Skip to main content

Military anthropology: soldiers, scholars and subjects at the margins of empire montgomery mcfate -

Page 1


https://ebookmass.com/product/military-anthropologysoldiers-scholars-and-subjects-at-the-margins-of-empire-

Instant digital products (PDF, ePub, MOBI) ready for you

Download now and discover formats that fit your needs...

Of Age: Boy Soldiers and Military Power in the Civil War Era Frances M. Clarke

https://ebookmass.com/product/of-age-boy-soldiers-and-military-powerin-the-civil-war-era-frances-m-clarke/ ebookmass.com

Of Age: Boy Soldiers and Military Power in the Civil War Era Frances M. Clarke

https://ebookmass.com/product/of-age-boy-soldiers-and-military-powerin-the-civil-war-era-frances-m-clarke-2/

ebookmass.com

Border Ecology: Art and Environmental Crisis at the Margins Ila Nicole Sheren

https://ebookmass.com/product/border-ecology-art-and-environmentalcrisis-at-the-margins-ila-nicole-sheren/ ebookmass.com

Women and Sustainable Human Development: Empowering Women in Africa 1st ed. Edition Maty Konte

https://ebookmass.com/product/women-and-sustainable-human-developmentempowering-women-in-africa-1st-ed-edition-maty-konte/ ebookmass.com

Ulysses 2rd edition Edition James Joyce

https://ebookmass.com/product/ulysses-2rd-edition-edition-james-joyce/

ebookmass.com

Applied Water Science, Volume 2: Remediation Technologies

Inamuddin

https://ebookmass.com/product/applied-water-sciencevolume-2-remediation-technologies-inamuddin/ ebookmass.com

Patrolling The Homeland: Volunteer Border Militias and the Power of Moral Assemblages John Richard Parsons

https://ebookmass.com/product/patrolling-the-homeland-volunteerborder-militias-and-the-power-of-moral-assemblages-john-richardparsons/ ebookmass.com

From Freedom Fighters to Jihadists: Human Resources of Non-State Armed Groups Vera Mironova

https://ebookmass.com/product/from-freedom-fighters-to-jihadistshuman-resources-of-non-state-armed-groups-vera-mironova/ ebookmass.com

Neuroanatomie 8th Edition Martin Trepel

https://ebookmass.com/product/neuroanatomie-8th-edition-martin-trepel/

ebookmass.com

https://ebookmass.com/product/psychology-13th-edition-david-g-myers/

ebookmass.com

MILITARYANTHROPOLOGY

MilitaryAnthropology

Soldiers, Scholars and Subjects at the Margins of Empire

OxfordUniversityPressisadepartmentoftheUniversityofOxford ItfurtherstheUniversity’sobjectiveofexcellenceinresearch, scholarship,andeducationbypublishingworldwide OxfordisaregisteredtrademarkofOxfordUniversityPressintheUKand certainothercountries

PublishedintheUnitedStatesofAmericabyOxfordUniversityPress198MadisonAvenue,NewYork,NY10016,UnitedStatesof America

©MontgomeryMcFate,2018

Allrightsreserved Nopartofthispublicationmaybereproduced,storedinaretrievalsystem,ortransmitted,inanyformorbyany means,withoutthepriorpermissioninwritingofOxfordUniversityPress,orasexpresslypermittedbylaw,bylicense,orunder termsagreedwiththeappropriatereproductionrightsorganization Inquiriesconcerningreproductionoutsidethescopeoftheabove shouldbesenttotheRightsDepartment,OxfordUniversityPress,attheaddressabove

Youmustnotcirculatethisworkinanyotherformandyoumustimposethissameconditiononanyacquirer

LibraryofCongressCataloging-in-PublicationData

Names:MontgomeryMcFate

Title:MilitaryAnthropology:Soldiers,ScholarsandSubjectsattheMarginsofEmpire/MontgomeryMcFate

Description:Oxford[UK];NewYork:OxfordUniversityPress,[2018]

ISBN:9780190680176(print)

ISBN:9780190934729(updf)

ISBN:9780190934941(epub)

The book is dedicated to my son, Vale Danger Vaughn Carlough, without whose surprise arrival I wouldneverhavesettleddownenoughtowriteanything.

