybecomes established in an all-auspicious position. Lord Siva prays herein that his auspicious position will continue eternally by virtue of the Lord's mercy upon him.

The Supreme Lord is all-perfect, and the Lord instructs that one who worships Him also becomes perfect. As stated in Bhagavad-gTtii: matta� smrtir jiiiinam apohanam ca (Bg. 15.15). The Lord is situated as the Supersoul in everyone's heart, but He is so kind to His devotees that He gives them instructions by which they may continue to progress. When they re-

Text 33] Chanting the Song Sung by Lord Siva 1063

ceive instructions from the all-perfect, there is no chance of their being misled. This is also confirmed in Bhagavad-gita: dadami buddhi-yogam tam yena miim upayiinti te (Bg. 10.10). The Lord is always ready to give instructions to the pure devotee so that the devotee can advance further and further in devotional service. Since the Lord gives instructions as Sarvatma, the Supersoul, Lord Siva offers Him respect with the words sarvatma atmane namaft. The individual soul is called atma, and the Lord is also called atma as well as Paramatma. Being situated in everyone's heart, the Lord is known as the supreme atmii. Therefore all obeisances are offered unto Him. In this regard, one may refer to the prayers of Kunti in the First Canto of Srimad-Bhiigavatam:

tatha paramahamsaniim munTniim amaliitmanam

bhaktiyoga-vidhaniirtham katham pasyema hi striyal;t (Bhiig. 1.8.20)

The Lord is always ready to give instructions to the paramahamsas, or the topmost devotees of the Lord who are completely liberated from all contaminations of the material world. The Lord always gives instructions to such exalted devotees to inform them how they can remain fixed in devotional service. Similarly, it is stated in the atmarama verse:

atmaramiis ca munayo nirgranthii apy urukrame

kurvanty ahaitukTm bhaktim itthambhuta-gur-o harift (Bhiig. 1.7.10)

The word iitmarama refers to those who are not interested in the material world but are simply engaged in spiritual realization. Such self-realized personsare generallyconsideredin two categories-impersonal and personal. However, impersonalists also become devotees when they are attracted by the personal transcendental qualities of the Lord. The conclusion is that Lord Siva wanted to remain a fixed devotee of the Supreme Personality of Godhead, Vasudeva. As explained in the following verses, Lord Siva never desires to merge into the existence of the Supreme Lord like the impersonalists. Rather, he thinks that it would be good fortune for him to continue to be fixed in the understanding of the Lord as the Supreme Being. By this understanding, one realizes that all living entities-including Lord Siva, Lord Brahma and other demigods-are servants of the Supreme Lord.

1064 Srimad-Bhagavatam [Canto4,Ch.24
TEXT34 if'{: til�� '{��1€¥4� I '41ij�'41tt '(ll�ltt �t�ltt €4Ufit111�'f?ll

namalt-all obeisances unto You; pa hkaja-niibhiiya-unto the Supreme Personality of Godhead from whose navel the lotus flower emanates; bhiita-suk�ma-the sense objects; indriya- the senses; iitmane-the origin; viisudevaya-unto Lord Vasudeva; siin tiiya- always peaceful; ku{asthiiyawithout being changed; sva-roci§e-unto the supreme illumination.

TRANSLATION

My Lord, You are the origin of the creation by virtue of the lotus flower which sprouts from Your navel. You are the supreme controller of the senses and the sense objects, and You are also the all-pervading Vasudeva. You are most peaceful, and because of Your self-illuminated existence, You are not disturbed by the six kinds of transformations.

PURPORT

The Lord as Garbhodakasayi Vi�Q.U lies in the ocean of Garbha within this universe, and from His navel the lotus flower sprouts. Lord Brahma is generated from that lotus flower, and from Lord Brahma the creation of this material world begins. As such, the Supreme Personality of Godhead, Garbhodakasay1 Vi�Q.u,is the origin ofthe material senses and senseobjects. Since Lord Sivaconsiders himself to be one of theproducts of the material world,hissenses are underthe controlof thesupreme creator. The Supreme Lord is also known as Hr�ikesa, master of the senses, which indicates that our senses and sense objects are formed by the Supreme Lord. As such, He can control our senses and out of His mercy engage them in the service of the master of the senses. In the conditioned state, the living entity struggles in this material world and engages his senses formaterial satisfaction. However, if the living entity is graced by the Supreme Personality o�Godhead, he can engage these very senses in the service of the Lord. Lord Siva desires not to be misled by the material senses but to engage always in the service of the Lord without being subject to contamination by materialistic influences. By the grace and help of Lord Vasudeva, who is all-pervading, one can engage his senses in devotional service without deviation, just as the Lord acts without deviation.

Text 34] Chanting
the Song Sung by Lord Siva
1065
nama� pankaja-niibhaya bhuta-siik§mendriyiitmane viisudeviiya siintiiya ku{asthiiya sva-roci§e

The words siintiiya ku,tasthiiya sva-roci�e are very significant. Although the Lord is within this material world, He is not disturbed by the waves of material existence. However, conditioned souls are agitated by six kinds of transformations; namely, they become agitated when they are hungry, when they are thirsty, when they are aggrieved, when they are illusioned,when they grow old, and when they are on the deathbed. Although conditioned souls become very easily illusioned by these conditions in the material world, the Supreme Personality of Godhead, as the Supersoul, Vasudeva, is never agitated by these transformations. Therefore it is said here (ku.tasthiiya) that He is always peaceful and devoid of agitation because of His prowess, which isdescribed herein as sva-roci§e, indicating-that He is illuminated by His own transcendental position. In other words, the individual soul, although within the illumination of the Supreme, sometimes falls down from that illumination because of his tiny position, and whenhe falls down heenters into materialconditional life. The Lord, however, is not subject to such conditioning; therefore He is described as selfilluminated. Consequently any conditioned soul within this material universe can remain completely perfect when he is under the protection of Vasudeva or when he is engaged in devotional service.

TEXT

sankar§aruiya siik§miiya

durantayantakaya ca namo visva-prabodhaya

pradyumnayantaratmane

sahkar�a(laya- unto the master of integration; silk§maya-unto the subtle unmanifested material ingredients; durantaya- unto the unsurpassable; antakaya- unto the master of disintegration; ca-also; nama{l.-obeisances; visva-prabodhaya-unto the master of the development of the universe; pradyumniiya- unto Lord Pradyumna; antaratmane-unto the Supersoul in everyone's heart.

TRANSLATION

My dear Lord, You are the origin of the subtle material ingredients, the master of all integration as well as the master of all disintegration, the predominating Deity named Sarikar�a1,1a, and the master of all intelligence,

1066 Srimad-Bhagavatam · [Canto 4, Ch. 24
35
«e�GIItt �'ll'R � I ;l'ft R� st'liltttt.-ei(t�� ������
�

known as the predominating Deity Pradyumna. Therefore, I offer my respectful obeisances unto You.

PURPORT

The whole universe is maintained by the integrating power of the Supreme Lord, who is known in that capacity by the name of Sarikaq;aJ;Ja. The material scientists might have discovered the law of gravity which maintains the integration of objects within the material energy, yet the master of all integration can create devastation by the disintegrating blazing fire emanating from His mouth. A description of this can he found in the Eleventh Chapter of Bhagavad-gitii wherein the universal form of the Lord is described. The master of integration is also the destroyer of this world by virtue of His disintegrating energy. Sarikar�aJ;Ja is the master of integration and disintegration, whereas Pradyumna, another feature of Lord Yasudeva, is responsible for universal growth and maintenance. The word sukfimiiya is significant because within this gross material body there are subtle material bodies-namely mind, intelligence and ego. The Lord in His different features (Vasudeva, Aniruddha, Pradyumna and Sarikar�aQ.a) maintains both the material and subtle elements of this world. As mentioned in Bhagavad-gztii, the material elements are earth, water, fire, air and ether, and the material subtle elements are mind, intelligence and ego. All of them are controlled by the Supreme Personality of Godhead as Vasudeva, Sat'lkar�at)a, Pradyumna and Aniruddha, and this will be further explained in the following verse.

TEXT 36

�'" �i{tsf.tW:Itt fil�f�lf+t� I

�: 4(it(ijlt� � Rfl(tlf¥4�������

namo namo 'niruddhiiya hrfizkesendriyiitmane nama� paramaharitstiya purraya nibhrtatmane

nama�-all my obeisances unto You; namaft - obeisances agam; aniruddhtiya-unto Lord Aniruddha; hnik e sa-the master of the senses; indriya-atmane-the director of the senses; namaft-all obeisances unto You; paramaharitsaya-unto the Supreme Perfect; purraya-unto the Supreme Complete; nibhrta-ritmane-who is situated apart from this material creation.

Text 36] Chanting the Song Sung by Lord Siva 1067

TRANSLATION

My Lord, as the supreme directing Deity known as Aniruddha, You are the master of the senses and the mind. I therefore offer my obeisances unto You again and again. You are known as Ananta as well as Sarikar�a�a because of Your ability to destroy the whole creation by the blazing fire from Your mouth.

PURPORT

Hr§ikesendriyiitmane. The mind is the director of the senses, and Lord Aniruddha is the director of the mind. In order to execute devotional service, one has to fix his mindonthe lotusfeet of Kr�J;�a;therefore Lord Siva prays to the controller of the mind, Lord Aniruddha, to be pleased and to help him engage hismind on the lotus feet of the Lord.Itis stated in Bhagavad-g"itii: man-manii bhava mad-bhakto mad-yiiji miirh namaskuru (Bg. 9.34). The mind has to beengagedinmeditationon thelotus feet of theLordinordertoexecutedevotionalservice.Itisalso stated in Bhagavadg"itii:

sarvasya ciiharh h[di sannivi�to matta� smrtir jii'iiriam apohanarh ca vedais ca sarvair aham eva vedyo vediinta-krd veda-vid eva ciiham

"Iam seatedineveryone'sheart,andfrom Me comeremembrance,knowledge and forgetfulness. By all the Vedas am I to be known; indeed I am the compiler of Vedanta, andI amthe knower of the Vedas." (Bg. 15.15)

Thus if Lord Aniruddha is pleased, He canhelpthemind engagein the service ofthe Lord.It is alsoindicatedin thisversethat Lord Aniruddha is the sun-god by virtue of His expansions. Sincethepredominating deity of the sun is an expansion of Lord Aniruddha, Lord Siva also prays to the sun-god in this verse.

Lord Kr�!Ja, by His quadruple expansion (Vasudeva, Sankar�aJ].a, Pradyumna and Aniruddha� is the Lord ofpsychic action-namely, thinking, feeling, willing and acting. Lord Siva prays to Lord Aniruddha as the sun-godwhoisthe controllingdeityof the externalmaterialelementswhich constitute the construction of the material body. According to Srila

Visvanatha Cakravartl Thakura, the word paramahamsa is also another name for the sun-god. The sun-god is addressed herein as nibh[tiitmane, which indicatesthat he alwaysmaintainsthe variousplanetsbymanipulatingtherainfall.Thesun-godevaporateswater fromtheseasand oceansand thenformsthewater into cloudsand distributesit overland.Whenthere is sufficient rainfall, grains are produced, and these grains maintain living

1068 Srimad-Bhagavatam [Canto 4, Ch. 24

entities in each and every planet. The sun-god is also addressed herein as purr-a, or complete, because the rays emanating from the sun haveno end. For millions and millions of years since the creation of this universe, the sun-god has been supplying heat and light without diminution. The word paramahamsa is applied to persons who are completely cleansed. When there is sufficient sunshine, the mind remains clear and transparent-in other words, the sun-god helps the mind of the living entity to become situated on the platform of paramahamsa. Thus Lord Siva prays to Aniruddha to be kind upon him so that his mind will always be in the perfect state of cleanliness and will be engaged in the devotional service of the Lord. just as fire sterilizes all unclean things, the sun-god also keeps everything sterilized, especially dirty things within the mind, thus enabling one to attain elevation to the platform of spiritual understanding.

TEXT 37

svargtipavarga-dvtirtiya

nityarh suci-�ade nama�

namo hirar-ya-virytiya

ctiturhotrtiya tantave

svarga-the heavenly planets; apavarga-the path of liberation; dvtirtiyaunto the door of; nityam-eternally; suci-§ade- unto the most purified; nama�-my obeisances unto You; namafl.- my obeisances; hirar-ya-gold; virytiya-semina; catur-hotrtiya-the Vedic sacrifices of the name; tantaveunto one who expands.

TRANSLATION

My Lord, 0 Aniruddha, You are the authority by which the doors of the higher planetary systems and liberation are opened. You are always within the pure heart of the living entity. Therefore I offer my obeisances unto You. You are the possessor of semina which is like gold, and thus, in the form of fire, You help the Vedic sacrifices, beginning with diturhotra. Therefore I offer my obeisances unto You.

PURPORT

The word svarga indicates a position in the higher or heavenly planetary systems, and the word apavarga means liberation. Those who are attached

Text 37] Chanting the Song Sung by Lord Siva 1069
;pft f((W4tf\�t�
(qtAAij•iA\10� � ��q� ;rq: 1
'441Qif�N � 11�'-911

to the karma-kiirt�iya activities describedin the Vedas are actually entangled in the three modes of material nature. The Bhagavad-g"itii therefore says that one should be above the dominion of fruitive activities. There are different kinds of liberation, or mukti. The best mukti is engagement in the devotional service of the Supreme Lord. Lord Aniruddha not only helps fruitive actors by elevating them to the higher planetary systems, but He also helps the devotee engage in devotional service by dint of His inexhaustible energy. Just as heat is the source of material energy, the inspiration of Lord Aniruddha is the energy by which one can engage in executing devotional service.

TEXT 38

nama urja i�e trayya� pataye yajiia-retase trpti-daya ca jlvanarh nama� sarva-rasatmane

nama�-I offer all obeisances unto You;urje-unto the provider of the Pitrloka;i�e-the provider of aU the demigods;trayyii�-of the three Vedas; pataye-unto the master;yajiia-sacrifices;retase-unto the predominating deity of the moon planet;trpti-diiya-unto Him who gives satisfaction to everyone; ca-also; jiviimim-of the living entities; nama�-I offer my obeisances;sarva-rcisa-iitmane-unto the all-pervading Supersoul.

TRANS LATION

My Lord, You are the provider of the Pitrlokas as well as all the demigods. You are the predominating deity of the moon and the master of all three Vedas. I offer my respectful obeisances unto You because You are the original source of satisfaction for all living entities.

PURPORT

When the living entity is born within this material world-especially as a human being-he has several obligations unto the demigods, unto the saintly persons and unto living entities in general. As enjoined in the siistras : devar�i-bhutiipta-nrrtiirh pitfrtiim. Thus one has an obligation to one'sforefathers,the previoushierarchy.Lord Siva praysto Lord Aniruddha

1070 Srimad-Bhagavatam [Canto 4. Ch. 24
� � � �: � tt(l'tMI tt'"«Jtf � \1t'Frr-tt �: (1�(1Rit�����II

to givehim strength sohe can becomefreefrom all obligations tothe pitas, demigods, general living entities and saintlypersons and completely engage himself in the devotional service of the Lord. As stated:

devar�i-bhutapta-nrrtiirh pitf.narh

na kinkaro nayam rrti ca riijan sarvatmanii ya[t sarartarh sarartyam

gato mukundarh parihrtya kartam (Bhag. 11.5.41)

One becomes free from all obligations to the demigods, saintlypersons, pitas, arcient forefathers, etc., if one is completely engaged in the devotional service of the Lord. Lord Siva therefore prays to Lord Aniruddha to give him strength so that he can be free from such obligations and entirely engage in the Lord's service.

Soma, or the predominating deity of the moon, is responsible for the living entity's ability to relish the taste of food throughthetongue. Lord Siva prays to Lord Aniruddha to give him strength so that he will not taste anything but the prasiida of the Lord. Srila Bhaktivinoda Thakura has sung a verse indicating that the tongue is the most viciousenemy and is the most voracious of all the senses. If one can control the tongue, he can easily control the other senses. The tongue can be controlled onlyby eating prasiida offeredtothe Deity. Lord Siva'sprayer to Lord Aniruddha is meant for this purpose (trpti-diiya); he prays to Lord Aniruddha to help him be satisfiedby eating only prasiida offered to the Lord.

TEXT 39

sarva-sattvatma-dehaya

vi.Se�aya sthaviyase

namas trailokya-paliiya saha ojo-baliiya ca

sarva-all; sattva-existence; iitma-soul; dehaya-unto the body; vise�iiya-diversity; sthav"iyase-unto the material world; nama?t-offering obeisances;trailokya-three planetary systems; piiliiya-maintainer; sahaalongwith;oja�-prowess;baliiya-untothe strength;ca-also.

TRANSLATION

My dear Lord, You are the gigantic universal form which contains all the individual bodies of the living entities. You are the maintainer ofthe

Text 39] Chanting the Song Sung
Siva 1071
by Lord
�·�'ij(l�'(lq f?t(i'tt� 8ft._, I ;pf.J\CfllqR�I� �ii�l:it'leN 1'( 11��11

three worlds, and as such You maintain the mind, senses, body and air of life within them. I therefore offer my respectful obeisances unto You.

PURPORT

As the individual body of the living entity is composed of millions of cells, germs and microbes, the universal body of the Supreme Lord similarly contains all the individual bodies of the living entities. Lord Siva is offering his obeisances to the universal body, which includes all other bodies, so that everyone's body may fully engage in devotional service. Since this individual body is composed of senses, all the senses should be engaged in devotional service. For instance, the smelling instrument, the nose, can engage in smelling the flowers offered to the lotus feet of the Lord, the hands can engage in cleansing the temple of the Lord, etc. Indeed, being the life air of every living entity, the Lord is the maintainer of the three worlds. Consequently He can induce every tiving entity to engage in his real life's duty with full bodily and mental strength. Thus every living entity should serve the Supreme Personality of Godhead by his priirw (life), artha (wealth), intelligence and words. As stated in the Srimad-Bhiigavatam:

etiivaj janma-siiphalyarit dehiniim iha dehi�u prii'{lair arthair dhiyii viicii sreya eviicaret sadii (Bhag. 10.22.35)

Even though one may desire to engage in the service of the Lord, without sanction one cannot do so. Lord Siva is offering his prayers in so many different ways in order to show living entities how to engage in the devotional service of the Lord.