Acknowledgements

List of Acronyms

1.Introduction:GeraldHickeyandtheDangersInherent

2.RobertSutherlandRattrayandIndirectRule

3 UrsulaGrahamBowerandMilitaryLeadership

4 GregoryBatesonandInformationOperations

5.TomHarrissonandUnconventionalWarfare

6 JohnUseemandGovernanceOperations

7 JomoKenyatta,LouisLeakeyandtheCounter-InsurgencySystem

8 DonMarshallandtheStrategicObjective

9.Conclusion:DavidPrescottBarrowsandtheMilitaryExecutionofForeignPolicy

Notes

Index

ACKNOWLEDGEMENTS

This book was produced with support from the Minerva Program in the US Office of Secretary of Defense ManythanksareduetoTomMahnkenandErinFitzgeraldwhodedicatedtimeandenergy to bringing social science research into the Department of Defense I would like to thank the many people who helped along the way, including Jonathan Crist, Lynn Tesser and Kim Hardee at US Institute of Peace who provided support during my tenure as a Jennings Randolph Fellow, during which some of the earliest drafts of these chapters were written Thanks are also due to Conrad CraneoftheArmyHeritageandEducationCenteratCarlisleBarracksandGregWilcoxforhelping withaccesstoDonMarshall’spapers.ManypeopleattheU.S.NavalWarCollegeprovidedsupport and assistance, including Ambassador Mary Anne Peters who encouraged me to audit the Joint MaritimeOperationscourse(andtoProfessorChrisGregor,ProfessorSteveForandandCAPTAlan Abramsonwhomadetheexperienceveryproductive).Manypeoplereaddraftsofvariouschapters, includingProfessorDougHime,ProfessorMilanVego,andProfessorWolffvonHeinegg,forwhichI thank them warmly. Professor Chris Demchak provided constant encouragement and friendship. Georgette Wilson proofread each chapter and tracked down a few stubbornly elusive citations, for whichshedeservesmuchcredit.IwouldalsoliketothankthewonderfullibrariansattheU.S.Naval War College (especially Jack Miranda) and the awesome administrative professionals (especially Sherri Whitmarsh and Dalton Alexander) who made the process smoother. My deep thanks to the Center for Naval Warfare Studies and Analysis who supported me throughout this research, including Professor Drew Winner, Dean Barney Ruble, Rachael Shaffer and Dean Tom Culora. Most special thanks and gratitude are owed to Professor Pete Dombrowski who provided endless cheap coffeeanddeepinsights.

AEF

LISTOFACRONYMS

AmericanExpeditionaryForce

ANA AfghanNationalArmy

AQI AlQaedainIraq

ARPA AdvancedResearchProjectsAgency

ARVN ArmyoftheRepublicofVietnam

BG BrigadierGeneral

C3CM Command,Control,Communications,Countermeasures

CA CivilAffairs

CCIR Commanders’CriticalInformationRequirements

CENTCOM UnitedStatesCentralCommand

CIA CentralIntelligenceAgency

CIMA CoordinatedInvestigationofMicronesianAnthropology

CMO Civil-MilitaryOperations

CO CyberspaceOperations

COMUSMACV CommanderoftheUnitedStatesMilitaryAssistanceCommandVietnam

CPA CoalitionProvisionalAuthority

DIA DefenseIntelligenceAgency

DIME Diplomacy,Information,Military,Economic DoD DepartmentofDefense

DOTMLPF Doctrine,Organization,Training,Materiel,Leadership,Personnel,Facilities

EW ElectronicWarfare

FFIR FriendlyForceInformationRequirements

FLN FrontdeLibérationNationale

GAO GovernmentAccountabilityOffice

GLOBE GlobalLeadershipandOrganizationalBehaviorEffectiveness

GVN GovernmentofSouthVietnam

HNIR HostNationInformationRequirements

HTS HumanTerrainSystem

HTTs HumanTerrainTeams

IJC ISAFJointCommand

IO InformationOperations

IRCs InformationRelatedCapabilities

ISAF InternationalSecurityAssistanceForce

JAG JudgeAdvocateGeneral

JFC JointForceCommander

JIPOE JointIntelligencePreparationoftheOperationalEnvironment

JMO JointMaritimeOperations

KAU KenyaAfricanUnion

KCA KikuyuCentralAssociation

LTG LieutenantGeneral

MACV MilitaryAssistanceCommandVietnam

METT-T Mission-Enemy-Terrain-Troops-Time

MILDEC MilitaryDeception

MISO MilitaryInformationSupportOperations

MO MoraleOperations

NCA NetworkofConcernedAnthropologists

NSC NationalSecurityCouncil

NSPD NationalSecurityPresidentialDirective

NSS NationalSecurityStrategy

NVA NorthVietnameseArmy

OPMEP JointChiefsofStaffOfficerProfessionalMilitaryEducationPolicy

ORHA OfficeofReconstructionandHumanitarianAssistance

OSINT Open-sourceIntelligence

OSS OfficeofStrategicServices

PA PublicAffairs

PF PopularForces

PIR PriorityIntelligenceRequirement

PME ProfessionalMilitaryEducation

PPDs PresidentialPolicyDirectives

PROVN ProgramforthePacificationandLong-TermDevelopmentofVietnam

PSB PacificScienceBoard

REC Radio-ElectronicCombatVietnam

SIGINT SignalsIntelligence

SIM ScientificInvestigationofMicronesia

SOCOM SpecialOperationsCommand

SORO SpecialOperationsResearchOffice

USNA UnitedStatesNavalAcademy

VC VietCong

INTRODUCTION

GERALDHICKEYANDTHEDANGERSINHERENT

Whereisyourdata?

GivemesomethingIcanputinthecomputer

Don’tgivemeyourpoetry

Robert MacNamara1

In 1964 Gerald Hickey, a military anthropologist working for the US government, visited a Special Forces Camp in the highlands of Vietnam to conduct research for a RAND study The camp at Nam Dong had been built deep inside Viet Cong territory to provide protection for the surrounding villages A twelve-man Special Forces Team, A-726 commanded by Capt Roger Donlon, was tasked with advising and training 311 Vietnamese Civilian Irregular Defense Group militiamen The camp itself heavily fortified with sandbag walls, concrete bunker pits, machine gun posts and external wire was guarded by sixty Nung tribesmen, many of whom had previously served as mercenaries intheFrenchArmy

During the afternoon of 4 July 1964 Hickey accompanied the Special Forces soldiers to a local village where they distributed medicine After dinner that evening, many of the soldiers had an uneasy, ominous feeling that something was about to happen A Special Forces sergeant asked Hickey if he wanted a weapon, promptly handing him an AR-15 rifle At 2:26AM, a white phosphorous explosion engulfed the mess hall “Suddenly the command post was a mass of flames, whichwererapidlyspreadingtootherbuildingsintheheat,smoke,anddustofafirestorm Mortar roundslandedeverywhere,grenadesexploded,andgunfirefilledtheair Inamatterofminutes,the camp had become a battlefield”2 A huge explosion lifted Hickey off his feet and smashed him against a wall “For an instant I experienced a strange feeling of detachment as if I were outside watching myself My whole body ached as I lay on the ground trying to catch my breath”3 Dusting himselfoff,Hickeyzigzaggedacrossaroadandjumpedintoatrenchfullof“verytense”Nungswho were firing at the barbed wire perimeter The Nung leader offered Hickey a cigarette “You’re a professor,” the Nung leader said in Vietnamese, “what are you doing here?” Hickey replied that he hadcometo“relaxinthemountains,”whichprovokedalaugh 4

The Viet Cong continued firing mortars into the camp until a US air strike began to pound their positions Captain Donlon suddenly appeared at the edge of the trench, badly wounded from gunshots and shrapnel in the leg, forearm, shoulder and stomach “Are you OK?” Donlon asked “God, Captain,” Hickey answered, “get in the trench, you’re wounded!” Donlon refused, telling Hickey that the inner perimeter was holding but three members of his team were dead Donlon askediftheyhadenoughammo,andHickeyrepliedthattheyonlyhadpartofoneclip “I’llgetyou more,”Donlonsaid,disappearingintothesmokeandexplosions 5

Asdawnbroke,theVietCongretreatedintothejungle Inthemorning,asHickeyrecalled,the scene before me was worse than any nightmare I could remember The whole camp was a blackened smoking ruinandammowasstillexploding Therewerebodiesandpiecesofbodieseverywhere ontheclutteredparade ground,inthegrasses,andonthewires Thesmokyairwasheavywiththeodorofdeathanddestruction6

Asthewounded wereevacuated byhelicopter,theVietCongcontinued firingsmallarmsintothe campfromtheirpositionsinthejungle.Butthemainbattlewasover,andthe372menatNamDong had held the camp against a reinforced Viet Cong battalion of 900. For his heroism that night, CaptainRogerDonlonwasthefirstmanintheVietnamWartowintheMedalofHonor.Hickeywent back to Saigon to write his report, “The American Military Advisor and His Foreign Counterpart,”7 which describes many barriers to cross-cultural interaction between the U.S. military and indigenousmilitaryunitsstillpertinenttoday.

Hickey’s career tracks almost perfectly with U.S. involvement in Vietnam. Having become interested in Indochina in the early 1950s as a graduate student at the University of Chicago, Hickey first visited Vietnam in 1956, shortly after Ngo Dinh Diem became the first President of SouthVietnam.HickeywaspresentinBanMeThoutinJanuary1968atthebeginningoftheNorth Vietnamese assaults now known as the Tet offensive. He fought at Nam Dong, which was the basis for a battle scene in the 1968 film The Green Berets. Hickey sailed away from Saigon a few years beforethewarofficiallyendedin1975.

Hickey’s fundamental insight just as applicable today as it was during the Vietnam War was

that war entailed a process of interaction between the military and the people living in the area of operations To be effective and work as intended, military decisions had to take the society as a wholeintoaccount InHickey’swords:

TheAmericanstrategyofmakingmilitarydecisionswithoutregardfortheirimpactonSouthVietnamesesociety boded badly for the outcome of the war American planners and decision-makers in Washington and Saigon failed to understand that the social, political, economic, religious, and military aspects of Vietnamese society were intrinsically interrelated and had to be understood that way A decision regarding one aspect had to be based on its effect, its impact, on all other aspects Making military decisions without considering what effects theywouldhaveonthesocietyasawholeresultedineverspreadingdisruptionthatweakenedsocialorderand structure8

Hickey repeatedly tried to convey his views and ideas to the U.S. military, arguing for the developmentofaculturallyastutestrategytomeettheneedsofthepeopleofVietnam andnotjust the interests of the government of Vietnam; explaining the means and methods for securing the strategically important area of the central highlands; advocating for a viable ceasefire in accord with Vietnamese concepts of conflict resolution; recommending improved cultural training for military advisors; arguing against forced relocation of Vietnamese peasants and Montagnard tribes to strategic hamlets; and encouraging the government of Vietnam to honor their promises to the ethnicminoritygroups.Althoughsomeofhispredictionsproveddisturbinglyaccurateinretrospect, mostofHickey’srecommendationswentunheeded.Hisepitaphcouldverywellread:‘Itoldyouso.’ HickeystruggledtohavehisviewslistenedtobytheU.S.militaryinpartbecausehisperspective and conclusions often challenged the U.S. Army’s view of itself. For example, in 1962 Hickey coauthored a report on strategic hamlets for RAND.9 Strategic hamlets were intended to separate insurgents from the population by resettling civilians into areas that could be secured by the military. Based on previous success in separating the Malay population from Chinese insurgents in Malaya, British advisor Sir Robert Thompson had recommended the program to the Diem government. In these Vietnamese strategic hamlets, peasants were forced to work without compensationandpreventedfromfarmingtheirownland,therebycurtailingtheirabilitytomakea living.10

Hickey attempted unsuccessfully to convince the U.S. military that the strategic hamlet program would not work in Vietnam. When Hickey briefed the Commander of United States Military AssistanceCommandVietnam(COMUSMACV),LieutenantGeneralPaulD.Harkinsonhisresearch, he explained that the population would not choose sides based on ideology, but rather on the basis of who could offer them “the possibility of a better life”. Hickey’s argument relied on the ability of LTGHarkinstoseetheworldfromtheVietnamesepointofview toimaginethatthepoliticalvision offeredbytheVietCongmayactuallybepreferabletothedemocraticregimeoftheGovernmentof SouthVietnam.Butthegeneralcouldnotstepoutsideofhisownculturalframework,believingthat “everyonewantedprotectionfromtheVietCong,sotheywouldwelcomethestrategichamlets.”11