TEXT40 dfewa� � ;OOs;ij�f{(R¥t� 1

Wf'l: �t{N � � ¥(ft*4� 11\loll

artha-lingiiya nabhase

namo 'ntar-bahir-iitmane nama� pu'{lyiiya lokiiya

amu�mai bhilri-varcase

artha-meaning; lingiiya-revealing; nabhase-unto the sky; nama�offering obeisances; anta�-within; bah*-and without; iitmane-unto the self; nama�-offering obeisances; pu'[lyiiya-pious activities; lokiiya-for creation;amu§mai-beyond death; bhuri-varcase-the supreme effulgence.

1072 Srimad-Bhagavatam [Canto 4, Ch. 24

My dear Lord, by expanding Your transcendental vibrations, You reveal the actual meaning of everything. You are the all-pervading sky within and without, and You are the ultimate goal of pious activities executed both within this material world and beyond it. I therefore offer my respectful obeisances again and again unto You.

PURPORT

Vedic evidence is called sabda-brahma. There are many things which are beyond the perception of our imperfect senses, yet the authoritative evidence of sound vibration is perfect. The Vedas are known as sabdabrahma because evidence taken from the Vedas constitutes the ultimate understanding. This is because sabda-brahma, or the Vedas, represents the Supreme Personality of Godhead. However, the real essence of sabdabrahma is the chanting of the Hare K{�Q.a mantra. By vibrating this transcendental sound, the meaning of everything both material and spiritual is revealed.This Hare Kr�Q.a isnondifferentfrom the Personalityof Godhead. The meaning of everything is received through the air through sound vibration. The vibration may be material or spiritual, but without sound vibration no one can understand the meaning of anything. In the Vedas it is said: antar bahis ca tat sarvarit vyiipya niiriiya[La� sthita�. "NarayaQ.a is all-pervading, and He exists both within and without." This is also confirmed in Bhagavad-g"itii:

yathii prakiisayaty eka�

krtsnarit lokam imam ravi�

k�etrarit k�etntathii krtsnarit prakiisayati bhiirata

"0 son of Bharata, as the sun alone illuminates all this universe, so do the living entity and the Supersoul illuminate the entire body by consciousness." (Bg. 13.34)

In other words, the consciousness of boththe soul and Supersoul is allpervading; the limited consciousness of the living entity is pervading the entire material body, and the supreme consciousness of the Lord is pervading the entire universe. Because the soul is present within the body, consciousness pervades the entire body; similarly, because the supreme soul, or K{�r;�a, is present within this universe, everything is working in order. Mayiidhyak�erta prakrt* siiyate sa-cariicaram: "This material nature is working under My direction, 0 son of Kunti, and it is producing all movingand unmoving beings." (Bg. 9.10)

Text 40) Chanting the Song Sung by Lord Siva 1073
TRANSLATION

Lord Siva is therefore praying to the Personality of Godhead to be kind to us so that simply bychanting the Hare Kr�l')a mantra we can understand everything in both the material and spiritual worlds. The word amu�mai is significant inthis regard because itindicates the best target one can aimfor after attaining the higher planetary systems. Those who are engaged in fruitive activities (karm"is) attain the higher planetary systems as a result of their past activities, and the jnan"is, who seek unification or a monistic merging with the effulgence of the Supreme Lord, also attain their desired end, but in the ultimate issue, the devotees who desire to personally associate with the Lord are promoted to the Vaikul,lthalokas, or Goloka Vrndavana. The Lord is described in Bhagavad-g"ita as pavitram paramam (Bg. 10.12), the supremely pious one. This is also confirmed in this verse. SukadevaGosvami has stated that thecowherd boys who played with Lord Kr�l')a were not ordinary living entities. Only after accumulating many pious activities invarious births does one get the opportunityto personally associate with the Supreme Personality of Godhead. Since only the pure can reach Him, He is the supreme pure.

TEXT 41

Pffijlq

Attoii4144 � I

�

�:� � 11\HII

pravrttiiya nivrttiiya

pitr-deviiya karmar-e namo 'dharma-vipiikiiya

mrtyave du�kha-diiya ca

pravrttaya-inclination; nivrttaya-disinclination; pitr-devaya- unto the master of Pitrloka;karma!le-untothe resultantaction of fruitive activities; namafl-offering respects; adharma-irreligious; vipakaya-unto the result; mrtyave-unto death; duflkha-daya-the cause of all kinds of miserable conditions; ca-also.

TRANSLATION

My dear Lord, You are the viewer of the results of pious activities. You are inclination, disinclination and their resultant activities. You are the cause of the miserable conditions of life caused by irreligion, and therefore You are death. I offer You my respectful obeisances.

PURPORT

The Supreme Personality of Godhead is situated in everyone's heart, and from Him issue a living entity's inclinations and disinclinations. This is confirmed in Bhagavad-g"ita:

1074 Srimad-Bhigavatam [Canto 4, Ch. 24

"I am seated in everyone's heart, and from Me come remembrance, knowledge and forgetfulness." (Bg. 15.15)

The Supreme Personality of Godhead causes the asuras to forget Him and the devotees to remember Him. One's disinclinations are due to the Supreme Personality of Godhead. According to Bhagavad-gitii the asuras do not know which way one should be inclined to act and which way one shouldnot heinclined to act. Pravrttim ca nivrttim ca jana na vidur iisuriift: "Those who are demoniac do not know what is to be done and what is not to be done." (Bg. 16.7) Although the asuras oppose devotional service, it is to he understood that they are inclined that way due to the Supreme Personality of Godhead. Because the asuras do not like to engage in the Lord's devotional service, the Lord within gives them the intelligence to forget. Ordinary karmis desire promotion to Pitrloka, as confirmed in Bhagavad-gitii. Yanti deva-vrata devan pitfn yiinti pitr-vrataft: "Those who worship the demigods will take birth among the demigods, and those who worship ancestors go to the ancestors." (Bg. 9.25)

In this verse the word duftkha-diiya is also very significant, for those who are nondevotees are perpetually put into the cycle of birth and death. This is a very miserable condition. Because one's position in life isattained according to one's activities, the asuras, or nondevotees, are put into such miserable conditions.

TEXT42

� 1111\1'114\\1 q;R ¥1(011�" I

� � m i'*'ll411"6it"4 1

� $;(10114 ijf(.oq.nfN(M ='f IIV�II

namas ta iis�iimiSa

manave karartatmane

namo dharmaya brhate

kr�rtiiyakurttha-medhase

puru�aya purartaya

siinkhya-yogesvaroya ca

nama[t-offering obeisances; te-unto You; iiS�am iSa-0 topmost of all bestowers of benediction; manave-unto the supreme mind or supreme Manu; kararta-iitmane-the supreme cause of all causes; nama[t-offering obeisances; dharmaya-unto one who knows the best of all religion; brhate-the greatest; kr�1,1aya-unto Kr�qa; akurt.tha-medhase-unto one

Text 42) Chantingthe Song Sung by Lord Siva sarvasya caham hrdi sanniv�to mattaft smrtir jiianam apohanarh ca 1075

whose brain activity is never checked; puru,saya-the Supreme Person; pura{taya- the oldest of the old; sankhya-yoga-ISvaraya-the master of the principles of sankhya-yoga; ca-and.

TRANSLATION

My dear Lord, You are the topmost of all bestowers of all benediction, the oldest and supreme enjoyer amongst all enjoyers. You are the master of all the worlds' metaphysical philosophy, for You are the supreme cause of all causes, Lord Kf!!IJa. You are the greatest of all religious principles, the supreme mind, and You have a brain which is never checked by any condition. Therefore I repeatedly offer my obeisances unto You.

PURPORT

The words kr�T}iiya akur}tha-medhase are significant in this verse. Modern scientists have stopped their brainwork by discovering the theory of uncertainty, but factually for a living being there cannot be any brain activity which is not checked by time and space limitations. A living entity is called a{tu, an atomic particle of the spirit soul, and therefore his brain is also atomic. It cannot accommodate unlimited knowledge. This does not mean, however, that the Supreme Personality of Godhead, KJ;�qa, has a limited brain. What KfllQa says and does is not limited by time and space. In Bhagavad-gita it is said:

vedaham samatitani

vartamiiniini carjuna

bhavi,sya{ti ca bhutani

mam tu veda na kascana

"0 Arjuna, as the Supreme Personality of Godhead, I know everything that has happened in the past, all that is happening in the present, and all things that are yet to come. I also know all living entities; but Me no one knows." (Bg. 7.26)

KJ;�qa knows everything, but one cannot know Kr�qa without being favored by Him. Thus for KfllQa and His representative there is no question of a theory of uncertainty. What Kr11qa says is all perfect and certain and is applicable to the past, present and future. Nor is there any uncertainty for one who knows exactly what Krllqa says. The Krllqa consciousness movement is based on Bhagavad-gita as it is, as spoken by Lord Krllqa, and for those who are engaged in this movement, there is no question of uncertainty.

Lord Krllqa is also addressed herein as asi,sam iSa. The great saintly personalities,sages and demigods are able to offer benedictions to ordinary living entities, but they in turn are benedicted by the Supreme Personality

1076 Srimad-Bhagavatam [Canto 4, Ch. 24

of Godhead. Without being benedicted by Kr�Qa, one cannot offer benediction to anyone else. The word manave, meaning "unto the supreme Manu," is also significant. The supreme Manu in Vedic literature is Svayambhuva Manu, who is an incarnation of Kr�!J.a. All the Manus are empowered incarnations of Kr�!la (manvantara-avatiira). There are fourteen Manus in one day of Brahma, 420 in one month, 5,040 in one year, and 504,000 Manus in the lifetime of Brahma. Since all the Manus are directors of human society,ultimately K.J;s.Qa is the supreme director of human society. In another sense, the word manave indicates the perfection of all kinds of mantras. The mantra delivers the conditioned soul from his bondage; so simply by chanting the mantra Hare Kr�!J.a, Hare Kr�Qa, Kr�Qa Kr�Qa, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare, one can gain deliverance from any condition.

Kiirar-iitmane: everythinghas a cause. The theory of chance is repudiated in this verse. Because everything has its cause, there is no question of chance. Because so-called philosophers and scientists are unable to find the real cause, they foolishly say that everything happens by chance. In Brahma-sanihitii Kr�Qa is described as the cause of all causes; therefore He is addressed herein as kiirar-iitmane. His very personality is the original cause of everything, the root of everything and the seed of everything. As described in the Vedanta-satra, janmiidy asya yata� (1.1.2): the Absolute Truth is the supreme cause of all emanations.

The word siihkhya-yogesvariiya is also significant herein, for Kr�Qa is described in Bhagavad-g"itii as Yogesvara, the master of all mystic powers. Without possessing inconceivable mystic powers, one cannot be accepted as God. In this age of Kali, those who have a little fragmental portion of mystic power claim to be God,but such pseudo-Gods can only be accepted as fools, for only Kr�Qa is the Supreme Person who possesses all mystic and yogic perfections. The siihkhya-yoga system popular at the present moment was propounded by the atheist Kapila, but the original sankhyayoga system was propounded by an incarnation of Kr�l)a also named Kapila, the son of Devahiiti. Similarly, Dattatreya, another incarnation of Kr�Qa, also explained the siihkhya-yoga system. Thus Kr�Qa is the origin of all siihkhya-yoga systems and mystic yoga powers.

The words puriirtiiya puru�iiya are also worthy of special attention. In Brahma-sarhhitii, Kr�Qa is accepted as the iidi-puru�a, the original person, or the original enjoyer. In Bhagavad-g"itii, Lord Kr�Qa is also accepted as puriirta-puru�a, the oldest person. Although He is the oldest of all personalities, He is also the youngest of all, or nava-yauvana. Another significant word is dharmiiya. Since Kr�Qa is the original propounder of all kinds of religious principles, it is said: dharmarh tu siik§iid bhagavat-

Text 42] Chanting the Song Sung by Lord Siva 1077

prar-"itam. No one can introduce a new type of religion, for religion is already there, having been established by Lord Kr�Qa. In Bhagavad-g"itii Kr�Qa informs us of the original dharma and asks us to give up all kinds of religious principles. The real dharma is surrender unto Him. In the Mahiibhiirata, it is also said:

ye ca veda-vido viprii ye ciidhyiitma-vido janii� te vadanti mahiitmiinarh kr�rtarh dharmam saniitanam

The purport is that one who has studied the Vedas perfectly, who is a perfect vipra, or knower of the Vedas, who knows what spiritual life actually is, speaks about Kr�p.a, the Supreme Person, as one's saniitanadharma. Lord Siva therefore teaches us the principles of saniitana-dharma.

TEXT43

sakti-traya-sametiiya m"i{lhu�e 'hankrtiitmane ceta-iikuti-rupiiya namo viico vibhutaye

sakti-traya- three kinds of energies; sametiiya-unto the reservoir; mi{lhu§e-unto Rudra; ahankrta-iitmane-the source of egotism; ceta[l,knowledge; iikuti_:eagerness to work; rupiiya-unto the form of; namaftmy obeisances;viicaft-unto the sound; vibhiitaye-unto the different types of opulences.

TRANSLATION

My dear Lord, You are the supreme controller of the worker, sense activities, and results of sense activities [karma]. Therefore You are the controller of the body, mind and the senses. You are also the supreme controller of egotism, known as Rudra. You are the source of knowledge and the activities of the Vedic injunctions.

PURPORT

Everyone acts under the dictation of the ego. Therefore Lord Siva is trying to purify false egotism through the mercy of the Supreme Personality of Godhead. Since Lord Siva, or Rudra, is himself the controller of egotism, he indirectly wants to be purified by the mercy of the Lord so that his real egotism can be awakened. Of course Lord Rudra is always spiritually awake, but for our benefit he is praying in this way. For the

1078 Srimad-Bhagavatam [Canto4, Ch. 24
lU�S(l§�
�6\ill\�""144 � '4Nlfch((1� IIV�II
I

impersonalist, pure egotism is aham brahmiismi- "I am not this body; I am spirit soul." But in its actual position, the spirit soul has devotional activities to perform. Therefore Lord Siva prays to be engaged both in mind and in action in the devotional service of the Supreme Lord according to the direction of the Vedas. This is the process for purifying false egotism. . Ceta[l. means knowledge. Without perfect knowledge, one cannot act perfectly. The real source of knowledge is the vaca[l., or sound vibration, given by Vedic instructions. Here the word viica[l., or vibration, means the Vedic vibration. The origin of creation is sound vibration, and if the sound vibration is clear and purified, perfect knowledge and perfect activities actually become manifest. This is enacted by the chanting of the mahii-mantra Hare Kr�Q.a, Hare Kr�Q.a, Kr�Q.a Kr�Q.a, Hare Hare/ Hare Rama, Hare Rama, Rama Rama, Hare Hare. Thus Lord Siva is praying again and again for the purification of body, mind and activities through the purification of knowledge and action under the pure directions of the Vedas. Lord Siva prays to the Supreme Personality of Godhead so that his mind, senses and words will all turn toward devotional activities only.

TEXT 44

darsanam no didrk§ii[liim dehi bhiigavatiircitam rupam priyatamam sviiniim sarvendriya-gu[liiiijanam

darsanam-vision; na[l.-our; didrk�ii[liim-desirous to see; dehi-kindly exhibit; bhiigavata-of the devotees; arcitam-as worshiped by them; riipam-form; priyatamam-dearmost; sviinam-of Your devotees; sarvai ndriya- all the senses; gu[la-qualities; aiijanam-very much pleasing.

TRANSLATION

My dear Lord, I wish to see You exactly in the form that Your very dear devotees worship. You have many other forms, but I wish to see Your form that is especially liked by the devotees. Please be merciful upon me and show me that form, for only that form worshiped by the devotees can perfectly satisfy all the demands of the senses.

PURPORT

In the sruti, or Veda-mantra, it is said that the Supreme Absolute Truth is sarva-kamal]. sarva-gandhal]. sarva-rasal]., or, in other words, He is known

Text 44] Chanting the Song Sung by Lord Siva 1079
��!JUII8Wli(
�· ;it � ijt +tltlf461�6i( I � � �
11\l\lll

as raso vai sa�, the source of all relishable relationships (rasas). We have various senses-the power of seeing, tasting, smelling, touching, etc.-and all the propensities of our senses can be satisfied when the senses are engaged in the service of the Lord. Hr§tker-a hr§ikesa-sevanam bhaktir ucyate (Niirada-pancariitra). "Bhakti means engaging all the senses in the service of the master of the senses, Ht�ikesa." These material senses, however, cannot be engaged in the service of the Lord; therefore one has tobecomefreefrom alldesignations. Sarvopiidhi-vinirmuktam tatparatvena nirmalam. One has to become free from all designation or false egotism and thus becomepurified. When we engageoursenses in theserviceof the Lord,thedesiresorthe inclinationsof the senses canbe perfectly fulfilled. Lord Siva therefore wants to seethe Lord ina form which isinconceivable totheBuddhist philosophersortheBuddhists.

The impersonalists and the voidists also have to see the form of the Absolute. In Buddhist temples there are forms of Lord Buddha in meditation, but these are not worshipedliketheformsof the Lord in Vai�J;lava temples (forms like Riidhii-Kt�IJ.a, Sitii-Riima or Lak�mi-NarayaJ;la).

Amongst thedifferent sampradiiyas (Vai�T).avasects) either Radha-KwJ.a or Lak�mi-NarayaJ;lais worshiped. Lord Siva wants toseethat form perfectly, just as the devotees want to see it. The words riipam priyatamam sviiniim are specifically mentioned here, indicating that Lord Siva wants to see that formwhichis verydeartothedevotees.Theword sviiniim is especially significant because only the devotees are very, very dear to the Supreme Personality of Godhead. The jiiiin"is, yogis and karmis are notparticularly dear, for the karmis simply want to see the Supreme PersonalityofGodhead as their order supplier. The jniinis want to see Him to become one with Him,andthe yogis wanttosee Him partially represented within their heart as Paramatma, but the bhaktas, or thedevotees,wanttosee Himin His completeperfection.Asstated in Brahma-samhitii:

ver-um kvar-antam aravinda-daliiyatiik§arh barhiivatamsam asitiimbuda-sundariingam

kandarpa-ko.ti-kamaniya-viSe§a-sobham govindam iidi-puru§am tam aham bhajiimi

"I worship Govinda, the primeval Lord, who is adept at playingon His flute, whose eyes are blooming like lotus petals, whose head is bedecked with peacockfeathers, whosebeautyis tinged with thehueofblueclouds, and w!Jose unique loveliness charms millions of Cupids." (Bs. 5.30) Thus Lord Siva's desire is to see the Supreme Personality of Godhead as He is described in this way-that is, he wants to see Him as He appears to the

1080 Srimad-Bhagavatam [Canto 4, Ch. 24

bhiigavatas, the devotees. The conclusion is that Lord Siva wants to see Him in complete perfection and not in the impersonalist or voidist way. Although the Lord is one in His various forms (advaitamacyutamaniidim), still His form as the young enjoyer of the gop"is and companion of the cowherd boys (kisora-murti) is the most perfect form. Thus Vai�l).avas accept the form of the Lord in His Vrndavana pastimes as the chief form.

TEXTS 45-46

�Sflt'6Ef'1�f414

snigdha-priivr{i-ghanasyiimam sarva-saundarya-sangraham ciirv-iiyata-catur-biihu sujiita-ruciriinanam

padma-kosa-paliisiik�am sundara-bhrusu-niisikam su-dvijamsu-kapoliisyam sama-karr-a-vibhii�ar-am

snigdha-glistening; pravn-rainy season; ghana-syiimam-densely cloudy; sarva-all; saundarya-beauty; sangraham-collection; ciiru-beautiful; iiyata-bodily feature; ciituft-biihu- unto the four-armed; suj iita-ultimately beautiful; rucira-very pleasing; iinanam-face; padma-kosa-the whorl of the lotus flower; paliisa-petals; ak§am-eyes ; sundara-beautiful; bhrueyebrows; su-niisikam-raised nose; su-dvijam-beautiful teeth; su-kapolabeautiful forehead; iisyam-face; sama-ka rQ. a-equally beautiful ears; vibhii§ar-am- fully decorated.

TRANSLATION

The Lord's beauty resembles a dark cloud during the rainy season. As the rainfall glistens, His bodily features also glisten. Indeed, He is the sum total of all beauty. TheLord has four arms and an exquisitelybeautiful face with eyes like lotus petals, abeautiful highlyraised nose, amindattracting smile, a beautiful forehead and equally beautiful and fully decoratedears.

Texts 45-46]
1081
Chanting the Song Sung by Lord Siva
Qete1�44Jt� I 'EIIiit�{'I'Eidilll Wi1H1,R0'1'1\11\l�ll �(!! 1 uwile•� 11\l�ll

PURPORT

After the scorching heat of the summer season, it is very pleasing to see dark clouds in the sky. As confirmed in Brahma-samhitii: barhiivatamsam asitiimbuda-sundariingam. The Lord wears a peacock feather in His hair, and His bodily complexion is just like a blackish cloud. The word sundara, or snigdha, means very pleasing, even when compared with kandarpa-kotikaman"iya. Kr�t;�a's beauty is so pleasing that not even millions upon millions of Cupids can compare to it.The Lord's form asVi�l)U is decorated in all opulence; therefore Lord Siva is trying to see that most opulent form of Narayal)a, or Vi�t;�u. Generally the worship of the Lord begins with the worship of Narayat).a or Vi�ryu, whereas the worship of Lord KriilJ.a and Radha is most confidential. Lord Narayarya is worshipable by the Piiiicariitrika-vidhi, or regulative principles, whereas Lord Kr�rya is worshipable by the Bhiigavata-vidhi. No one can worship the Lord in the Bhiigavata-vidhi without going through the regulations of the Piiiicariitrikavidhi. Actually neophyte devotees worship the Lord according to the Piiiicariitrika-vidhi, or the regulative principles enjoined in the Niiradapaiicariitra. Radha-Kriit;�a cannot be approached by the neophyte devotees; therefore temple worship according to regulative principles is offered to Lak�mi-Narayarya. Although there may be a Radhii-Kr�rya vigraha, or form, the worship of the neophyte devotees is acceptable as Lak�mi-Narayat).a worship. Worship according to the Piiiicariitrika-vidhi is called vidhi-miirga, and worship according to the Bhiigavata-vidhi principles is called· riigamiirga. The principles of riiga-miirga are especially meant for devotees who are elevated to the vrndavana platform.

The inhabitants of Vrndavana, the gop"is, mother Yasoda, Nanda Maharaja, the cowherd boys, the cows and everyone else, are actually on the riiga-miirga or Bhagavata-miirga platform. However, they participate in five basic rasas-diisya, sakhya, viitsalya, miidhurya and siinta. Although these fiv� rasas are found in the Bhiigavata-miirga, the Bhiigavata-miirga is especially meant for viitsalya and miidhurya, or paternal and conjugal relationships. Yet there is the vipralambha-sakhya, the higher fraternal worship of the Lord especially enjoyed by the cowherd boys. Although there is friendship between Kr�rya and the cowherd boys, this friendship is different from the aisvarya friendship between Kr�t;�a and Arjuna. When Arjuna saw the visva-riipa, the gigantic universal form of the Lord, he was afraid for having treated Kr�rya as an ordinary friend; therefore he begged Kr�t;�a's pardon. However, the cowherd boys who are friends of Kr�t;ta in Vrndavana sometimes ride on the shoulders of Kr�t;�a. They treat Kr�t;�a equally, just as they treat one another, and they are never afraid of Him,

1082 Srimad-Bhagavatam [Canto 4, Ch. 24

Texts 45-46] Chanting the Song Sung by Lord Siva 1083

nor do theyever beg His pardon. Thus the rii.ga-mii.rga, or Bhii.gavata-mii.rga, friendship exists on a higher platform with l<.{�l,la, namely the platform of vipralambha friendship. Paternal friendship, conjugal paternal service, as well as conjugal service, are visible in the Vrndavana rii.ga-mii.rga relationships.

Without serving Kr�l,la according to the vidhi-mii.rga regulative principles of the Piiiicarii.trika-vidhi, unscrupulous persons want to jump immediately to the rii.ga-miirga principles. Such persons are called sahajiyii. There are also demons who enjoy dep cting Kr�l,la and His pastimes with the gopis, taking advantage of Kr�l,la bytheir licentious character. These demons who print books and write lyrics on the rii.ga-miirga principles are surely on the way to hell. Unfortunately, they lead others down with them. Devotees in Kr�l,la consciousness should be very careful to avoid such demons. One should strictly follow the vidhi-miirga regulative principles in the worship of Lak�mi-Narayal,la, although the Lord is present in the temple as Radhal<.{�l,la. Radha-Kr�l,la includes Lak�mi-Narayal,la; therefore when one worships the Lord according to the regulative principles, the Lord accepts the service in the role of Lak�mi-Nariiyal,la. In Nectar of Devotion full instructions are given about the vidhi-miirga worship of Radha-Kr�l,la or Lak�miNarayal)a. Although there are sixty-four kinds of offenses one can commit in vidhi-mii.rga worship, in raga-mii.rga worship there is no consideration of such offenses because the devotees on that platform are very much elevated, and there is no question of offense. But if we do not follow the regulative principles on the vidhi-miirga platform andkeep our eyes trained to spot offenses, we will not make progress.

In his description of Kr�l,la's beauty, Lord Siva uses the words cii.rviiyata-catur-biihu sujii.ta-rucirii.nanam, indicating the beautiful four-armed form of Nariiyal,la, or Vi�l,lU. Those who worship Lord Kr�Qa describe Him as sujiita-ruciriinanam. In the Vi�flu-tattva there are hundreds andthousands and millions of forms of the Supreme Lord, but of all these forms, the form of Krwa is the most beautiful. Thus for those who worship Kr�l)a, the word sujii.ta-rucirii.nanam is used.

The four arms of Lord Vi�l)U have different purposes. The hands holding a lotus flower and conchshell are meant for the devotees, whereas the other two hands, holding a disc and mace or club, are meant for the demons. Actually all of the Lord's arms are auspicious, whether they are holding conchshells and flowers or clubs and discs. The demons killed by LordVi�QU's ca.kra discandclubareelevated to the spiritual world,just like the devotees who are protectedby the hands holding the lotus flower and conchshell. However, the demons who are elevated to the spiritual world

are situated in the impersonal Brahman effulgence, whereas the devotees are allowed to enter into the Vaikw;ttha planets. Those who are devotees of Lord Kr�Qa are immediately elevated to the Goloka Vrndavana planet. The Lord's beauty is compared to rainfall because when the rain falls in the rainy season, it becomes more and more pleasing to the people. After the scorching heat of the summer season, the people enjoy the rainy season very much. Indeed, they even come out of their doors in the villages and enjoy the rainfall directly. Thus the Lord's bodily features are compared with the clouds of the rainy season. The devotees enjoy the Lord's beauty because it is a collection of all kinds of beauties. Therefore the word sarvasaundarya-sangraham is used. No one can say that the body of the Lord is wanting inbeautifulparts. It is completely purr-am. Everything is complete: God's creation, God's beauty, and God's bodily features. All these are so complete that all one's desires can become fully satisfied when one sees the beauty of the Lord. The word sarva-saundarya indicates that there are different types of beauties in the material and spiritual worlds, and that the Lord contains all of them. Both materialists and spiritualists can enjoy the beauty of the Lord. Because the Supreme Lord attracts everyone, including demons and devotees, materialists and spiritualists, He is called Kr�Qa. Similarly, His devotees also attract everyone. As mentioned in the $a{igosviimi-stotra: dhiriidhira-jana-priyau-the Gosvamis are equally dear to the dhira (devotees) and adhira (demons). Lord Kr�Qa was not very pleasing to the demons when He was present in Vrndavana, but the six Gosvamis were pleasing to the demons when they were present in Vrndavana. That is the beauty of the Lord's dealings with His devotees; sometimes the Lord gives more credit to His devotees than He takes for Himself. For instance, on the Battlefield of Kuruk�etra, Lord Kr�I).a fought simply by giving directions. Yet it was Arjuna who took the credit for fighting. Nimitta-miitrarh bhava savyasiicin (Bg. 11.33). "You, 0 Savyasacin fArjuna] , can be but an instrument in the fight." Everything was arranged by the Lord, but the credit of victory was given to Arjuna. Similarly, in the Kr�Qa consciousness movement, everything is happening according to the predictions of Lord Caitanya, but the credit goes to Lord Caitanya's sincere servants. Thus the Lord is described herein as sarva-saundarya-satigraham.

TEXTS47-48 si\fttsl(ft\ijNif'(�*� e(1�t:stfcMI��J

1084 Srimad-Bhagavatam [Canto 4, Ch. 24
'ltt"'66tfl.IIV\911

pri'ti-prahasitiipiingam

alakai rupa-sobhitam

lasa_t-pankaja-kinjalkadukularh mr�ta-kurzflalam

sphurat-kiri'ta-valayahiira-nupura-mekhalam

sankha-cakra-gadii-padmamiilii-ma[ty-uttamarddhimat

pnti-merciful; prahasita- smiling; apiingam-sidelong glance; alaka*with curling hair; rupa-beauty; sobhitam-increased; lasat- glittering ; pankaja- of the lotus; kinjalka-saffron; dukulam-clothing; mr�ta- glittering; ku[t{falam-earrings; sphurat- shiny; kinta- helmet; valaya- bangles; hiira-necklace; nu pura-ankle bells; mekhalam-belt; sankha-conchshell; c akra-wheel; gadii- club; padma- lotus flower; miilii- garland; ma[ti-pearls; uttama-first class ; rddhimat-still more beautified on account of this.

TRANSLATION

The Lord is superexcellently beautiful on account of His open and merciful smile and His sidelong glance upon His devotees. His black hair is curly, and His garments, waving in the wind,appear as flying saffron pollen from lotus flowers. His glittering earrings, shining helmet, bangles, garland, ankle bells, waist belt and various other bodily ornaments combine with conchshell, disc, club and lotus flower to increase the natural beauty of the Kaustubha pearl on His chest.

PURPORT

The word prahasitiipiinga, referring to K�;sna's smile and sidelong glances at His devotees, specifically applies to His dealings with the gopl.s. Kr�qa is always in a joking mood when He increases the feelings of conjugal rasa in the hearts of the gopl.s. The conchshell, club, disc and lotus flower can be either held in His hands or seen on the palms of His hands. According to palmistry, the signs of a conchshell, club, lotus flower and disc mark the palms of great personalities and especially indicate the Supreme Personality of Godhead.

Texts 47-48] Chanting
Siva �(�eite44(l�<ii(CI�4( ij14tifit(i.((q'I¥Uel+tO�'qqftq<t_ 11\l�ll
the Song Sung by Lord
1085

11�'"

siniha-skandha-tvi§O bibhrat saubhaga-griva-kaustubham sriyiinapiiyinyii k�iptanika§iismorasollasat

simha-the lion; skandha-shoulders; tvi�a[l-the coils of hair; bibhratbearing; saubhaga-fortunate; griva-neck; kaustubham-the pearl of the name; sriya-beauty; anapiiyinyii-never decreasing; k�ipta- defeating; nika�a-the stone for testing gold; asma-stone; urasa-with the chest; ullasat-glittering.

TRANSLATION

The Lord has shoulders just like a lion. Upon these shoulders are garlands, necklaces and epaulets, and all of these are always glittering. Besides these, there is the beauty of the Kaus�ha mar_ri pearl, and on the dark chest of the Lord there are streaks named Srivatsa, which are signs of the goddess of fortune. The glittering of these streaks excels the beauty of the golden streaks on a gold-testing stone. Indeed, such beauty defeats a gold-testing stone.

PURPORT

The curling hair on the shoulders of a lion always appears very, very beautiful. Similarly, the shoulders of the Lord were just like a lion's, and the necklace and garlands, along with the Kaustubha pearl necklace, combined to excel the beauty of a lion. The chest of the Lord is streaked with Srivatsa lines, the sign of the goddess of fortune. Consequently the Lord's chest excels the beauty of a testing stone for gold. The black siliceous stone on which gold is rubbed to test its value always looks very beautiful, being streaked with gold lines. Yet the chest of the Lord excels even such a stone in its beauty. TEXT

1086 Srimad-Bhagavatam [Canto4, Ch. 24
�\EFliC��§IE(i1¥t•ttftcc"\ij¥t(
TEXT49
1 N4tttqtfi4;:qtfiaaril¥1tWt(tiltw(
\.({q+MffiucccfeccC?t..Ja>JI<(¥( 1 51�4¥1'\q� ��ssq�•l¥fi(�l ll�oll
50

pi.Lra-inhaling; recaka-exhaling; sarhvigna-agitated; vali-the wrinkles on the abdomen; valgu-beautiful; dala-like the banyan leaf; udaramabdomen; pratisankriimayat-coiling down; visvam-universe; niibhyiinavel; iivarta-screwing; gabhirayii-by deepness.

TRANSLATION

The Lord's abdomen is beautiful due to three ripples in the flesh. Being so round, His abdomen resembles the leaf of a banyan tree, and when He exhales and inhales, the movement of the ripples appears very, very beautiful. The coils within the navel of the Lord are so deep that it appears that the entire universe sprouted out of it and yet again wishes to go back.

PURPORT

The whole universe is born out of the lotus stem which sprouted from the navel of the Lord. Lord Brahma sat on the top of this lotus stem to create the whole universe. The navel of the Lord is so deep and coiling that it appears that the whole universe again wants to withdraw into the navel, being attracted by the Lord's beauty. The Lord's navel and the ripples on His belly always increase the beauty of His bodily features. The details of the bodily features of the Lord especially indicate the Personality of Godhead. Impersonalists cannot appreciate the beautiful body of the Lord which is described in these prayers by Lord Siva. Although the impersonalists are always engaged in the worship of Lord Siva, they are unable to understand the prayers offered by Lord Siva to the bodily features of Lord Vigm. Lord Vi�l).u is known as siva-virinci-nutam (Bhiig. 11.5.33), for He is always worshiped by Lord Brahma and Lord Siva.

TEXT 51

'4tff¥(tflO��(tPMJl\tJS(Cioi�(CI�

syama-sror-y-adhi-roc4r-udukula-svarr-a-mekhalam

sama-carv-anghri-janghoru­

nimna-janu-sudarsanam

Text 51) Chanting the Song Sung by
piira-recaka-sarhvignavali-valgu-dalodaram pratisanknimayad visvarh nabhyavarta-gabhiraya 1087
Lord Siva
I ������

sytima-blackish; srori-lower part of the waist; adhi-extra; roci§r-upleasing; dukula-garments; svarr-a-golden; mekhalam-belt; sama-symmetrical; ciiru-beautiful; anghri-lotus feet; jangha-calves; U:ru-thighs; nimna-lower; janu-knees; su-darsanam-very beautiful.

TRANSLATION

The lower part of the Lord's waist is dark and covered with yellow garments and a belt bedecked with golden embroidery work. His symmetrical lotus feet and the calves, thighs and joints of His legs are extraordinarily beautiful. Indeed, the Lord's entire body appears to be well built.

PURPORT

Lord Siva is one of the twelve great authorities mentioned in SnmadBhiigavatam (6.3.20). These authorities are Svayambhu, Narada, Sambhu, Kumara, Kapila, Manu, PrahUida, Janaka, Bhiflma, Bali, Vaiyasaki or Sukadeva Gosvami, and Yamaraja. The impersonalists who generally worship Lord Siva should learn of the transcendental sac-cid-ananda-vigraha form of the Lord. Here Lord Siva kindly describes the details of the Lord's bodily features. Thus the impersonalists' argument that the Lord has no form cannot be accepted under any circumstance.