Neither the Diem government, nor military officers in Saigon, nor the Department of Defense wanted to hear any critical reports about the strategic hamlet program. LTG Harkins, for example, stated, “I am optimistic, and I am not going to allow my staff to be pessimistic.”12 Meanwhile, Viet CongweredismantlingstrategichamletsandreportsfromSaigonthatattacksonstrategichamlets had declined were contradicted by reports from the field that showed there were no longer any hamletstoattack.13

The story of Gerald Hickey’s life and times in Vietnam resonates with many of the issues the U.S. continues to face in its relationships with foreign governments and civilian populations. Foremost among these issues was a lack of understanding about the rest of the world a misunderstanding thatisoftenmutual.AsHickeynoted,PresidentDiem“wasaproductoftheesotericHueConfucianTaoistmandarinmilieu.…TherewasnothinginthisoutlooktopreparehimtounderstandAmerican leaders. On the other hand there was certainly nothing in the background of the American leaders that would have prepared them to understand Ngo Dinh Diem.”14 Few attempts were made to understand the population living in the operating environment. Americans imposed their own culturalframesonwhattheyencountered,obsessedwiththefallingdominoesofCommunismrather than the nationalist ambitions of a newly decolonized country. Convinced that the solution in Vietnam was firepower, U.S. forces were equipped and trained for conventional battles, and they prepared the South Vietnamese for the same fight which never materialized. Even U.S. counterinsurgency doctrine of the 1960s reflected the primacy of “firepower, mobility, and aggressive leadership”.15 Often the tactics and operations undercut the strategic objective of the waritself.

Hickey’s story also illuminates the sometimes tense relationship between the military and the academy. Then as now, the military tends to be skeptical of social scientists present in the battlespace. Hickey’s attempt to conduct further research with the Montagnards in 1961 was quashed by a CIA official who reputedly said he “did not want any anthropologists running around askingquestionsaboutthemontagnards’[sic]sexpractices.”16 Advisingthemilitaryasanoutsider is challenging, and advice often goes unheeded. On the flip side, civilian social scientists are often sceptical of the military and its motives. At the end of the war, Hickey’s alma mater, the University of Chicago, rejected him for even a menial visiting professorship.17 His colleagues in the anthropology department objected to his association with RAND and his work for the government during the Vietnam War. The anti-war sentiment of professional anthropologists was formally

articulated by the American Anthropological Association in 1967 in a Statement on Research and Ethics, which resolved that “except in the event of a declaration of war by the Congress, academic institutions should not undertake activities or accept contracts in anthropology that are not related to their normal functions of teaching, research, and public services”18 Since work for the US government was generally not considered “public service,” this resolution effectively prevented most anthropologists from participating in government-sponsored work Anthropologists became “the first, the loudest, and the harshest against their colleagues undertaking work for government agencies that have operational concerns overseas”19 Virulent ad hominem attacks were launched againstanthropologistssuchasHickey,who“hadcommittedtheunpardonablesinofacceptingDoD [DepartmentofDefense]money,throughtheRANDCorporation,tosupporthisworkinVietnam”20 His peers questioned Hickey’s Faustian relationship with the government, providing ethnography forpoliticalpurposeswhileadvocatingfortherightsofthepeoplehestudied

Hickey’s Vietnam story ends as the process of ‘Vietnamization’ began, during which US forces handed responsibility for security to local forces, leaving the conflict unfinished and government andsocietyunstable BackinthePentagon,theJointChiefsofStaffturnedawayfromthemessiness of small, irregular wars towards conventional wars that could more easily be won The doctrine of AirLand Battle was as much a reflection of a real strategic threat as it was a rejection of military failure in Vietnam In the words of Lieutenant General David Barno, “Refocusing on a major war in Europeofferedtohealthepainfulscarsoffailedcounterinsurgency”21

At the time of writing, to the relief of many, the wars in the Middle East and Central Asia are slowly winding down (or are being pursued primarily with air power) It is tempting to put these experiences on the shelf and turn away from them, focusing instead on emergent peer competitor threats,justastheJointChiefsandtheUS ArmydidattheendoftheVietnamWar However,ifthe US government elects to become engaged in counterinsurgency and irregular warfare again sometime in the future and given the historical record it is hard to imagine that this will not happen then acknowledgement and analysis of socio-cultural dynamics between opposing military forces and local civilians will have value All the firepower, technology, and sophisticated platforms designed for a major combat operation against a conventional threat that cost so much money and took so long to develop proved insufficient given the fight facing soldiers and marines in Iraq and Afghanistan AsGeneralJohnAbizaidoncenoted,“Whatwillwintheglobalwaronterrorismwillbe peoplethatcancrosstheculturaldivide It’sanideaoftenoverlookedbypeople[who]wanttobuild a new firebase or a new national training center for tanks”22 The nature of the tasks the military faced in Iraq and Afghanistan fighting an insurgency and stabilizing a government required less technical prowess and more information about the people living outside the forward operating bases The US was unprepared for what it faced and did not have the knowledge it needed Given thehistoryofsmallwars(especiallytheexperiencesofSomaliaandHaitilessthanadecadebefore) andthecombinedresourcesofthefederalgovernment,itisinexcusablethatUS militarypersonnel were deployed with no knowledge about the social systems of Iraq and Afghanistan, limited understanding of Islam, and minimal knowledge of the ethno-sectarian composition of these countries To put it very simply, the next time the US engages in a small war in a foreign country, thesemistakesshouldnotbemadeagain