TEXT 52

pada sarat-padma-palasa-roci§ti

nakha-dyubhir no 'ntar-agham vidhunvata

pradarsaya sviyam apasta-sadhvasam

padarh guro marga-gurus tamo-ju§tim

pada-by the lotus feet; sarat-autumn; padma-lotus flower; palasapetals; roci§a-very pleasing; nakha-nails; dyubhi[l-by the effulgence; na[t-our; antar-agham-dirty things; vidhunvata-which can cleanse; pradarsaya-just show;sviyam-Your own;apasta-diminishing;sadhvasamthe trouble of the material world; padam-lotus feet; guro-0 supreme spiritual master;marga- the path;guru[t-spiritual master;tama{l.-ju§tim-of the persons suffering in ignorance.

1088 Srimad-Bhagavatam [Canto 4, Ch. 24
� ��ml � ��ijqj(ijijl&:t4 q( gU +tl•fg�til'i}Efli.( 11'-\�11

My dear Lord, Your two lotus feet are so beautiful that they appear like two blossoming petals of the lotus flower which grows during the autumn season. Indeed, the nails of Your lotus feet emanate such a great effulgence that they immediately dissipate all the darkness in the heart of a conditioned soul. My dear Lord, kindly show me that form of Yours which always dissipates all kinds of darkness in the heart of a devotee. My dear Lord, You are thesupremespiritual master of everyone; therefore all conditioned souls covered with the darkness of ignorance can be enlightened by You as the spiritual master.

PURPORT

Lord Siva has thus described the bodily features of the Lord authori· tatively. Now he wants to see the lotus feet of theLord.Whenadevotee wantstoseethetranscendentalformofthe Lord,hebeginshismeditation on the Lord's body by first looking at the feet of the Lord. SnmadBhiigavatam isconsideredtobethetranscendentalsoundformoftheLord, and the twelve cantos are divided in accordance with the transcendental form of theLord. TheFirstandSecondCantosof Srl:mad-Bhiigavatam are calledthetwolotusfeetofthe Lord.Itisthereforesuggestedby LordSiva that one should first try toseethelotusfeetofthe Lord. Thisalsomeans that if one is serious about reading Srl:mad-Bhiigavatam, hemustbeginby seriouslystudyingtheFirstandSecondCantos.

The beauty of the lotus feet of the Lordiscomparedtothepetalsofa lotusflowerwhichgrowsintheautumnseason.Bynature'slaw,inautumn the dirty or muddy waters of rivers and lakes becomeveryclean. Atthat timethelotusflowersgrowinginthelakesappearverybrightandbeautiful. ThelotusfloweritselfiscomparedwiththelotusfeetoftheLord,andthe petals arecomparedwiththenailsofthefeetofthe Lord.Thenailsofthe feet of the Lord are very bright, as Brahma-samhitii testifies. Anandacinmaya-sad-ujjvala-vigrahasya: every limb of the transcendental body of the Lord is made of ananda-cinmaya-sad-ujjvala. Thus every limb is eternally bright. As sunshine dissipates the darkness of this material world, the effulgence emanating from the body of the Lord immediately dries up the darkness in the heart of the conditioned soul. In other words, everyone serious aboutunderstandingthe transcendentalscienceandseeingthetranscendentalformoftheLordmustfirstof all attempt to see the lotus feet of the Lord by studying the First and Second Cantos of Srimad-Bhiigavatam. When one sees the lotus feet of the Lord, all kinds of doubts and fears within the heart are vanquished.

Text 52] Chanting the Song Sung by Lord Siva 1089
TRANSLATION

In Bhagavad-glta it is said that in order to make spiritual progress, one must become fearless. Abhayarh sattva-sarhsuddhil;t (Bg. 16.1). Fearfulness is the result of material involvement. It is also said in Srimad-Bhiigavatam: bhayarh dvitzyabhinivesatal;t syat (Bhag. 11.2.37). Fearfulness is a creation of the bodily conception of life. As long as one is absorbed in the thought that he is this material body, he is fearful, and as soon as one is freed from this material conception, he becomes brahma-bhiita, or self-realized, and immediately becomes fearless. Brahma-bhiital;t prasanniitma (Bg. 18.54). Without being fearless, one cannot be joyful. The bhaktas, the devotees, are fearless and always joyful because they are constantly engaged in the service of the lotus feet of the Lord. It is also said:

evarh prasanna-manaso bhagavad-bhakti-yogatal;t bhagavat-tattva-vijiianarh mukta-sangasya fayate (Bhiig. 1.2.20)

By practicing bhagavad-bhakti-yoga, one becomes fearless and joyful. Unless one becomes fearless and joyful, he cannot understand the science of God. Bhagavat-tattva-vijfiiinarh mukta-sangasya fayate. This verse refers to those who are completely liberated from the fearfulness of this material world. When one is so liberated, he can really understand the transcendental features of the form of the Lord. Lord Siva therefore advises everyone to practice bhagavad-bhakti-yoga. As will be clear in the following verses, by doing so one can become really liberated and enjoy spiritual bliss.

It is also stated:

orh ajiiana-timirandhasya jiianaiijana-salakaya

cak�ur unmuitarh yena tasmai sri-gurave namal;t

The Lord is the supreme spiritual master, and the bona fide representative of the Supreme Lord is also a spiritual master. The Lord from within enlightens the devotees by the effulgence of the nails of His lotus feet, and His representative, the spiritual master, enlightens from without. Only by thinking of the lotus feet of the Lord and always taking the spiritual master's advice can one advance in spiritual life and understand Vedic knowledge.

yasya deve para bhaktir yatha deve tatha gurau

tasyaite kathita hy arthal;t prakasante mahatmana[l. (Svet. Up. 6.23)

Thus the Vedas enjoin that for one who has unflinching faith in the lotus feet of the Lord, as well as in the spiritual master, the real import of Vedic knowledge can be revealed.

1090 Srimad-Bhagavatam [Canto 4, Ch. 24

*«<(q4t�*'l4tltil?Af4:4t¥fttQijl( I qf���: �44t�J�I$!61(ll��ll

etad rupam anudhyeyam titma-suddhim abhipsattim yad-bhakti-yogo 'bhaya-da[l · sva-dharmam anuti�thattim

etat-this; rupam-form; anudhyeyam-must be meditated upon; titmaself; suddhim-purification;abhipsattim-of those who are desiring so;yatthat which; bhakti-yoga[l-the devotional service; abhaya-da[l-factual fearlessness; sva-dharmam-one's own occupational duties; anut4thattimexecuting.

TRANSLATION

My dear Lord, those who desire to purify their existence must always engage in the meditation of Your lotus feet, as described above. Those who are serious about executing their occupational duties and who want freedom from fear must take to this process of bhakti-yoga.

PURPORT

It is said that the transcendental name, form, pastimes and entourage of the Lord cannot be appreciated by the blunt material senses;therefore one has to engage himself in devotional service so that the senses may be purified and one can see the Supreme Personality of Godhead. Here, however, it is indicated that those who are constantly engaged in meditating on the lotus feet of the Lord are certainly purified of the material contamination of the senses and are thus able to see the Supreme Lord eye to eye. The word "meditation" is very popular in this age amongst the common people, but they do not know the actual meaning of meditation. However, from Vedic literature we learn that the yog"is are always absorbed in meditation upon the lotus feet of the Lord. Dhyiinavasthitatad-gatena manasii pasyanti yam yogina[l (Bhiig. 12.13.1). This is the real business of the yog"is: to think of the lotus feet of the Lord. Lord Siva therefore advises that one who is actually serious about purification must engage himself in this type of meditation or in the mystic yoga system, which will help him not only to see the Lord within constantly but to see Him eye to eye and become His associate in Vaikul).thaloka or Goloka Vrndavana.

Text 53] Chanting the Song Sung
by Lord Siva TEXT 53
1091

The word sva-dharmam (as in sva-dharmam anuti§fhatiim) indicates that the system of var(lasrama-which indicates the occupational duties of the brahma!la, k�atriya, vaiSya and sudra and which is the perfect institution for humanity-must be supported by bhakti-yoga if one at all wants security in life. Generally people think that simply by executing the occupational duties ofa brahma[�-a, k§atriya, vaisya or sudra, or the duty of a brahmacari, grhastha, vanaprastha or sannyasi, one becomes fearless or securelyattains liberation, but factually unless all these occupational duties are accompanied by bhakti-yoga, one cannot become fearless. In Bhagavadg"itii there are descriptions of karma-yoga, jiiiina-yoga, bhakti-yoga, dhyana-yoga, etc., but unless one comes to the point of bhakti-yoga, these other yogas cannot help one attain the highest perfection of life. In other words, bhakti-yoga is the only means for liberation.We find this conclusion also in Caitanya-caritamrta in a discussion between Lord Caitanya and Riimiinanda Raya regarding a human being's liberation from this material world. In that discussion Riimiinanda Raya referred to the execution of var[�-iisrama-dharma, and Lord Caitanya indicated (eho bahya) that the var!liisrama-dharma was simply external. Lord Caitanya wanted to impress upon Riimananda Raya that simply by executing the duties of var(liisramadharma one is not guaranteed liberation. Finally Ramiinanda Raya referred to the process of bhakti-yoga: sthane sthita� sruti-gatiirh tanu-viirimanobhifl (Bhiig. 10.14.3). Regardless of one's condition of life, if he practices bhakti-yoga, which begins with hearing (sruti-gatiim) the transcendental messages of the Lord through the mouths of devotees, he gradually conquers the unconquerable God.

God is known to be unconquerable, but one who submissively hears the words of a self-realized soul conquers the unconquerable. The conclusion. is that if one is serious about liberation, he not only should execute the occupational duties of var[�-asrama-dharma but should also engage in bhakti-yoga by beginning hearing from a realized soul. This process will help the devotee conquer the unconquerable Supreme Personality of Godhead and become His associate after giving up the material body.

1092 Srimad-Bhiigavatam [Canto 4, Ch. 24
54 ��'IRti¥461��:���If( I II�\lll
TEXT
bhavan bhaktimata labhyo durlabha� sarva-dehinam

bhavlin-Your Grace; bhaktimata-by the devotee; labhya�-obtainable; durlabha�-very difficult to be obtained; sarva-dehinlim-of all other living entities; svlirajyasya-of the king of heaven; api-even; abhimata�-the ultimate goal; eklintena-by oneness; iitma-vit-of the self-realized;gati�the ultimate destination.

TRANSLATION

My dear Lord, the king in charge of the heavenly kingdom is also desirous to obtain the ultimate goal of life-devotional service. Similarly, You are the ultimate destination of those who identify themselves with You [aham brahmasmi]. However, it is very difficult for them to attain You, whereas adevotee can very easily attain Your Lordship.

PURPORT

As stated in Brahma-sarhhita: vedefiU durlabham adurlabham atmabhaktau. This indicates that it is very difficult for one to attain the ultimate goal of life and reach the supreme destination, VaikuQ.thaloka or Goloka Vrndavana, simply by studying Vedanta philosophy or Vedic literature. However, this highest perfectional stage can be attained by the devotees very easily. That is the meaning of vede�u durla�ham adurlabham iitma-bhaktau. The same point is confirmed by Lord Siva in this verse. The Lord is very difficult for the karma-yogl:s, jriiina-yogfs and dhyana-yog"i"s to attain. Those who are bhakti-yogl:s, however, have no difficulty at all. In the word svariijyasya, svar refers to Svargaloka, the heavenly planet, and sviiriijya refers to the ruler of the heavenly planet, Indra. Generally, karmis desire elevation to heavenly planets, but King Indra desires to become perfect in bhakti-yoga. Those who also identify themselves as aham brahmasmi ("I am the Supreme Brahman, one with the Absolute Truth.") also ultimately desire to attain perfect liberation in the VaikuQ.tha planets or Goloka Vrndavana. In Bhagavad-gl:ta it is said:

bhaktyli mlim abhijlinliti ylivan yas casmi tattvata�

tato mam tattvato jiiatvli viSate tad-anantaram

"One can understand the Supreme Personality as He is only by devotional service. And when one is in full consciousness of the Supreme Lord by such devotion, he can enter into the kingdom of God." (Bg. 18.55)

Text 54) Chanting the Song Sung by Lord Siva svlirlijyasyapy abhimata eklintenci.tma-vid-gat* 1093

Thus if one desires to enter into the spiritual world, he must try to understand the Supreme Personality of Godhead by practicing bhakti-yoga. Simply by practicing bhakti-yoga one can understand the Supreme Lord in truth, but without such understanding, one cannot enter the spiritual kingdom. One may be elevated to the heavenly planets or may realize himself as Brahman (aharh brahmasmi), but that is not the end of realization. One must realize the position of the Supreme Personality of Godhead by bhakti-yoga; then real perfection of life is attained.

TEXT 55

� §;�H1Q4'i1� ('lijjqfq � I ��� A-n.m::1���''

tarh duraradhyam aradhya satam api durapaya ekanta-bhaktya ko vaiichet pada-miilarh vina bah*

tam-unto You; duriiriidhyam-very difficult to worship;iiriidhya-having worshiped; satiim api-even for the most exalted persons; duriipayiivery difficult to attain; ekiinta-pure; bhaktyii-by devotional service; ka[l-who is that man; viinchet-should desire; piida-mulam- lotus feet; vinii-without; bahi[l-those who are outsiders.

TRANSLATION

My dear Lord, pure devotional service is even difficult for liberated persons to discharge, but devotional service alone can satisfy You. Who will take to other processes of self-realization if he is actually serious about the perfection of life?

PURPORT

The word satam refers to transcendentalists. There are three kinds of transcendentalists: the jiiiini, yogi and bhakta. Out of these three, the bhakta is selected as the most suitable candidate to approach the Supreme Personality of Godhead. It is emphasized herein that only one who is outside devotional service would not engage in searching for the lotus feet of the Lord. Foolish people sometimes maintain that God may be attained in any way-either by karma-yoga, jiiana-yoga, dhyana-yoga, etc.-but here it is clearly stated that it is impossible to obtain the mercy of the Lord by any means but bhakti-yoga. The word duraradhya is especially significant.

1094 Srimad-Bhagavatam [Canto 4, Ch. 24

It is very difficult to attain the lotus feet of the Lord by any method other than bhakti-yoga.

TEXT 56

q;r f.wf!'RUi WI� I tim A'o�

yatra nirvi§tam arar-arh krtanto nabhimanyate visvarh vidhvarhsayan viryasaurya-visphurjita-bhruva

yatra-wherein; nirv4tam arar-am-completely surrendered soul; krtaanta�-invincible time; na abhimanyate-does not go to attack; vi§vamthe entireuniverse; vidhvarhsayan-by vanquishing; virya-prowess; sauryainfluence; visphurjita-simply by expansion; bhruvii-of the eyebrows.

TRANSLATION

Simply by expansion of His eyebrows, invincible Time personified can immediately vanquish the entire universe. However, formidable Time does not approach the devotee who has taken complete shelter at Your lotus feet.

PURPORT

In Bhagavad-gita it is said that the Lord in the shape and form of death destroys all a person's possessions. Mrtyu� sarva-haras ciiham: "I am alldevouring death." (Bg. 10.34) The Lord in the shape of death takes away everything that is created by the conditioned soul. Everything in this material world is subject to perish in due course of time. However, all the strength of time cannot hamper the activities of a devotee because a devotee takes complete shelter under the lotus feet of the Lord. For this reason only is a devotee free from formidable time. All the activities of the karmis and jiiiinis, which have no touch of devotional service, are spoiledin due course oftime. The material success of the karmis is destined to be destroyed; similarly, the impersonal realization attained by the jiianis is also destroyed in the course of time.

iiruhya krcchrerta pararh padarh tata!t patanty adho 'niidrta-yu�mad-anghraya!t (Bhiig. 10.2.32)

To say nothing of the karmis, the jniinis undergo severe austerities to attain the impersonal brahmajyoti, but because they do not find the lotus feet of the Lord, they fall down again into this material existence. Unless

Text 56] Chanting the Song Sung by Lord Siva 1095
��"PtA� ������

one is fully situated in unalloyed devotional service, there is no guarantee of liberation, even if one is elevated to the heavenly planets or to the impersonal Brahman effulgence. A devotee's achievement, however, is never lost by the influence of time. Even if a devotee cannot completely execute devotional service, in his next life he begins from the point where he left off. Such an opportunity is not given to the karmts and jiiants, whose achievements are destroyed. The bhakta's achievement is never destroyed, for it goes on perpetually, be it complete or incomplete. This is the verdict of all Vedic literatures.

sribhagavi.in uvi.ica

partha naiveha namutra

vinasas tasya vidyate na hi kalyar-a-krt kascid durgatirh tata gacchati

prapya pur-ya-krtiirh lokiin u�itvii siisvati{t samii�

suctniirh srtmatiirh gehe yoga-bhra§to 'bhijiiyate

"The Blessed Lord said: Son of Prtha, a transcendentalist engaged in auspicious activities does not meet with destruction either in this world or in the spiritualworld;one who does good,Myfriend, is never overcome by evil. The unsuccessful yogi, after many, many years of enjoyment on the planets of the pious living entities, is born into a family of righteous people, or into a family of rich aristocracy." (Bg. 6.40-41)

Thus if one is unable to complete the process of bhakti-yoga, he is given a chance in his next life to take birth in a pure family of devotees or in a rich family. In such families a person can have a good opportunity to further progress in devotional service.

When Yamariija, the superintendent of death, was instructing his assistants, he told them not to approach the devotees. "The devotees should be offered respect," he said, "but do not go near them." Thus the devotees of the Lord are not underthe jurisdiction of Yamaraja.Yamanija is a representative of the Supreme Personality of Godhead, and he controls the death of every living entity. Yet he has nothing to do with the devotees. Simplyby blinking his eyes,Timepersonified candestroy theentire cosmic manifestation, but he has nothing to do with the devotee. In other words, devotional service which is rendered by the devotee in this lifetime can never be destroyed by time. Such spiritual assets remain unchanged, being beyond the influence of time.

1096 Srimad-Bhagavatam [Canto 4, Ch. 24

TEXT 57 � � WI � ��fwt�ct( I ¥(t(q�ff� �iwn f�<tl�tt: ������

k§ar.a-ardhena-by half of a moment; api-even; tulaye-compare; nanever; svargam-heavenly planets; na-neither; apunarbhavam-merging into the Supreme; bhagavat-the Supreme Personality of Godhead; sangiassociate; sangasya-one who takes advantage of associating; martyiiniimof the conditioned soul; kimuta-what is there;iisi§a�-blessings.