When culture matters most

“Wars are not tactical exercises writ large,” as British military historian Sir Michael Howard once wrote.“Theyareconflictsofsocieties,andtheycanbefullyunderstoodonlyifoneunderstandsthe nature of the society fighting them. The roots of victory or defeat often have to be sought far from the battlefield, in political, social, or economic factors.”23 In the western military tradition, the beliefthatsocietyandculturemattersinamilitarycontextdatesbacktothefifthcenturyBCwhen Herodotus wrote about the habits and beliefs of the Persians.24 In the eastern tradition, the imperative dates at least to Sun Tzu, writing around 400 BC. By the end of the U.S. military intervention in Iraq, understanding the people living in the area of operations was talked about as an imperative, rather than something optional. As then-Lieutenant General David Petraeus noted, “Weusedtojustfocusonthemilitaryterrain.Nowwehavetofocusontheculturalterrain.”25

Under what conditions and in what circumstances is cultural knowledge most important to the military? Despite axiomatic statements regarding its utility, cultural knowledge matters most to the militaryenterprisewhenfourconditionsaremet.

First, military organizations seem to pay more attention to culture when they engage with an adversary or a civilian population that is ‘culturally distant.’ For example, when the U.S. fought againsttheJapaneseduringWWII,thearmedforcesactivelypursuedinformationaboutthesociety ofthe‘other.’AsRuthBenedictnotedin1944:

Whether the issue was military or diplomatic, whether it was raised by questions of high policy or of leaflets to be dropped behind the Japanese front lines, every insight was important In the all-out war Japan was fighting wehadtoknow,notjusttheaimsandmotivesofthoseinpowerinTokyo,notjustthelonghistoryofJapan,not justeconomicandmilitarystatistics;wehadtoknowwhattheirgovernmentcouldcountonfromthepeople We had to try to understand Japanese habits of thought and emotion and the patterns into which these habits fell Wehadtoknowthesanctionsbehindtheseactionsandopinions.26

Ontheotherhand,whenopponentsareculturallyand/orsociallysimilar,suchasGermanyduring WWIandWWII,themilitaryestablishmentappearstofocuslessonobtainingculturalknowledgeof thehostnation 27

Second, cultural knowledge becomes more important when the military operates in close contact with either civil society or civil authority in a foreign country The experience of the US in the 1990s in Somalia and Haiti shows that cultural knowledge matters more for small operations than for big wars Small operations, especially those that involve the military in the execution of governmentaltasks,bringthemilitaryintoclosecontactwithlocalciviliansandhostnationofficials It is in these contexts that understanding values, beliefs, norms, identity, and social organization contributetothe military’sability toachieve itsobjectives Thisprinciple isrecognized inbothUS and UK doctrine According to Joint Publication 2–013, Joint Intelligence Preparation of the Operational Environment, “stability operations and IW [irregular warfare] requires a more detailed understanding of the relevant area’s sociocultural factors than is normally the case during traditionalwar”28

Third,culturalknowledgemattersmorewhenfirepowerislimited whetherbydoctrine,strategy, laws of war or political concerns Big wars, with their emphasis on firepower, delivery platforms, and technology, do not require much cultural knowledge Except perhaps at a strategic level, the uniqueculturalcharacteristicsandsocialorganizationofthepeoplelivingintheareaofoperations would have had little relevance to the outcome ofa war foughtbetween tanks in the Fulda Gap As anthropologistKevinAvruchoncenoted,“Shockandawemakesculturalknowledgeirrelevant”29

Fourth, cultural knowledge matters more when the strategic objective is not primarily military in nature 30 Iftheobjectiveisthedestructionofenemyforcesthenithardlymattersifpopulationsare decimated, crops are burned, and buildings destroyed Such was the case in the 1980–1988 conventional war between Iran and Iraq If, however, the “object beyond war” includes a sociopoliticaloutcome a“free,democraticsociety”inVietnamora“stable”societyinIraq,forexample then the host nation society should be taken into account in the development of strategy and the conduct of operations Too often, military intervention results in neither a defeated, demobilized, disarmed opposing force nor a stable, secure society The resurgence of the ‘defeated’ Taliban in Afghanistanoffersevidenceoftheformer,andtheongoingsectarianviolenceandriseoftheIslamic State in Iraq provides evidence of the latter If the strategic objective involves anything more than grinding the adversary to dust and bulldozing his society into the ground, then the longterm effect of war on the population should be considered during the planning phase of the war and during operations Otherwise there is certain danger that operations designed to achieve the “object beyondwar”willundercutthatobjective

Inshort,socio-culturalknowledgeholdsutilityforthemilitary,especiallywhenconditionssuchas those detailed above have been met However, this statement has a caveat The conceptual frameworks and methodological approaches offered by anthropology have sometimes been treated bytheUS militaryasapanaceathatwillinstantaneouslyprovidetheculturalknowledgedesiredby military forces The tools and methods of anthropology (and of the social sciences in general) are necessary but not sufficient to meet military requirements As Doug Feith concluded in 2005 regardingthedecisiontogotowarinIraq:

It helps to be deeply knowledgeable about an area, to know the people, to know the language, to know the history, the culture, the literature, but it is not a guarantee that you will have the right strategy or policy as a matter of statecraft for dealing with that area You see, the great experts in certain areas sometimes get it fundamentallywrong Expertiseisaverygoodthing,butitisnotthesamethingassoundjudgmentregarding strategyandpolicy31

Cultural knowledge will not fix a bad policy, but in some cases cultural knowledge may make implementation of foreign policy more effective, expedient or efficient. In the words of S. F. Nadel, an anthropologist who worked in colonial Sudan in the 1930s, cultural knowledge will not prevent disaster,butitmayhelpadministratorsmake“betterblunders.”32

Story of the book

The conditions listed above that tend to make cultural knowledge most critical to the military cultural distance, close contact with civil society, limitation on firepower, and an “object beyond war” not just military in scope were met during the wars in Iraq and Afghanistan It was not surprising that ‘culture’ became (for a brief time) an important concept in the Pentagon In 2009, theJointChiefsofStaffissuedguidancetotheprofessionalmilitaryeducation(PME)institutionsto incorporate culture into their curriculum Substantially altered while this book was being written, theJointChiefsofStaffOfficerProfessionalMilitaryEducationPolicy(OPMEP)requiredthatnewly commissioned officers, for example, “know the operational definition of culture; describe the relevance of regional and cultural knowledge for operational planning; and explain the relationship andimportanceofknowingone’sowncultureandanother’sandtheimpactsonhumaninteractions, behaviors,andmissionaccomplishment”33

ThisguidancefromtheJointChiefssetahighbar,requiringthatUS militaryofficersunderstand culture almost as well as novice anthropologists In 2011, the Provost of the Naval War College asked me to take a look at how and whether Joint Maritime Operations (JMO) was following the

2009OPMEPguidance AfteratrimesterinJMOSeminar15,Icametotheconclusionthatalthough many of the students (who were professional military officers at the major and lieutenant colonel rank) alluded frequently to their intercultural experiences down range and the instructors did the best they could to highlight these so-called ‘human terrain’ issues, culture was not systematically incorporatedintothecurriculum Howcoulditbe?DespitethegoodintentionsoftheJointChiefsin promulgating such guidance, most faculty members at military education institutions have no particular interest or expertise in culture Moreover, if the JMO department wanted to include it, there were few if any articles or books to assign on “culture and operational planning” or “culture and information operations” At that point, I decided that I should shift the focus of my research from the narrow issue I had selected to military anthropology more broadly The spirit of the Minerva Fellowship that brought me to the Naval War College, after all, was to enrich PME institutionswithsocialscience

Because this book was written in part to help military educational institutions meet the Joint Chiefs’ (now moot) guidance, it is structured according to concepts commonly found in officer advanced educational curricula 34 Each chapter covers a topic found in the joint professional militaryeducationalcurriculum includinginformationoperations,leadership,strategicobjectives and describes how and why the culture and society of the opposing forces and host nation influenced decisions, operations, and outcomes in these domains Each chapter uses the life and times of an anthropologist who worked directly with the military as a lens to illuminate these concepts The story of Ursula Graham Bower, for example the only woman to hold a de facto combat command in the British Army during WWII introduces and frames a deeper discussion about cross-cultural military leadership in extremis that can be generalized to other times and places This book is a history, insofar as it explores certain key episodes in the history of military anthropology But it also leans forward to bring the lessons and intellectual legacies of unique individuals into current discussion and debate within military circles The cases in the book were selected because the anthropologists’ research interests and life experiences best illuminated the military concepts I wished to explore Certainly, I could have chosen other anthropologists whose stories would have been equally illustrative: Evans-Pritchard’s command of a band of Bedouin in North Africa during WWII could just as well have been used to discuss cross-cultural military leadership 35 Where I had a choice of anthropologists, therefore, I chose the lesser known figure While many anthropologists would prefer to obfuscate their discipline’s war legacy,36 I believe writingtheseindividualsbackintoourhistoryremainsanimportantintellectualendeavor I crafted the book so that each chapter could stand alone as a case study, so that professional military educational faculty could scatter chapters throughout their syllabi without needing to assign the whole book Since each chapter can be read without reference to the rest of the book, I didnotfeelitnecessarytoorganizethechaptersinastrictchronology TheIntroductionbeginswith Gerald Hickey in Vietnam, selected because Hickey’s experiences seemed to explicate both the dramaofanthropologicalengagementwiththemilitaryaswellasmilitaryengagementwithforeign societies The next chapter, on Indirect Rule, transports the reader to Ghana under British colonial rule (1874–1956) The chapters that follow, on Military Leadership, Information Operations, Unconventional Warfare, Governance Operations, Counterinsurgency and Strategic Objectives, are organized chronologically, covering World War II (1939–45), post-WWII administration and reconstruction (1946–51), the Kenya Emergency (1952–60) and the Vietnam War (1955–75) The Conclusion of the book jumps back in time to the 1918 American intervention in Siberia, where a young lieutenant colonel named David Prescott Barrows struggled to understand the politics of intervention Barrows, to my knowledge, is the only US Army general to have a PhD in anthropology As the apotheosis of military anthropology, his story is a good place to end the discussion

The omission of a case from Iraq and Afghanistan wasintentional Asmostofthe chaptersin this volume demonstrate, military intervention and the policies enacted in foreign territory often have longtermconsequences InthecaseofIraqandAfghanistan,notenoughtimehaspassedtobeable toobjectivelyassessthoseconsequences