TRANSLATION

If one by chance associates with a devotee, even for a fraction of a moment, he no longer is subject to attraction by the results of karma or jiiana. What interest then can he have in the benedictions of the demigods, who are subject to the laws of birth and death?

PURPORT

Out of three kinds of men-the karm"is, jniin"is, and bhaktas-the bhakta is described herein as the most exalted. Srila Prabodhananda Sarasvati has sung: kaivalyarh narakiiyate tridasapur iikiisa-pu�piiyate (Caitanyacandriimrta, 5). The word kaivalya means to merge into the effulgence of the Supreme Personality of Godhead, and the word tridasa-pur refers to the heavenly planets where the demigods live.Thus for a devotee, kaivalyasukha, or merging into the existence of the Lord, is hellish because the bhakta considers it suicidal to lose his individuality and merge into the effulgence of Brahman. A bhakta always wants to retain his individuality in order to render service to the Lord. Indeed, he considers promotion to the upper planetary systems to be no better than a will-o'-the-wisp. Temporary material happiness holds no value for a devotee. The devotee is in such an exalted position that he is not interested in the actions of karma or jniina. The resultant actions of karma and jniina are so insignificant to a devotee situated on the transcendental platform that he is not in the least interested in them. Bhakti-yoga is sufficient to give the bhakta all happiness.As stated in Snmad-Bhiigavatam: yayiitmii supras"idati (Bhiig. 1.2.6). One can be fully satisfied simply by devotional service, and that is the result of association with a devotee. Without being blessed by a

Text 57) Chanting
the Song Sung by Lord Siva
na svargarh niipunarbhavam bhagavat-sangi-sangasya martyiiniirh kimutiisi§a� 1097
k§aruirdheniipi tulaye

pure devotee, no one can be fully satisfied, nor can anyone understand the transcendental position of the Supreme Personality of Godhead.

TEXT 58

athanaghanghres tava kirti-tirthayor antar-bahi[t-snana-vidhuta-papmanam bhute�v anukrosa-susattva-silinarh syat sahgamo 'nugraha e�a nas tava

atka-therefore; anagha-anghrefl.-of my Lord, whose lotus feet destroy all inauspiciousness; tava- Your; kirti-glorification; tirthayo� - the holy Ganges water; anta� - within; bahi� - and outside; snana-taking bath; vidhiita-washed; papmanam-contaminated state of mind; bhiite§u- unto the ordinary living beings; anukrosa-benediction or mercy; su-sattvacompletely in goodness; silinam-of those who possess such characteristics; syat- let there be; sarigamaf!. - association; anugrahafl. - mercy; e�af!.-this; nafl.-unto us; tava- Your.

TRANSLATION

My dear Lord, Your lotus feet are the cause of all auspicious things and the destroyer ofall the contamination of sin. I therefore beg Your Lordship to benedict me by the association of Your devotees, who are completely purified by worshiping Your lotus feet and who are so merciful upon the conditioned souls. I think that Your real benediction will be to allow me to associate with such devotees.

PURPORT

The Ganges water is celebrated as being able to eradicate all kinds of sinful reactions. In other words, when a person takes his bath in the Ganges, he becomes freed from all life's contaminations. The Ganges water is celebrated in this way because it emanates from the lotus feet of the Supreme Personality of Godhead. Similarly, those who are directly in touch with the lotus feet of the Supreme Personality of Godhead and who are absorbed in the chanting of His glories are freed from all material contamination. Such unalloyed devotees are able to show mercy to the common

1098 Srimad-Bhagavatam [Canto 4, Ch. 24
��(­
��� �
I \a��l\lij\4��
�Cf ������

conditioned soul. Srila Vrndavana dasa 'fhiikura has sung that the devotees of Lord Caitanya are so powerful that each one of them can deliver a universe. In other words, it is the business of devotees to preach the glories of the Lord and deliver all conditioned souls to the platform of suddhasattva, pure goodness. Here the word su-sattva means suddha-sattva, the transcendental stage beyond material goodness. By his exemplary prayers, Lord Siva teaches us that our best course is to take shelter of Lord Vi��u and His Vai�l).ava devotees.

TEXT 59

na yasya cittarh bahir-artha-vibhramarh tamo-guhayarh ca visuddham avisat yad-bhaktiyoganugrhitam aiijasa munir vica§te nanu tatra te gatim

na-never; yasya-whose; cittam-heart; bah*-external; artha-interest; vibhramam-bewildered; tamaft-darkness; guhayam-in the hole;ca- also; visuddham-purified; aviSat-entered; yat-that; bhakti-yoga-devotional service;anugrhitam-being favored by;aiijasa-ha.ppily; mun*-the thoughtful; vica§te-sees; nanu-however; tatra-there; te-Your;gatim- activities.

TRANSLATION

The devotee whose heart has been completely cleansed by the process of devotional service and who is favored by the Bhaktidevi does not become bewildered by the external energy, which is just like a dark well. Being completely cleansed of all material contamination in this way, a devotee is able to understand very happily Your name, fame, form, activities, etc.

PURPORT

As stated in Snmad-Bhiigavatam: satiirh prasangiin mama virya-samvido bhavanti hrt-kar!Ja-rasiiyaniift kathii'fi.

taj-jo�ar;tiid iisv apavarga-vartmani sraddhii ratir bhaktir anukrami�yati (Bhiig. 3.25.25)

Text 59] Chanting the Song Sung by Lord Siva 1099
;{� � �" �gmt� A-��� q�·���·ooaqm af.IFf� � � ��u����

Simply by the association of pure devotees one can understand the transcendental name, fame, quality and activities of the Supreme Personality of Godhead. SrT Caitanya Mahiiprabhu has repeatedly said:

'siidhu-smiga ', 'siidhu-smiga '-sarva-siistre kaya

lavamiitra siidhu-sange sarva-siddhi haya (Cc. Madhya 22.54)

Simply by associating with a pure devotee, one becomes wonderfully advanced in Kr�J,la consciousness. Siidhu-sanga, or association with a devotee, means always engaging in Kr�J,la consciousness by chanting the Hare Kr�J,la mantra and by acting for Kr�J,la. Specifically, chanting the Hare Kr�J,la mantra purifies one, and this chanting is therefore recommended by Sri Caitanya Mahiiprabhu. Ceto-darpa'!l-a-miirjanam: by chanting the names of Kr�J,la, the mirror of the heart is cleansed and the devotee loses interest in everything external. When one is influenced by the external energy of the Lord, his heart is impure. When one's heart is not pure, he cannot see how things are related to the Supreme Personality of Godhead. !dam hi viSvarh bhagaviin ivetaro (Bhiig. 1.5.20). He whose heart is purified can see that the whole cosmic manifestation is but the Supreme Personality of Godhead, but he whose heart is contaminated sees things differently. Therefore by sat-sanga, or association with devotees, one becomes perfectly pure in heart.

One who is pure in heart is never attracted by the external energy, which urges the individual soul to try to dominate material nature. The pure heart of a devotee is never disturbed when he executes devotional service in the form of hearing, chanting, remembering, etc. In all, there are nine processes one can follow in the execution of devotional service. In any case, a pure-hearted devotee is never disturbed. The bhakti-yoga process must be carried out by avoiding the ten offenses one can commit whilechantingthe mahii-mantra andthe sixty-four offenses one can commit while worshiping the Deity. When a devotee strictly follows the rules and regulations, Bhaktidevi becomes very much satisfied with him, and at that time he is never disturbed by anything external. A devotee is also called a muni. The word muni means thoughtful. A devotee is as thoughtful as a nondevotee is speculative. The nondevotee's speculation is impure, but a devotee's thoughts are pure. Lord Kapila and Sukadeva Gosviimi are also called muni, and Vyasadeva is addressed as Mahamuni. A devotee is addressed as muni, or thoughtful,when he purely understands the Supreme Personality of Godhead.The conclusion is that when one's heart is purified by the association of devotees and by the avoidance of the offenses committed when chanting and worshiping the Lord, the transcendental name, form and activities of the Lord are revealed by the Lord.

llOO Srimad-Bhagavatam [Canto 4, Ch. 24

Chanting the Song Sung by Lord Siva

TEXT 60

� �f%� �Jfl�� �I �� iRr� ��,f'R�II� oil

yatredarh vyajyate visvarh

visvasminn avabhiiti yat

tat tvarh brahma pararh jyotir

iikasam iva vistrtam

yatra-where; idam-this; vyajyate-manifested; visvam-the universe; visvasmin-in the cosmic manifestation;avabhiiti-is manifested;yat-that; tat-that;tvam-You;brahma-the impersonal Brahman;param-transcendental;jyoti[t-effulgence;iikiisam-sky;iva-like;vistrtam-spread.

TRANSLATION

My dear Lord, You are the impersonal Brahman which is spread everywhere, like the sunshine or the sky. And You are also the entire manifested universe. Indeed, You are spread all over the universe.

PURPORT

In Vedic literature it is said that everything is Brahman and nothing else. The whole cosmic manifestation rests on the Brahman effulgence. The impersonalists, however, cannot understand how such a huge cosmic manifestation can rest on a person. Thus this inconceivable power of the Supreme Personality of Godhead is not understood by the impersonalists; therefore they are puzzled and always denying that the Absolute Truth is a person. This wrong impression is cleared by Lord Siva himself, who says that the impersonal Brahman which is spread all over the universe is nothing but the Supreme Lord Himself. Here it is clearly said that the Lord is spread everywhere,just like the sunshine,by virtue of His Brahman feature. This example is very easy to understand. All the planetary systems are resting upon the sunshine, yet the sunshine, as well as the source of sunshine, are aloof from the planetary manifestations. Similarly, the sky or air is spread everywhere;air is within a pot, but it also touches filthy places and sanctified places alike. In any case, the sky is uncontaminated. The sunshine also touches filthy places and sanctified places, and both are actually produced by the sun, but in any case the sun is aloof from all filthy things. Similarly, the Lord exists everywhere. There are pious things and impious things, but in the siistras the pious things are described as the front of the Supreme Lord, whereas impious things are described as the

Text 60]
HOI

backside of the Supreme Personality of Godhead. In Bhagavad-g"itii the Lord clearly says: mayii tatam idani sarvam jagad avyakta-miirtinii mat-sthiini sarva-bhiitiini na ciiham te�v avasthita�

"By Me, in My unmanifested form, this entire universe is pervaded. All beings are in Me, but I am not in them." (Bg. 9.4)

This verse explains that the Lord is spread everywhere by virtue of His Brahman feature. Everything rests in Him, yet He is not there. The conclusion is that without bhakti-yoga, without rendering devotional service to the Lord, even an impersonalist cannot understand the Brahma-tattva, the Brahman feature. In the Vediinta-siitra it is stated: athiito brahmajijiiiisii. This means that Brahman, Paramatma, or Parabrahman should be understood. In Srimad-Bhiigavatam also the Absolute Truth is described as the one without a second, but He is realized in three features-impersonal Brahman, localized Paramatma and the Supreme Personality of Godhead. The Supreme Personality of Godhead is the ultimate issue,and in this verse Lord Siva confirms that ultimately the Absolute Truth is a person. He clearly says: tat tvam brahma param jyotir iikiisam iva vistrtam. Here is a common example: a successful businessman may have many factories and offices, and everything rests on his order. If someone says that the entire business rests on such and such a person, it does not mean that the person is bearing all the factories and offices on his head. Rather, it is understood that by his brain or his energetic expansion, the business is running without interruption. Similarly, it is the brain and energy of the Supreme Personality of Godhead that carry on the complete manifestation of the material and spiritual worlds. The philosophy of monism, explained here very clearly, adjusts itself to the fact that the supreme source of all energy is the Supreme Personality of Godhead, I<{�I).a. This is described very clearly. It is also stated how the impersonal feature of I<{�I).a can be understood:

raso'ham apsu kaunteya prabhiismi sasi-siiryayo"fl. pra!'-ava"fl. sarva-vede�u

sabda� khe pauru�arh nr�u

"0 son.of Kunti [ Arjuna] , I am the taste of water, the light of the sun and moon, the syllable om in the Vedic mantras; I am the sound in ether and ability in man." (Bg. 7.8)

In this way Kr�I.la can be understood as the mystic power in everything.

1102 Srimad-Bhagavatam [Canto 4, Ch. 24

�ftfrA:I

�:ia\�{4:: ��iU€¥4�:�

� SHthtft:Ill\�II

yo mayayedam puru-rilpayasrjad

bibharti bhiiya� k§apayaty avikriya{l. yad-bheda-buddhi{l. sad ivatma-du{l.sthaya

tvam atma-tantram bhagavan pratimahi

ya�-one who; miiyayii- by His energy; idam-this; puru-manifold ; rU:payli-manifestation; asrjqt-created; bibharti-maintains; bhuya{l.-again; k§apayati-annihilates ; avikriya�-without being altered; yat-that ; bhedabuddhi{l.-sense of differentiation; sat- eternal; iva-like; atma-du{l.sthayagiving trouble to oneself; tvam-unto You; atma-tantram-fully selfindependent; bhagavan-0 Lord, Supreme Personality of Godhead; pratimahi-1 can understand.

TRANSLATION

My dear Lord, You have manifold energies, and these energies are manifested in manifold forms. With such energies You have also created this cosmic manifestation, and although You maintain it as if it were permanent,You ultimately annihilate it. Although You are never disturbed by such changes and alterations, the living entities are disturbed by them, and therefore they find the cosmic manifestation to be different or separated from You. My Lord, You are always independent, and I can clearly see this fact.

PURPORT

It is clearly explained that Lord Kf�l)a has multi-energies that can be grouped into three: namely the external energy, the internal energy, and the marginal energy. There are also different cosmic manifestationsnamely, the spiritual world and the material world-as well as different types of living entities. Some living entities are conditioned, and others are eternally free. The eternally free living entities are called nitya-mukta, for they never come in contact with the material energy. However, some living entities are conditioned in this material world, and thus they think themselves separated from the Supreme Lord. Due to their contact with the

Text 61] Chanting the Song Sung by
��
��q�lq:3(i(
Lord Siva TEXT 61
�
fin��\f{:
1103

material energy, their existence is always troublesome. Being always in distress, the conditioned soul considers the material energy to be very much disturbing. This fact is explained by a Vai�l).ava kavi, or poet: kmw bhuli' sei jiva aniidi-bahir-mukha/ ataeva maya tare deya samsiira-du�kha. When the living entity forgets the Supreme Lord and wants to enjoy himself independently, imitating the Supreme Lord,he is captured by the false notion that he is the enjoyer and is separated from the Supreme Lord. This material energy is therefore very muchtroublesome to the spiritual energy, the living entity, but the material energy is never troublesome to the Supreme Lord. Indeed, for the Supreme Lord, both material and spiritual energy arethe same. In this verse Lord Siva explains that the material energy is never troublesome to the Supreme Lord. The Supreme Lord is always independent, but because the living entities are not independent-due to their false idea of becoming independently happy-the material energy is troublesome. Consequently the material energy creates differentiation. Because the Mayavadi philosophers cannot understand this, they want to be relieved from the material energy. However, because a Vai�l).ava philosopher is in full knowledge of the Supreme Personality of Godhead, he finds no disturbance even in the material energy. This is because he knows how to utilize the material energy for the service of the Lord. In the government, the criminal department and civil department may appear different in the eyes of the citizens, but in the eyes of the government both departments are one and the same. The criminal department is troublesome for the criminal but not for the obedient citizen. Similarly, this material energy is troublesome for the conditioned soul, but it has nothing to do with the liberated souls who are engaged in the service of the Lord. Through the puru§a-avatiira Maha-Vi�l}.u, the Supreme Personality of Godhead created the whole cosmic manifestation. Simply by breathing out all the universes, the Lord creates and maintains the cosmic manifestation as Lord Vi�J).U. Then as Sarikar�al).a, He annihilates the cosmic manifestation. Yet despite the creation, maintenance and destruction of the cosmos, the Lord is not affected. The various activities of the Lord must be very disturbing to the tiny living entities, but since the Lord is supremely great, He is never affected. Lord Siva or any other pure devotee can see this clearly without being blinded by bheda-buddhi, or differentiation. For a devotee, the Lord is the Supreme Spirit Soul. Since He is supremely powerful, His various powers are also spiritual. For a devotee, there is nothing material, for material existence only means forgetfulness of th6 Supreme Personality of Godhead.

1104 Srimad-Bhagavatam [Canto 4, Ch. 24

\��ttlkt:'f;ooqeMi � �ij��ij � �: II��II

kriyii-kalapair idam eva yogina�

sraddhiinvitiib- siidhu yajanti siddhaye

bhutendriyiinta�karaflopalak§itarh vede ca tantre ca ta eva kovidii�

kriyii-activities; kaliipaib--by processes; idam-this; eva-certainly; yogina�-transcendentalists; sraddhii-anvitii�-with faith and conviction; sadhu-properly; yajanti-worship; siddhaye-for perfection; bhuta-the material energy; indriya-senses; anta!t-karafla-heart; upalak�itam-symptomized by; vede-in the Vedas; ca-also; tantre-in the corollaries of the Vedas; ca-also; te- Your Lordship; eva-certainly; kovidii�-those who are experts.

TRANSLATION

My dear Lord, Your universal form consists of all five elements-the senses, mind, intelligence, false ego (which is material) and the Paramatma, Your partial expansion who is the director of everything. With the exception of the devotees, the other yogis-namely the karma-yogi and joana-yogi-worship You by their respective actions in their respective positions. It is stated both in the Vedas and in the sastras that are corollaries of the Vedas, and indeed everywhere, that it is only You who are to be worshiped. That is the expert version of all the Vedas.