SomereadersmayquestionwhythisbookdiscussesneitherUS foreignpolicyintheMiddleEast norBritishcolonialpolicyinanygreatdetail Theomissionshouldnotbeinterpretedasadvocacyof neo-colonialism or US foreign policy by default Rather, these issues have been debated and discussed thoroughly in other forums and would only be repetitious here Other readers will be disappointed that I make no judgments about the ethics or morality of conducting applied anthropologyforthemilitary,anothertopicwhichhasbeenwell-coveredinotherforums 37

My purpose is not to condemn, nor to articulate a political position, nor to redefine the field of anthropology The true purpose of this book is to understand how military organizations have used socio-cultural knowledge at the strategic, operational and tactical level in a variety of different conflicts, and how individual anthropologists contributed their knowledge about the human condition to difficult national security problems, so that if socio-cultural knowledge plays an importantroleinfutureconflictssomeofthepitfallsofthepastmightbeavoided

Because this book was written primarily for a military audience, it rests on the assumption that the military is executing rather than formulating policy The focus therefore falls on the military component of foreign policy implementation, rather than foreign policy decision making Moreover, thisbookdoesnotdelveintoculturalknowledgeasusedbynon-militaryelements,suchashowthe

Department of State might apply this information in a diplomatic situation It is primarily intended for military audiences and policy makers whose job it is to design, plan and execute these operations,butitismyhopethathistorians,anthropologistsandothersocialscientistswillalsofind ituseful

Barriers and impediments

In a 2012 speech, LTG Charles Cleveland, the commander of the U.S. Army Special Operations Command,opinedthat:

The nature of current conflict is that we are contesting in non-declared combat zones. What DOTMLPF [Doctrine, Organization, Training, Materiel, Leadership, Personnel and Facilities] do you need to fight in those places? In the land domain, the focus has been on tanks and other heavy stuff. Humans have been treated as a lesser case. The problem in Afghanistan and Iraq was that we didn’t have the right kinds of structures and knowledgetodealwiththehumandomain.38

As these comments suggest, even when military organizations recognize the value of understanding opposing forces and host nation societies, they inevitably face impediments when it comes to acquiring, managing, disseminating and utilizing this knowledge at the sharp end of the foreignpolicyspear

What are conceptual, cultural or practical barriers to successful military operations in societies vastlydifferenttoourown?Whatproblemsdomilitaryorganizationsencounteroverandoveragain when operating in the “human domain”? This introduction lays out five barriers that appear as majorthemesinthechaptersthatfollow Thefirstchallengeisthattheincreasingcomplexityofwar combinedwiththeincreasedflowofinformationaboutthecomplexityofwarasitisbeingfought results in a strong need to simplify reality in order to manage time and tasks This is the complexity problem The simplification of reality through heuristics such as models, taxonomies, categories and frames enables the military to execute its kinetic missions but also limits understanding of human beings This is the epistemology problem Even when military personnel seek to understand their adversaries and the host nation population, they often discover that the culture of their own organizations creates barriers to understanding This is the way of war problem In attempting to use social science downrange, the military encounters another barrier: themodels,theoriesandconceptsofhowasocietyactuallyworksdonotexistintherequiredform This is the social theory problem Now the real trouble begins actually implementing US foreign policy at the point of a gun This is the thorniest problem of all: the military implementation of foreignpolicy

The complexity problem

Inthesummerof2009,GeneralStanleyMcChrystalwasshownaslideproducedbytheOfficeofthe Joint Chiefs of Staff showing the U.S. military’s plan for “Afghanistan Stability/COIN Dynamics Security.”Theslideattemptedtocaptureallofthepolitical,economic,criminal,environmentaland military dynamics in Afghanistan, and the interrelationship between them. “When we understand thatslide,we’llhavewonthewar,”saidMcChrystal.39

McChrystal’swittycommentcapturesafundamentaltruth:warisexceedinglycomplex,requiring as it does, melding individual human beings with all their emotion, fear, and passion into an organized fighting force; the mastery and employment of lethal and non-lethal technology; the synchronization of logistic and supply chains; and the movement of men and machines across vast distances.Allofthis(andmore)mustbedoneinordertoshifttheadversary’swillatthesametime as the adversary attempts to secure their own victory. Whether fought hundreds of years ago or today, with sticks and clubs or rocket propelled grenades, war has always been a complex human undertaking.

The complexity of war is magnified when it is fought in a foreign environment, where soldiers must grapple with adversaries and host nation populations whose language, religion, customs and social organization differ from their own. “We are absolutely newcomers to this environment,” said oneyoungofficerdeployedinIraq.“Itissoforeigntous.Youcouldn’tpickaplaceintheworldthat would be more foreign to most Americans than Iraq.”40 The ordinary fog and friction of war becomesamplifiedinatransculturalarmedexchange.41

Both war and society can be characterized as complex, adaptive systems, and because every military action has consequences that ripple throughout the society, the intersection of society and war amplifies the complexity of both. Every social shift forces the military to adapt its tactics and operations. LTG Mike Oates, who served three tours in Iraq and commanded more than 25,000 troopsinaviolentregionjustsouthofBaghdadin2007and2008,observedthat“Iraqislikeagiant Jengapuzzle.Movingonesmallpiecehasaneffectonitall.Wehavetobeverycarefulthatwedon’t exaggerateoneperson’svieworonesetoflessons,becausewewillmissimportantthings.”42