PURPORT

In the previous verse Lord Siva wanted to see the form of the Lord which the devotees are always interested in. There are other forms of the Lord manifest in the material world,including Brahma andother demigods, and these are worshiped by materialistic persons. In Snmad-Bhiigavatam it is stated that those who desire material benefits are recommended to worship different types of demigods.

akiima� sarva-kiimo vii mok§a-kiima udiira-dhi[t fivre!la bhakti-yogena yajeta puru§arh param (Bhiig. 2.3.10)

Text62] Chanting
ftti�IWI��i(�
the Song Sung by Lord Siva TEXT62
�: qd'�:����l
ll05

The devotees,the jiiiin"ls, who areknown as mok�a-kiima, and the karmts, who are known as sarva-kiima, are all aspiring to worship the Supreme Personality of Godhead, Vi�Q.U. Even when one performs yajiias, as stated here (kriyii-kaliipaib-), he should always remember that the demigods are but agents of the Supreme Lord. Actually the worshipful Lord is Vi�Q.u, Yajiiesvara. Thus even when different demigods are worshiped in the Vedic and Tantric sacrifices, the actual goal of sacrifice is Lord Vi�Q.U. Therefore in Bhagavad-g"ltii it is said:

ye 'py anya-devatii-bhaktii yajante sraddhayiinvitiib, te 'pi miim eva kaunteya yajanty avidhi-piirvakam

"Whatever a man may sacrifice to other gods, 0 son of Kunti, is really meant for Me alone, but is offered without true understanding."

(Bg. 9.23)

Thus the worshipers of various demigods also worship the Supreme Lord, but they do so against the regulative principles. The purpose of the regulative principles is to satisfy Lord Vi�I).U. In the Vigm Puriil)a the very same thing is confirmed:

varT}iisramiiciiravatii puru�el)a parab, pumiin vi�l)ur iiriidhyate panthii niinyat tat-to�a-kiiral)am (Vi�I)U P. 3.8.9)

Here it is clearly mentioned that the karml, Fiiin"l or yogi-in fact, everyone-worships Lord Vi�v.u if he is actually expert in knowledge of the Vedas and Tantras. The word kovidii� is very significant, for it indicates the devotees of the Lord. Only the devotees know perfectly that the Supreme Personality of Godhead, Vi�Qu, is all-pervading. Within the material energy, He is represented by the five material elements as well as the mind, intelligence and ego. He is also represented by another energy, and all these manifestations in the spiritual and material world combined are but representations of the different energies of the Lord. The conclusion is that the Lord is one and that He is expanded in everything. This is understood by the Vedic version: sarvam khalv idam brahma. One who knows this concentrates all his energy in worshiping Lord Vi�Q.U.

1106 Srimad-Bhagavatam [Canto 4, Ch. 24
TEXT 63 � 3('RI: �: mt�Rti� �R'l'*Hiiil Rfilq� I

tvam eka iidyal), puru�al), supta-saktis

tayii rajal),-sattva-tamo vibhidyate mahan aham kham marud agni-viir-dharii[l.

surar�ayo bhiita-gar-a idam yataJ:t

tvam- Your Lordship;eka{l-one;adya{l-the original;puru§a{L-person; supta-dormant;sakti{l-energy;taya-by which;raja[�,-the passion energy; sattva-goodness;tamal),-ignorance;vibhidyate-is diversified;mahan-the total material energy;aham-egotism;kham-the sky;marut-theair;agnifire; vaJ:t-water;dhariiJ:t-earth;sura-r�ayaJ:t-the demigods and the great sages;bhiita-ga[la{l-the living entities;idam-all this;yata{l-from whom.

TRANSLATION

My dear Lord, You are the only Supreme Person, the cause of all causes. Before the creation of this material world, Your material energy remains in a dormant condition. When Your material energy is agitated, the three qualities-namely, goodness, passion and ignorance-act, and as a result the total material energy-egotism, ether, air, fire, water, earth, and all the various demigods and saintly persons-becomes manifest. Thus the material world is created.

PURPORT

If the whole creation is one, that is, nothing but the Supreme Lord, or Vi�I)U, then why do the expert transcendentalists make such categories as are found in the above verse? Why do learned and expert scholars distin· guish between matter and spirit? In answer to these questions, Lord Siva says that spirit and matter are not creations of various philosophers, but are manifested by Lord Vi�I)U, as described in this verse: tvam eka iidyal), puru�a(l,. Spiritual and material categories are made possible by the Supreme Personality of Godhead, but actually there are no such distinctions for the living entities who are eternally engaged in the service of the Lord. There is only a material world for those who want to imitate the Lord and become enjoyers. Indeed, the material world is nothing but forgetfulness of the original Supreme Personality of Godhead, the creator

Text 63)
. . «:' �� +t« 41W: � � � �: ����II
Chanting the Song Sung by Lord Siva
1107

of everything. The distinction between matter and spirit is created by the sleeping energy of the Lord when the Lord wants to give some facility to those living entities who want to imitate the Lord in His enjoyment. It is only for them that this material world is created by the dormant energy of the Lord. For instance, sometimes children want to imitate their mother and cook in the kitchen, and at such a time the mother supplies them with some toys so that the children can imitate her cooking. Similarly, when some of the living entities want to imitate the activities of the Lord, this material cosmic manifestation is created for them by the Lord. The material creation is therefore caused by the Lord through His material energy.It is by the glance of the Lord that the material energy is activated. At that time the three material qualities are set into motion, and the material energy is manifested first in the form of the mahat-tattva, then egotism, then ether, then air, fire, water, and earth. After the creation, the living entities are impregnated in the cosmic manifestation, and they emerge as Lord Brahmaand the seven great [�is, then as different demigods. From the demigods come human beings, animals, trees, birds, beasts and everything else. The original cause, however, is the Supreme Personality of Godhead, as verified herein-tvam eka iidya� puru�a�. This is also confirmed in Brahma-samhitii:

"iSvara� parama[l. kr�rta� sac-cid-iinanda-vigraha� anadir iidir govinda[l. sarva-kiirarta-kiirartam

Those who are covered by the material energy cannot understand that the origin of everything is the Supreme Personality of Godhead, Kt�J).a. This is summarized in the Vedanta aphorism, janmiidy asya yata[l. (Vediinta-siltra 1.1.2). .Krgta also confirms this in Bhagavad-gitii:

aham sarvasya prabhavo matta� sarvam pravartate iti matvii bhajante miim budhii bhiiva-samanvitii[l.

"I am the source of all spiritual and material worlds. Everything emanates from Me. The wise who know this perfectly engage in My devotional service and worship Me with all their hearts." (Bg. 10.8)

When Kt�.l).a says that He is the origin of everything (aham sarvasya prabhavo), He means that He is even the source of Lord Brahma, Lord Siva,thepuru�a-avatiiras, the material manifestation and all the livingentities within the material world. Actually the word prabhava (creation) only refers to this material world, for since the spiritual world is eternally

1108 Srimad-Bhagavatam [Canto 4, Ch. 24

existing, there is no question of creation. In the catu1)slokT of Snmad­

Bhiigavatam, the Lord says: aham eviisam eviigre (Bhiig. 2.9.33). "I was existing in the beginning before the creation." In the Vedas it is also said, eko niiriiyal)a iis"it: "Before the creation there was only Narayar_la." This is also confirmed by Sarikaracarya: niiriiya'!'-a/.t paro'vyaktiit (G"itii-bhii�ya). "Narayar_la is transcendental to the creation." Since all the activities of Narayar_la are spiritual, when Narayar_la said, "Let there be creation," that creation was all-spiritual. The "material" only exists for those who have forgotten that Narayar_la is the original cause.

mtarhsva-saktyedam anupravi§.tas catur-vidharhpuram iitmiirhsakena athovidus tam puru§arh santam antar bhunktehr§"ikair madhu siira-gharh yal.t

sntam-in the creation; sva-saktyii-by Your own potency; idam-this cosmic manifestation; anupravi�ta[l-entering afterwards; catu[l-vidhamfour kinds of; puram- bodies ; iitma-arhsakena-by Your own part and parcel; atho-therefore; vidu[l-know; tam-him; puru§am-the enjoyer; santam-existing; anta[l-within; bhunkte-enjoys; hnikai[l-by the senses; madhu-sweetness; siira-gham-honey; ya[l-one who.

TRANSLATION

My dear Lord, after creating by Your own potencies, You enter within the creation in four kinds of forms. Being within the hearts of the living entities, You know them and know how they are enjoying their senses. The so-called happiness of this material creation is exactly like the bees' enjoyment of honey after it has been collected in the honeycomb.

PURPORT

The material cosmic manifestation is an exhibition of the external energy of the Supreme Personality of Godhead, but because dull matter cannot work independently, the Lord Himself enters within this material

Text 64] Chanting the Song Sung by Lord Siva 1109

creation in the form of a partial expansion (Paramatma), and He enters also by His separated parts and parcels (the living entities). In other words, both the living entities and the Supreme Personality of Godhead enter into the material creation just to make it active. As stated in Bhagavad-gitii:

apareyam itas tv anyiirh

prakrtirh viddhi me pariim

jlva-bhiitiirh mahii-biiho

yayedarh dhiiryate jagat

"Besides this inferior nature, 0 mighty-armed Arjuna, there is a superior energy of Mine, which are all living entities who are struggling with material nature and are sustaining the universe." (Bg. 7.5)

Since the material world cannot work independently, the living entities enter into the material manifestation in four different types of bodies. The word catur-vidham is significant in this verse. There are four types of living entities born within this material world. Some are born by way of an embryo (jariiyu-ja), by way of eggs (a'(ltja-ja), perspiration (sveda-ja), and, like the trees, by way of seeds (udbhij-ja). Regardless of how these living entities appear, they are all busy in the pursuit of sense enjoyment.

The materialistic scientists' contention that living entities other than human beings have no soul is nullified herein. Whether they are born through an embryo, eggs, perspiration or seeds, all living entities in the 8,400,000 species ef life are parts and parcels of the Supreme Personality of Godhead, and each therefore is an individual spiritual spark and soul. The Supreme Personality of Godhead also remains within the heart of the living entity, regardless of whether the living entity is a man, animal, tree, germ or microbe. The Lord resides in everyone's heart, and because all living entities who come to this material world do so in order to fulfill their desire for sense enjoyment, the Lord directs the living entities to enjoy their senses. Thus the Paramatmii., the Supreme Personality of Godhead, knows everyone's desires. As stated in Bhagavad-g"itii:

sarvasya ciiharh hrdi sanniv�to mattaft smrtir jiiiinam apohanarh ca I

"I am seated in everyone's heart, and from Me come remembrance, knowledge and forgetfulness." (Bg. 15.15)

Remaining within the hearts of all living entities, the Lord bestows remembrance by which the living entities can enjoy certain things. Thus the living entities create their enjoyable honeycombs and then enjoy them. The example of the bees is appropriate because when bees try to enjoy their honeycomb, they have to suffer the bites of other bees. Because bees

1110 Srimad-Bhagavatam [Canto 4, Ch. 24

bite one another when they enjoy honey, they are not exclusively enjoying the sweetness of the honey, for there is also suffering. In other words, the living entities are subjected to the pains and pleasures of material enjoyment, whereas the Supreme Personality of Godhead, knowing their plans for sense enjoyment, is aloof from them. In the Upan�ads the example is given of two birds sitting on a tree. One bird (the jiva, or living entity) is enjoying the fruits of that tree, and the other bird (Paramatma) is simply witnessing. In the Bhagavad-g"itii the Supreme Personality of Godhead as Paramatma IS described as upadra�.tii (the overseer) and anumantii (the permitter).

upadra§fiinumantii ca bhartii bhoktii mahesvara� paramiitmeti ciipy ukto dehe 'smin puru�a� para�

"Yet in this body there is another, a transcendental enjoyer, who is the Lord, the supreme proprietor, who exists as the overseer and permitter, and who is known as the Supersoul." (Bg. 13.23)

Thus the Lord simply witnesses and gives the living entity sanction for sense enjoyment. It is the Paramatma also who gives the intelligence by which the bees can construct a hive, collect honey from various flowers, store it and enjoy it. Although the Paramatma is aloof from the living entities, He knows their intentions, and He gives them facilities by which they can enjoy or suffer the results of their actions. Human society is exactly like a beehive, for everyone is engaged in collecting honey from various flowers, or collecting money from various sources and creating large empires for common enjoyment. However, after these empires are created, the bites of other nations have to be suffered. Sometimes nations declare war upon one another, and the human beehives become sources of misery. Although human beings are creating their beehives in order to enjoy the sweetness of their senses, they are at the same time suffering from the bites of other persons or nations. The Supreme Personality of Godhead as Paramatma is simply witnessing all these activities. The conclusion is that both the Supreme Personality of Godhead and the jivas enter into this material world. However, the Paramatma, or Supreme Personality ·of Godhead, is worshipable because He has arranged for the happiness of the living entity in the material world. Because it is the material world, how.ever, no one can enjoy any kind of happiness without inebriety. Material enjoyment means inebriety,whereas spiritual enjoyment means pure enjoyment under the protection of the Supreme Personality of Godhead.

Text 641 Chanting the Song Sung by
llll
Lord Siva

TEXT 65

� � �Rtoqll'$�4ft Rcti� � � 4iiW.U;{: � ll_�(�q�r�1 IIG.���

sa e�a lokan ati-cart9a-vego vikar�asi tvarh khalu kalayana�

bhiitiini bhutair anumeya-tattvo ghanavalir vayur iviiv�ahya�

sa�-that; e§a{l-this; lokan-all the planetary systems; ati-very much; cart9a-vega[l-the great force; vikar§asi-destroys; tvam- Your Lordship; khalu-however; ktilayiina[l-in due course of time; bhUttini-all living entities; bhutai�-by other living entities; anumeya-tattva[l-the Absolute Truth can be guessed; ghana-iivali{l. -the clouds; viiyu�-air; iva-like; avi§ahya[l-unbearable.

TRANSLATION

My dear Lord, Your absolute authority cannot be directly experienced, but one can guess by seeing the activities of the world that everything is being destroyed in due course of time. The force of time is very strong, and everything is being destroyed by something else-just as one animal is being eaten by another animal. Time scatters everything, exactly as the wind scatters clouds in the sky.

PURPORT

The process of destruction is going on according to the law of nature. Nothing within this material world can be permanent, although scientists, philosophers, workers and everyone else are trying to make things permanent. One foolish scientist recently declared that eventually life will be made permanent through science. Some so-called scientists are also trying to manufacture living entities within the laboratory. Thus in one way or another everyone is busy denying the existence of the Supreme Personality of Godhead and rejecting the supreme authority of the Lord. However, the Lord is so powerful that He destroys everything in the form of death. As K{�t;ta says in Bhagavad-gitii:mrtyu[l, sarva-haras ciiham. "I am all-devouring death." (Bg. 10.34) The Lord is just like death to the atheists, for He takes away everything they accumulate in the material world. Hirat;tyakasipu, the father of Prahlada, always denied the existence of the Lord, and he

1112 Srimad-Bhagavatam
[Canto 4, Ch. 24

tried to kill his five-year-old boy due to the boy's unflinching faith in God. However, in due course of time the Lord appeared as Nrsiril.hadeva and killed Hirat;�yakasipu in the presence of his son. As stated in SnmadBhagavatam, this killing process is natural. Jlvo j1vasya jlvanam: "One animal is food for another animal." (Bhag. 1.13.47) A frog is eaten by a snake, a snake is eaten by a mongoose, and the mongoose is eaten by' another animal. In this way the process of destruction goes on by the supreme will of the Lord. Although we do not see the hand of the Supreme Lord directly, we can feel the presence of that hand through the Lord's process of destruction. We can see the clouds scattered by the wind, although we cannot see how this is being done because it is not possible to see the wind. Similarly, although we do not directly see the Supreme Personality of Godhead, we can see that He controls the process of destruction. The destructive process is going on fiercely under the control of the Lord, but the atheists cannot see it.

TEXT 66

stW1¥i

�+lst+t"Et: �

pramattam uccair iti krtya-cintaya

pravrddha-lobharh v�aye�u lalasam

tvam apramatta{l sahasabhipadyase

k�ul-lelihiino 'hir ivakhum antaka{l

pramattam-persons who are mad; uccai[t-loudly; iti-thus ; krtya-to be done; cintaya-by such desire; pravrddha-very much advanced; lobham- greediness; vi$aye$u-in the matter of material enjoyment; lalasam-so desiring; tvam- Your Lordship; apramatta[l- completely in transcendence; sahasa-all of a sudden; abhipadyase-seizes them; k�ut-hungry; lelihana/:1 -by the greedy tongue; ahi/:1- snake; iva- like; akhum-mouse; antaka� -destroyer.

TRANSLATION

My dear Lord, all living entities within this material world are mad after planning for things, and they are always busy with a desire to do this or that. This is due to uncontrollable greed. The greed for material enjoyment

Text 66] Chanting the Song Sung by Lord Siva 1113
� el8(1'{ I
w;8fe,•;l)sftJtcms+t;{f*M ������

is always existing in the living entity, but Your Lordship is always alert, and in due course of time You strike him, just as a snake seizes a mouse and very easily swallows him.

PURPORT

Everyone is greedy, and everyone makes plans for material enjoyment. In his lust for material enjoyment, the living entity is described as a madman. As stated in Bhagavad-gi:tii:

prakrtel;l kriyamiir-iini gur-ail;l karmiir-i sarvasal;l ahankiira-vimuqhiitmii kartiiham iti manyate

"The bewildered spirit soul, under the influence of the three modes of material nature, thinks himself to be the doer of activities, which are in actuality carried out by nature." (Bg. 3.27)

Everything is enacted by the laws of nature, and these laws are under the direction of the Supreme Personality of Godhead. The atheists, or unintelligent men, do not know this. They are busy making their own plans, and big nations are busy expanding their empire. And yet we know that in due course of time many empires have come into existence and been destroyed. Many aristocratic families were created by the people in their extreme madness, but we can see that in the course of time those families and empires have all been destroyed. But still the foolish atheists do not accept the supreme authority of the Lord. Such foolish people unnecessarily concoct their own duties without referring to the supreme authorityof the Lord.The so-called political leaders are busy making plans to advance the material prosperity of their nation, but factually these political leaders only want an exalted position for themselves. Due to their greed for material position, theyfalsely present themselves as leaders before the people and collect their votes, although they are completely under the grip of the laws of material nature. These are some of the faults of modern civilization. Without taking to God consciousness and accepting the authority of the Lord, the living entities become ultimately confused and frustrated in their planmaking attempts. Due to their unauthorized plans for economic development, the price of commodities is rising daily all over the world, so much so that it has become difficult for the poorer classes, and they are suffering the consequences. And due to lack of Kr�Q.a consciousness, people are being fooled by so-called leaders and planmakers.

1114 Srimad-Bhagavatam [Canto 4, Ch. 24 ·

Consequently, the sufferings of the people are increasing. According to the laws of nature, which are hacked by the Lord, nothing can he permanent within this material world; therefore everyone should he allowed to take shelter of the Absolute in order to be saved. In this regard, Lord K{�l).a says in Bhagavad-gzta:

bhoktaram yajna-tapasam

sarva-loka-mahesvaram

suhrdam sarva-bhutanam

jnatva mam santim rcchati

"The sages, knowing Me as the ultimate purpose of all sacrifices and austerities, the Supreme Lord of all planets and demigods and the bene· factor and well-wisher of all living entities, attain peace from the pangs of material miseries." (Bg. 5.29)

If one wants peace of mind and tranquility in society, he·must accept the fact that the real enjoyer is the Supreme Personality of Godhead. The Lord is the proprietor of everything all over the universe, and He is the supreme friend of all living entities as well. By understanding this, people can become happy and peaceful individually and collectively.

TEXT 67 4M'ii�C(IiGIN:st«IRt�

�Scc+ll'1otftf+l1'14il'1:

Nf814U41tg�Rt

f4;ftqqf4t ��

11�"11

kas tvat-padabjam vijahati part{lito yas te 'vamana-vyayamiina-ketanal;l.

vi.Sankayasmad-gurur arcati sma yad vinopapattirh manavas caturdasa

ka�-who; tvat-Your; pada-abjam-lotus feet; vijahiiti-avoids ; pa[L{iita�learned; ya�-who; te-unto You; avamana-deriding; vyayamana-decreasing; ketana� - this body; visankaya-without any douht; asmat-our ; guru{tspiritual master, father; arcati-worships; sma-in the past; yat-that; viniiwithout; upapattim-agitation; manava[l-the Manus; caturdasa-fourteen in number.

Text 67] Chanting the Song Sung by Lord Siva 1115
�
41

My dear Lord, any learned person knows that unless he worships You, his entire life is spoiled. Knowing this, how could he give up worshiping Your lotus feet? Even our father and spiritual master, Lord Brahma, unhesitatingly worshiped You, and the fourteen Manus followed in his footsteps.

PURPORT

The word patp}ita means "a wise man."Who is actually a wise man? The wise man is described in Bhagavad-gitii in this way:

bahunam janmaniim ante jnanaviin mam prapadyate viisudeva[l, sarvam iti sa mahatma sudurlabha[l,

"After many births and deaths, he who is actually in knowledge surrenders unto Me, knowing Me to be the cause of all causes and all that is. Such a great soul is very rare." (Bg. 7.19)

Thus when the wise man actually becomes wise after many births and whimsical attempts at self-realization, he surrenders unto the Supreme Personality of Godhead, J<.r�Q.a. Such a mahiitmii, or learned person, knows that J<.r�qa, Vasudeva, is everything (viisudeva[l, sarvam iti). Learned persons always think that life is wasted unless they worship Lord Kr�I;J.a or become His devotee. Srila Rupa Gosvami also says that when one becomes an advanced devotee he understands that he should be reserved and perseverent (k�anti[l,) and that he should engage in the service of the Lord and not waste time (avyartha-kalatvam)_ He should also be detached from all material attraction (virakti[l,), and he should not long for any material respect in return for his activities (miina-sunyatii). He should be certain that K.r�I;J.a will bestow His mercy upon him (iisii-bandha/;1.), and he should always be very eager to serve the Lord faithfully (samutkart.thii). The wise man is always very eager to glorify the Lord by chanting and hearing (niima-giine sadii ruci[l,) and he is always eager to describe the transcendental qualities of the Lord (iisaktis tad-gurtiikhyiine ) . He should also be attracted to those places where the Lord had His pastimes (pntis tad-vasati-sthale). These are symptoms of an advanced devotee.

An advanced devotee or a perfect human being who is actually wise and learned cannot give up his service at the lotus feet of the Lord. Although Lord Brahma has a long life span (4,320,000,000 years constitute twelve hours in a day of Brahma), Brahma is nonetheless afraid of death and con-

1116 Srimad-Bhagavatam [Canto 4, Ch. 24
TRANSLATION

sequently engaged in the devotional service of the Lord. ffi1nilarly,all the Manus who appear and disappear during the day of Brahma are also engaged in the Lord's devotional service. In Brahma's one day, fourteen Manus appear and disappear. The first Manu is Svayambhuva Manu. Each Manu livesfor seventy-one yugas, eachconsisting of some 4,320,000 years. Although the Manus have such a long life span, they still prepare forthe next life by engaging in the devotional service of the Lord. In this age human beings only live for sixty or eighty years, and even this small life span is gradually decreasing. Therefore it is even more imperative for human beings to take to the worship of the lotus feet of the Lord by constantly chanting the Hare Kr�J}.a mantra, as recommended by Lord Caitanya Mahaprabhu.

trP-iid api sun'icena taror iva sah�[lunii amiininii miinadena k'irtan'iya� sadii hari�

When one is engaged in devotional service, he is often surrounded by envious people,and often manyenemiescome to try to defeat him or stop him. This is not new in this present age, for even in the days of yore Prahlada Maharaja,who was engaged in the devotional service of the Lord, was harassedby hisdemonic father,HiraJ].yakasipu. The atheists are always prepared to harass a devotee; therefore Caitanya Mahiiprabhu suggested that one be verytolerant of these people. Nonetheless,one has to continue chanting theHare Kr�J}.a mantra and preaching the chanting of this mantra because such preaching and chanting constitute the perfection of life. One should chant and preach about the urgency of making this life perfect in all respects. One should thus engage in the devotional service of the Lord and follow in the footsteps of previous iiciiryas, beginning with Lord Brahma and others.

TEXT 68

3I1J �;itQI't.Q(¥U€¥1W(MQfiMI(I fW �'4\f.l«tfitij� �:II'\�II

atha tvam asi no brahman paramiitman vipascitiim viSvam rudra-bhaya-dhvastam

akutascid-bhayii gat*

atka-therefore;tvam-my Lord, Yourself;asi-are; na�-our; brahman0 Supreme Brahman; paramiitman-0 Supersoul; vipaJcitiim-for the learned wise men; visvam-the whole universe; rudra-bhaya-being afraid

Text 68) Chanting the Song Sung by Lord Siva 1117

of Rudra; dhvastam-annihilated; akutascit-bhaya-undoubtedly fearless; gati�- destination.

TRANSLATION

My dear Lord, all actually learned persons know You as the Supreme Brahman and the Supersoul. Although the entire universe is afraid of Lord Rudra, who ultimately annihilates everything, for the learned devotees You are the fearless destination of all.

PURPORT

For the purpose ofcreation, maintenance andannihilation of this cosmic manifestation, there are three lords-Brahma, Vi�Q.U and Siva (Mahesvara). The material body isfinished at thetime ofannihilation.Both the universal body and the small unit, the individual living entity's body, are susceptible to annihilation at the ultimate end. However, the devotees do not fear the annihilation of the body, for they are confident that they will go back home, back to Godhead, after the annihilation. As stated in Bhagavad-gitii.:

janma karma ca me divyam evarh yo vetti tattvata� tyaktvii. deharh punar janma naiti mii.m eti so 'rjuna

"One who knows the transcendental nature of My appearance and activities does not, upon leaving the body, take his birth again in this material world, but attains My eternal abode, 0 Arjuna." (Bg. 4.9)

If one strictly follows the process of devotional service, he has no fear of death, for he is predestined to go back home, back to Godhead. The nondevotees are fearful of death because they have no guarantee of where they are going or of the type of body they are going to get in their next life. The word rudra-bhaya is significant in this verse because Rudra ·himself, Lord Siva, is speaking of "fear of Rudra." This indicates that there are many Rudras-eleven Rudras-and the Rudra (Lord Siva) who was offering this prayer to the Supreme Personality of Godhead is different from the other Rudras, although he is as powerful as they are. The conclusion is that one Rudra is afraid of another Rudra because each and every one of them is engaged in the destruction of this cosmic manifestation. But for the devotee, everyone is afraid of Rudra, even Rudra himself. A devotee is never afraid of Rudra because he is always secure, being protected by the lotus feet of the Lord. As Sri Kr�Q.a says in Bhagavad-gitii.:

1118 Srimad-Bhagavatam [Canto 4, Ch. 24

Chanting the Song Sung by Lord Siva

k�iprarit bhavati dharmiitmii sasvac-chiintirit nigacchati kaunteya pratijiinmi na me bhakta� prar-asyati

"He quickly becomes righteous and attains lasting peace. 0 son of Kunti, declare it boldly that My devotee never perishes." (Bg. 9.31)

TEXT

idarit japata bhadrarit vo visuddhii nrpa-nandaniift sva-dharmam anuti�.thanto bhagavaty arpitiisayiift

idam- this; japata-while chanting; bhadram-all auspiciousness; vaft- all of you; visuddhiift-purified; nrpa-nandaniift-the sons of the king; svadharmam- one' s occupationalduties; anuti�. thanta� - executing; bhagavatiunto the Supreme Personality of Godhead; arpita-given up; iisayiiftpossessing all kinds of faithfulness.

TRANSLATION

My dear sons of the King, just execute your occupational duty as kings with a pure heart. Just chant this prayer fixing your mind on the lotus feet of the Lord. That will bring you all good fortune, for the Lord will be very much pleased with you.

PURPORT

The prayers offered by Lord Siva are very authoritative and significant. Simply by offering prayers to the Supreme Lord one can become perfect, even though engaged in his occupational duty. The real purpose of life is to become a devotee of the Lord. It does not matter where one is situated. Whether one is a brahmar-a, kfiatriya, vaisya, sudra, American, Englishman, Indian, etc., one can execute devotional service anywhere and everywhere in the material existence simply by offering prayers unto the Supreme Personality of Godhead. The Hare l<.t�qa mah'ii-mantra is also a prayer, for a prayer addresses the Supreme Personality of Godhead by His name and invokes good fortune by petitioning the Lord to allow one to engage in His devotional service. The Hare KP;lQa maha-mantra also says, "My dear Lord Kt�Qa, my dear Lord Rama, 0 energy of the Lord, Hare, kindly

Text 69]
1119
¥�•1i:t�fit"6•'l8qu����u
69 � � �crt � iqi1�;n:I

engage me in Your service." Although one may be lowly situated, he can execute devotional service under any circumstance, as stated, ahaituky apratihata (Bhag. 1.2.6). "Devotional service cannot be checked by any material condition." Lord Caitanya Mahaprabhu also recommended this process:

jiiane prayasam udapasya namanta eva jivanti san-mukharitam bhavadiya-vartam sthiine sthitii[l. sruti-gatiim tanu-viin-manobhir ye priiyaso ]ita jito 'py asi tais tri-lokyam (Bhag. 10.14.3)

One may remain situated in his own place or in his own occupational duty and still lend his ear to receive the message of the Lord from realized souls. The l<f�Q.a conscious movement is based on this principle, and we are opening centers all over the world to give everyone a chance to hear the message of Lord Kt�Q.a in order to go back home, back to Godhead.

TEXT 70

'l.;ifq-f ��� Qllqkitqliji(R(ll\9oII

tam evatmanam atma-stham sarva-bhii.te�v avasthitam

pujayadhvam grrwntas ca dhyiiyantas ciisakrd dharim

tam-unto Him; eva-certainly; atmanam-the Supreme Soul; atmastham-within your hearts; sarva-all; bhiite§u-in every living being; avas thitam-situated ; piijayadhvam-just worship Him;grrantaft ca-always chanting; dhyayanta[l. ca-always meditating upon; asakrt-continually; harim-the Supreme Personality of Godhead.

TRANSLATION

Therefore, 0 sons of the king, the Supreme Personality of Godhead Hari is situated in everyone's heart. He is also within your hearts. Therefore chant the glories of the Lord and alway s meditate upon Him continually.

PURPORT

The word asakrt is significant, for it means not just for a few minutes but continually.This is the instruction given by Lord Caitanya Mahiiprabhu in His Sik�a�Jaka. Kirtan"iyal;l sada haril;l. "The holy name of the Lord should be chanted twenty-four hours daily." Therefore in this Kt�Q.a consciousness

1120 Srlmad-Bhagavatam [Canto 4, Ch. 24
ricn�IWC¥ti�W �6�ct�6(I

movementwe request the devoteesto chantat least sixteen rounds on their beads daily. Actually one has to chant twenty-four hours daily, just like Thiikura Haridasa, who was chanting the Hare Kr��a mantra 300,000 times daily. Indeed, he had no other business. Some of the Gosvamis like Raghunatha dasa Gosvami were also chanting very rigidly and also offering obeisances very rigidly. As stated in Srinivasacarya's prayer to the six Gosvamis ($af}-gosviimy-a§,taka): smikhyii-piirvaka-niima-giinanatibhi[l kiiliivasiinikrtau. The word sankhyii-purvaka means "maintaining a numerical strength." Not only was Raghunatha dasa Gosvami chanting the holy name of the Lord, but he was also offering obeisances in the same prolific numbers.

Because the princes were ready to enter into some severe austerity in order to worship the Lord, Lord Siva advised them to constantly chant and meditate upon the Supreme Personality of Godhead. It is significant that Lord Siva personally offered his prayers to the Supreme Personality of Godheadjust as he was taught by his father, Lord Brahma. Similarly, he was also preaching to the princes according to the paramparii system. One should not onlypracticethe instructions receivedfrom the spiritual master but should also distribute this knowledge to his disciples.

The words iitmiinam iitma-stham sarva-bhute�v avasthitam are also significant. The Personality of Godhead is the origin of all living entities. Because the living entities are parts and parcels of the Lord, He is the father of all of them. One can search out the Supreme Lord very easily within his heart, for He is situated in every living entity's heart. In this verse the process of worshiping the Lord is considered to be very easy and complete, for anyone can sit down anywhere and in any condition of life and simply chant the holy names of the Lord. By chanting and hearing, one automatically engages in meditation.

8M!4<:tU I

l({tC(P.I�<:tlt<:tUll\9 �II

yogiidesam upiisiidya

dhiirayanto muni-vratiift

samiihita-dhiyaft sarva

etad abhyasatiidrtiift

yoga-adesam-this instruction of bhakti-yoga; upasadya-constantly reading; dharayantaft-and taking within the heart;muni-vrataft-just take the vow of the great sages, the vow of silence; samahita-always fixed in

Text 71) Chanting the Sbng Sung by Lord Siva 1121

the mind; dhiya�-with intelligence; saroe-all of you; etat-this; abhyasatapractice; adrta�-with great reverence.

TRANSLATION

My dear princes, in the form of a prayer I have delineated the yoga system of chanting the holy name. All of you should take this important stotra within your minds and promise to keep it in order to become great sages. By acting silently like a great sage and by giving attention and reverence, you should practice this method.

PURPORT

In the ha.tha-yoga system one has to practice bodily exercises, dhyiina, dhiirar.ii, iisana, meditation, etc. One also has to sit in one place in a particular posture and concentrate his gaze on the tip of the nose. There are so many rules and regulations for the ha.tha-yoga system that it is practically impossible to perform it in this age. The alternative system of bhakti-yoga is very easy not only in this age but in others as well, for this yoga system was advocated long ago by Lord Siva when he advised the princes, the sons of Maharaja Pracinabarhi�at. The bhakti-yoga system is not newly introduced, for even five thousand years ago Lord Kr�l).a recommended this bhakti-yoga as the topmost yoga. As K.r�IJa tells Arjuna in Bhagavad-gitii:

yoginam api saroe�iirh

mad-gateniintariitmanii

sraddhiivan bhajate yo miirh

sa me yuktatamo mata�

"Of all yogis, he who always abides in Me with great faith, worshiping Me in transcendental loving service, is most intimately united with Me in yoga and is the highest of all." (Bg. 6.47)

In other words, this system of bhakti-yoga has been existing from time immemorial and is now continuing in this K.r�IJa consciousness movement.

The word muni-vratiil). is significant in this regard because those who are interestedin advancing in spiritual life mustbe silent.Silence means talking only of Krfir-a-kathii. This is the silence of Maharaja Ambari�a:

sa vai mana!). krfir-a-padiiravindayor vaciirhsi vaikur.tha-gur.iinuvarr.ane

"King Ambari�a always fixed his mind on the lotus feet of the Lord and talked of Him only." (Bhiig. 9.4.18) We should also take this opportunity

1122 Srimad-Bhagavatam [Canto 4, Ch. 24

in life to become as good as a great saint simply by not talking unnecessarily with unwanted persons. We should either talk of l<.t�I.J.a or chant Hare l<.t�I.J.a undeviatingly. This is called muni-vrata. The intelligence (samiihita-dhiya"tt) must be verysharp and should alwaysbe acting in l<.t�I.J.a consciousness. The words etad abhyasatiidrtii� indicate that if one takes these instructions from a spiritual master with great reverence (iidrta) and practices themaccordingly,he will find this bhakti-yoga process tobevery, very easy.

TEXT 72

� ���14t � A'�qflm: I

t*il�'11¥41€+1il1Rf.: 4Rt@61(11"'�11

idam aha puriismiikam bhagaviin viSvasrk-pati� bhrgv-iidiniim iitma-jiiniim sisrk§u{l, samsisrk§atiim

idam-this; iiha-said; purii-formerly; asmiikam- unto us; bhagaviin- the lord; visva-srk-the creators of the universe; pat*-master; bhrgu-iidiniimof the great sages headed by Bhrgu; iitma-jiiniim-of his sons; sisrk§u�desirous to create; sarhsisrk§atiim-who are in charge of creation.

TRANSLATION

This prayer was first spoken to us by Lord Brahma, the master of all creators. The creat-ors, headed by Bhrgu, were instructed in these prayers because they wanted to create.

PURPORT

Lord Brahma was created by Lord Vi�I.J.u; then Lord Brahma created Lord Siva and other great sages headed by Bhrgu Muni. These great sages included Bhrgu, Marici, A.treya, Vasi��ha and others. All these great sages were in charge of creating population. Since there were not very many living entities in the beginning, Vi�QU entrusted Brahma with the business of creation, and Brahma in his turn created many hundreds and thousands of demigods and great sages to continue with the creation. At the same time, Lord Brahma cautioned all his sons and disciples by reciting the prayers now recited by Lord Siva. The material creation means material engagement, but material engagements can be counteracted if we always remember our relationship with the Lord as that relationship is described in these prayers recited by Lord Siva. In this way we can remain constantly

Text 72] Chanting the Song Sung by Lord Siva 1123

in touch with the Supreme Personality of Godhead. Thus despite our engagement in the creation, we cannot be deviated from the path of Kf�J)a consciousness. The Kf�J)a consciousness movement is especially meant for this purpose. In this material world everyone is engaged in some particular occupational duty which is prescribed in the varrtiisrama-dharma. Briihmartas, k§atriyas, vaisyas, siidras and everyone are engaged in their occupationalduty,but if one remembers his first duty-keeping in constant contact with the Supreme Personality of Godhead-everything will be successful. If one simply executes the rules and regulations of the var[liisrama-dharma in the role of a briihma[la, k§atriya, vaisya, sudra, and keeps busy and does not remember one's eternal relationship with the Lord, one's business and activities as well as occupational duties will simply be a wasteof time. This is confirmedin the First Canto of Srimad-Bhiigavatam:

dharma� svanu§.thita� pumsiim vi�vaksena-kathiisu ya�

notpiidayed yadi ratim srama eva hi kevalam (Bhiig. 1.2.8)

The conclusion is that even if one is busy executing his occupational duty, his business in Kr�J)a consciousness need not be hampered. He has simply to execute the devotional service of sravartarit k"irtanam-hearing, chanting, and remembering. One need not abandon his occupational duty. As stated in Bhagavad-g"itii:

yata� pravrttir bhiitiiniim yena sarvam idam tatam sva-karmartii tam abhyarcya siddhim vindati miinava�

"By worship of the Lord-who is the source of all beings and who is all-pervading-man can, in the performance of his own duty, attain perfection." (Bg. 18.46)

Thus one can continue with his occupational duty, but if he worships the Supreme Personality of Godhead as Lord Siva herein prescribes, he attains his perfection of life. Svanu�thitasya dharmasya samsiddhir harito§a!lam (Bhiig. 1.2.13). We should continue executing our occupational duties, but if we try to satisfy the Supreme Personality of Godhead by our duties, then our lives will be perfected.

1124 Srimad-Bhagavatam [ Canto 4, Ch. 24
TEXT 73 �� �: � �mif�: I �\i4�ij4\(U��AA1fl:�: ll\9�11

Chanting the Song Sung by Lord Siva

te vayam nodita[l sarve pra]a-sarge prajesvara[l anena dhvasta-tamasa[l sisrk�mo vividha[l praja[l

te- by him; vayam- all of us; noditalt-ordered; sarve-all;praja-sarge-at the time of creating population; praja-Tsvara[l-the controllers of all living entities; anena-by this; dhvasta-tamasalt-being freed from all kinds of ignorance;sisrk�malt-we created;vividha[l-various kinds of;prajiilt-living entities.

TRANSLATION

When all Prajapatis were ordered to create by Lord Brahma, we chanted these prayers in praise of the Supreme Personality of Godhead and became completely free from all ignorance. Thus we were able to create different types of living entities.

PURPORT

In this verse we can understand that the various types of living entities were created simultaneously at the very beginning of the creation. The nonsensical Darwinian theory of evolution is not applicable here. It is not that intelligent human beings did not exist millions of years ago. On the contrary, it is understood that the most intelligent creature, Lord Brahma, was first created. Then Lord Brahma created other saintly sages like Marici, Bhrgu, Atreya, Vasi�tha, Lord Siva and others. They in their turn created different types of bodies according to karma. In Sr"imad-Bhiigavatam Lord Kapiladeva told His mother that the living entity gets a particular type of body in accordance to his work and that this body is decided upon by higher authorities. The higher authorities, as appointed by the Supreme Personality of Godhead, are Lord Brahmii. and all other Prajapatis and Manus. Thus from the beginning of creation it can be seen that the first creature is the most intelligent. It is not that so·called modern intelligence has developed by the gradual process of evolution. As stated in Brahmavaivarta Purii[la, there is a gradual evolutionary process, but it is not the body that is evolving. All the bodily forms are already there. It is the spiritual entity or spiritual spark within the body that is being promoted by the laws of nature under the supervision of superior authority. We can understand from this verse that from the very beginning of creation different varieties of living entities were existing. It is not that some of them have become extinct. Everything is there; it is due to our lack of knowledge that we cannot see things in their proper perspective.

In this verse the word dhvasta-tamasa[! is very important, for without

Text 73]
1125

being free of ignorance one cannot control the creation of different types of living entities. As stated in Srimad-Bhiigavatam, daiva-netrerta- bodies are awarded under the supervision of superior powers. How can these superior powers control the evolutionary process of the living entity if they are not free from all imperfection? The followers of the Vedic instructions cannot accept the Darwinian theory of evolution, for it is marred by imperfect knowledge.

TEXT 74

31M(I�� 31i�t1Rt 1:41ij�E4q(i�: 11�\lll

athedarh nityadii yukto japann avahita[l. pumiin aciriic chreya iipnoti viisudeva-pariiya!lafi.

atha-thus; idam- this; nityadii- regularly ; yukta[l.- with great attention; japan- by murmuring; avahita[l.-fully attentive; pumiin-a person; aciriitwithout delay; sreya[l.-auspiciousness; iipnoti-achieves; viisudevapariiya!lafi.-one who is a devotee of Lord l<.f�l).a.

TRANSLATION

A devotee of Lord Kr�qa whose mind is always absorbed in Him, who with great attention and reverence chants this stotra [prayer] , will achieve the greatest perfection of life without delay.

PURPORT

Perfection means becoming a devotee of Lord Kr�l).a. As stated in the First Canto of Srimad-Bhiigavatam: viisudeva-parii vedii viisudeva-parii makhii[l. (Bhiig. 1.2.28). The ultimate goal of life is Vasudeva, or l<.f�qa. Any devotee of Lord l<.f�qa can attain all perfection, material gains and liberation simply by offering prayers to Him. There are many varieties of prayers to Lord l<.f�qa chanted by great sages and great personalities such as Lord Brahma and Lord Siva. Lord Kr�qa is known as siva-viriiici-nutam (Bhiig. 11.5.33). Siva means Lord Siva, and viriiici means Lord Brahma. Both of these demigods are engaged in offering prayers to Lord Vasudeva, l<.f�qa. If we follow in the footsteps of such great personalities and become devotees of Lord l<.f�qa, our lives become successful. Unfortunately people do not know this secret. Na te vidu[l. sviirtha-gatirh hi vi�T}Um (Bhiig. 7 .5.31 ). "They do not know that the real interest and the highest perfection of life

1126 Srimad-Bh�gavatam [Canto 4, Ch. 24
���
�qi5\1:4�:�1

is to worship Lord Vi�J,lu [Kr�J.la] ."It is impossible to become satisfied by trying to adjust the external energy. Without being a devotee of Lord l<_r�T).a, one can only be baffled and confused. To save living entities from such a calamity, Lord Kr�T).a points out in Bhagavad-gita:

bahiinarit janmanam ante

jnanavan marit prapadyate vasudeva� sarvam iti sa mahatma sudurlabha�

"After many births and deaths, he who is actually in knowledge surrenders unto Me, knowing Me to be the cause of all causes and all that is. Such a great soul is very rare." (Bg. 7 .19)

We can achieve whatever benediction we want simply by becoming devotees of Vasudeva.

TEXT 75

il�etfitii �'If � f;r:�� 1 � � � ll\9�11

sreyasiim iha sarve�iim

jiiiinarh nil;tsreyasam param sukham tarati du�piiram

jiiiina-naur vyasaniirr-avam

sreyasiim- of all benedictions; iha-in this world; sarve�iim-of every person; j1iiinam-knowledge; nil;tsreyasam- the supreme benefit; paramtranscendental; sukham-happiness; tarati-crosses over; du�piiraminsurmountable; jl'iiina-knowledge; nau�-boat; vyasana-danger; arr-avamthe ocean.

TRANSLATION

In this material world there are different types of achievement, but of all of them the achievement of knowledge is considered to be the highest because one can cross the ocean of nescience only on the boat of knowledge. Otherwise the ocean is impassable.

PURPORT

Actually everyone is suffering within this material world due to ignorance. Every day we see that a person without knowledge commits some criminal act and is later arrested and punished, despite the fact that he actually may not have been conscious of his sinful activity. Such ignorance prevails throughout the world. People do not consider how they are risking

Text 75] Chanting the Song Sung by Lord Siva 1127

their lives in an attempt to have illicit sex life, kill animals to satisfy their tongue, enjoy intoxication and gamble. It is very regrettable that the leaders of the world do not know of the effects of these sinful activities. They are instead taki� things very easily and are succeeding in making the ocean of nescience wider and wider.

Opposed to such ignorance, full knowledge is the greatest achievement within this material world. We can practically see that one who has sufficient knowledge is saved from many dangerous pitfalls in life. As stated in Bhagavad-gitti:

bahiiniirh janmantim ante

jiitinavtin mtirh prapadyate vtisudeva� sarvam iti

sa mahtitmti sudurlabha�

"After many births and deaths,hewho is actually in knowledge surrenders unto Me, knowing Me to be the cause of all causes and all that is. Sucha great soul is very rare." (Bg. 7 .19)

This Kr�l).a consciousness movement is determined to open wide the eyes of the so-called leaders who are full of ignorance and thus save them from the many pitfalls and dangerous conditions of life. The greatest danger is the danger of getting a body lower than a human being. It was with great difficulty that we attained this human form of life just to take advantage of this body and reestablish our relationship with the Supreme Personality of Godhead, Govinda. Lord Siva advises, however, that those who take advantage of his prayers will very soon become devotees of Lord Vasudeva and thus will be able to cross the ocean of nescience and make life perfect.

TEXT 76 � � � � 'llfui+t•liil&tiif¥(I � §l(towt m¥tl(llil44�446111"'���

ya imam sraddhaya yukto

mad-gTtarh bhagavat-stavam

adhTyano duraradhyarh

harim aradhayaty asau

ya�-anyone; imam-this;sraddhaya-with greatfaith;yukta�-devoutly attached; mat-gitam-the song composed by me or sung by me; bhagavatstavam-a prayer offered to the Supreme Personality of Godhead; adhiyana[l.-by regular study; duraradhyam-very difficult to worship;

1128 Srimad-Bhagavatam [Canto 4, Ch. 24

harim-the Supreme Personality of Godhead; iiriidhayati-he can, however, worship Him; asau-such a person.

TRANSLATION

Although rendering devotional service to the Supreme Personality of Godhead and worshiping Him are very difficult, if one vibrates or simply reads this stotra [prayer] composed and sung by me, he will very easily be ableto invokethe mercy of the Supreme Personality of Godhead.

PURPORT

It is especially significant that Lord Siva is a pure devotee of Lord Vasudeva. Vai§r-avtintirh yathti sambhuft: "Amongst all Vai�J]avas, Lord Siva is the topmost." Consequently Lord Siva has a sampradtiya, a Vai�J]ava disciplic succession, called Rudra-sampradaya. At the present moment those who belong to the Vi�!]usvami-sampradaya of Vai�p.avas come from Rudra, Lord Siva. To become a devotee of Lord I<J�J]a, Vasudeva, is very, very difficult. The word especially used in this connection is durtirtidhyam. The worship of the demigods is not very difficult, but becoming a devotee of Lord Vasudeva, Kr�J]a, is not so easy. However, if one adheres to the principles and follows in the footsteps of the higher authorities, as advised by Lord Siva, he can easily become a devotee of Lord Vasudeva. This is also confirmed by Prahlada Maharaja. Devotional service cannot be practiced by a mental speculator. Devotional service is a special attainment which can be acquired only by a person who has surrendered unto a pure devotee. As confirmed by Prahlada Maharaja, mahiyastirh ptida-rajo 'bhi§ekarh ni§kiiicantintirh na vrr-itaytivat: "Unless one accepts the dust of the lotus feet of a pure devotee, who is free from all material contamination, one cannot enter into the devotional service of the Lord." (Bhtig. 7.5.32)

TEXT 77

� �Sfl"liQQ�'I'4�f4(1fH( I

•t:�a•ihn�stH11,..�(11�*48¥ffi( II�\911

vindate puru�o 'mu�miid yad yad icchaty asatvaram mad-gzta-gztiit su-pritiic chreyasiim eka vallabhiit

vindate-achieves; puru�alt-a devotee; amu�mat-from the Personality of Godhead; yat yat- that which; icchati-desires;asatvaram-beingfixed;

Text 77) Chantingthe Song Sung by Lord Siva 1129

mat-gita-sung by me; gl:tiit-by the song; su-pntiit-from the Lord who is very pleased; sreyasiim-of all benediction; eka-one; vallabhiit-from the dearmost.

TRANSLATION

The Supreme Personality of Godhead is the dearmost objective of all auspicious benedictions. A human being who sings this song sung by me can please the Supreme Personality of Godhead. Such a devotee, being fixed in the Lord's devotional service, can acquire whatever he wants from the Supreme Lord.

PURPORT

As stated in Bhagavad-gitii, yam labdhvii ciipararh liibharh manyate niidhikarh tatal).: "Established thus, one never departs from the truth, and upon gaining it he thinks there is no greater gain." (Bg. 6.22) If one can attain the favor of the Supreme Personality of Godhead, he has nothing to aspire for, nor does he desire any other gain. When Dhruva Maharaja became perfect by austerity and saw the Supreme Personality of Godhead eye to eye, he was offered any kind of benediction he wanted. However, Dhruva replied that he did notwant anything, for he was perfectly satisfied with the benediction of seeing the Lord. Except for the service of the Supreme Lord, whatever we want is called illusion, miiyii. Sri Caitanya Mahaprabhu said: jivera 'svarupa' haya-krfirtera 'nitya-dasa' (Cc. Madhya 20.108). Every living entity is an eternal servant of the Lord; therefore when one engages in the service of the Lord, he realizes the highest perfection of life. A faithful servant can fulfill any desire by the grace of the master, and one who engages in the transcendental loving service of the Lord has nothing to aspire for separately. All his desires are fulfilled simply by engaging constantly in the Lord's loving service. Lord Siva shows us that any devotee can be successful simply by chanting the prayers which he has recited.

TEXT 78

{(�:���:��: I

1'*4Miitit.4t� � 11�11

idarh ya� kalya utthaya praiijali/:1. sraddhayiinvita/:1.

srr-uyiic chravayen martyo mucyate karma-bandhanail).

1130 Srimad-Bhagavatam [Canto 4, Ch. 24

idam-this prayer; ya/.1.-a devotee who; kalye-early in the morning; utthiiya-after getting up from bed; priinjali/.1.-with folded hands; sraddhayii- with faith and devotion; anvita/.1.·-thus being absorbed; Sf!J. Uyiit-personally chants and hears; sriivayet-and gets others to hear; martya1;.-such a human being; mu cyate -becomes freed; karmabandhanai/.1.- from all kinds of actions resulting from fruitive activities.

TRANSLATION

A devotee who rises early in the morning and with folded hands chants these prayers sung by Lord Siva and gives facility to others to hear them certainly becomes free from all bondage to fruitive activities.

PURPORT

Mukti or liberation means becoming free from the results of fruitive activities. As stated in Sr"imad-Bhiigavatam: muktir hitviinyatliii rupam. Mukti means giving up all other activities, and svariipeTJ,a vyavasthiti/.1. means being situated in one's constitutional position. (Bhiig. 2.10.6) In this conditional state we are entangled by one fruitive activity after another. Karma-bandhana means the bonds of fruitive activity. As long as one's mind is absorbed in fruitive activities, he has to manufacture plans for happiness. The bhakti-yoga process is different, for bhakti-yoga means acting according to the order of the supreme authority.When we act under the direction of supreme authority, we do not become entangled by fruitive results. For instance, Arjuna fought because the Supreme Personality of Godhead wanted him to; therefore he was not responsible for the outcome of the fighting. As far as devotional service is concerned, even hearing and chanting is as good as acting with our body, mind and senses.Actually hearing and chanting are also activities of the senses.When the senses are utilized for one's own sense gratification, they entangle one in karma, but when they are used for the satisfaction of the Lord, they establish one in bhakti.

Text 79] Chanting the Song Sung by Lord Siva 1131
TEXT 79 � � • � �: q(¥U€44Wi: �I � .,...,.�44(ijcft � 'lit('iiil4t � 311'4�fi�t<l(����II

gitam mayedam naradeva-nandanal;t parasya pumsal;t paramatmanal;t stavam

japanta ekagra-dhiyas tapo mahatcaradhvam ante tata apsyathepsitam

gitam-sung; maya-by me; idam-this; naradeva-nandana!z-0 sons of the king; parasya-of the Supreme; pumsa!z-Personality of Godhead; paramatmana/;t-the Supersoul of everyone; stavam- prayer; japanta!zchanting;ekagra-perfectattention; dhiya!z-intelligence;tapa/;t-austerities; mahat-great;caradhvam-youpractice; ante-at the end;tata!z-thereafter; apsyatha-willachieve;ipsitam-the desired result.

TRANSLATION

My dear sons of the King, the prayers which I have recited to you are meant for pleasing the Supreme Personality of Godhead, the Supl!rsoul. I advise you to recite these prayers, which are as effective as great austerities. In this way, when you are mature, your life will be successful, and you will certainly achieve all your desired objectives without fail.

PURPORT

Ifwepersistentlyengage in devotional service,certainly allof our desires will befulfilled in duecourse of time.

Thus end the Bhaktivedanta purports of the Fourth Canto, Twentyfourth Chapter, of the Srimad-Bhagavatam, entitled "Chanting the Song Sung by Lord Siva."

1132 Srimad-Bhagavatam [Canto 4, Ch. 24

Turn static files into dynamic content formats.

Create a flipbook