Wars especiallythosefoughtunderadifferentsky havenotbecomeanylesscomplexovertime. What has certainly changed in the past fifty years is the amount of simultaneous information that commanders and soldiers have regarding their own forces, the adversary’s forces, the environment and the population. In 1837, when battlefield intelligence was limited to the reports of scouts and

whatcouldbeseenthroughbinoculars,KarlvonClausewitzwrote“waristherealmofuncertainty; three quarters of the factors on which action is based are wrapped in a fog of greater or lesser uncertainty”43 The so-called “fog of war” has not lifted over time, despite the vast array of sensors and real time intelligence that characterizes the contemporary battlefield If anything, the neverending flow of information has resulted in a state of permanent information overload for soldiers and commanders “The troubling paradox,” as Paul Virilio observed, is “that greater complexity continues to yield ever faster rates of processing and operation”44 Faster rates of information processingandoperation,inturn,leadstogreatercomplexity45

Because “complex systems are computationally as well as psychologically unmanageable for humans,”46 they must be simplified and controlled to be managed Regardless of time and place, militariesalwaysseektosimplify,organize,containorcontrolthecomplexityofwar Theartofwar warfare is the means by which order is imposed on the chaos of fear, death, violence, and irrationality MichaelHerr’s Dispatches,oneofthebestbooksabouttheVietnamWar,capturesthis tension:

That fall, all that the Mission talked about was control: arms control, information control, resources control, psycho-political control, population control, control of the almost supernatural inflation, control of terrain throughtheStrategyofPeriphery Butwhenthetalkhadpassed,theonlythingleftstandingupthatlookedtrue wasyoursenseofhowoutofcontrolthingsreallywere47

Control however elusive remains a dominant theme in the conceptual framework of contemporary warfare, found in concepts such as “Information Superiority,” “Full Spectrum Dominance,”“CommandandControl”and“Precision-GuidedMunitions.”48

Control whetherofterritory,commandandcontrol,orsocialcontrol canbeachievedthrougha variety of mechanisms, including technology, force, and conceptual ordering.49 For our purposes here, the most important mechanism by which militaries impose order on the chaos of war is conceptual ordering. Conceptual ordering, like technology, separates signal from noise, indicates what is important and what is irrelevant, and thereby imposes order on the chaos of war. Doctrine exemplifies the military process of conceptual ordering. At the joint level the effort to understand the environment both physical and ephemeral is broadly guided by doctrine for Joint Intelligence Preparation of the Operational Environment (JIPOE), which is “the analytical process used by joint intelligence organizations to produce intelligence assessments, estimates, and other intelligence products in support of the Joint Force Commander’s (JFC) decision-making process.” The process involves four major steps: defining the total operational environment; describing the impact of the operational environment; evaluating the adversary; and determining and describing adversary potential courses of action.50 Although the manual cautions that the JIPOE should be “holistic,” these complex issues are frequently reduced to a checklist of characteristics, which might include “population demographics (ethnic groups, ideological factions, religious groups and sects, age distribution, income groups, public health issues),” “political and socioeconomic factors (economic system, political factions), or “psychological characteristics of adversary decision making.”51 Each step of the JIPOE process organizes reality into discrete, manageable elements and thereby directs attentionofacommanderandhisstafftowardstowardthatwhichismost‘important.’ButT.S.Eliot wrote in 1934: “Where is the Life we have lost in living? Where is the wisdom we have lost in knowledge?Whereistheknowledgewehavelostininformation?”52

Insum,inordertoconstrainthechaosofwar,militaryorganizationsmustseekcontrol whether territorial control, command and control of forces, or social control. The means of control technological, conceptual ordering or the use of force organizes reality, structures experience and separates signal from noise. However, control in a military system should be thought of as an aspiration, a goal, something to be achieved. In reality, control is elusive and difficult to maintain. Like a chimera, the closer it seems the further it recedes. The Do Long Bridge scene in Apocalypse Now remindsusthatcontrolisoftenanillusioninwar.AstroopsfireonaVietCongpositionacross theriver,Willardasks,“Who’sincommandhere?”ThesoldiercalledRoachanswers:“Ain’tyou?”

The epistemology problem

To manage the complexity of war, the military must exert control over territory, units and people The most important control mechanism for the purposes of this discussion is conceptual ordering, which refers to the concepts, ideas and frames commonly employed by the military to organize the world into a manageable level of complexity Conceptual ordering imposes order on the chaos of war, but may also limit perception This is not just a problem for the military, but for humanity in general Because constantly increasingly complexity and information overload have become an almost universal condition of humanity, individuals almost everywhere reduce complexity and solve problems through the use of schemas, models, and heuristics That is, they employ their own knowledge and experience (in the form of educated guesses, trial and error, and common sense) to solve problems 53 Categories, frames and rules of thumb simplify complexity, but they come with a price: the heuristics that enable the military to execute incredibly complex tasks also limit perception and therefore understanding of other human beings This can be referred to as the epistemologyproblem

The meaning, limitations, and acquisition of knowledge are the subject of an entire branch of

philosophy called epistemology Questions such as “how do we know?” and “what do we know?” have been the subject of ongoing debate among philosophers since Plato The sense of the word epistemology,asIamusingithere,however,comesfromtheworkofGregoryBateson(seechapter 4) InBateson’sview,realityisalwaysdistortedbytheprocessofperception(thefiltersoflanguage, code,habit,culture,andsoon) Thereisnowaytoactuallyknowanything,sincetheveryprocesses ofperceivingdistortsorchangestheobjectofperception Yet,forBateson,thesefilterswerenotan impediment to knowledge; rather, they were actually a form of knowledge: the neural filtering that signalstoafrog’sbrainthatsmalldotsareflies,andtheculturalfilteringthatpredisposesaperson to believe or disbelieve in miracles or economic determinism, are both epistemology54 Evenratsin a maze have an epistemology, an internalized theory of knowledge that calibrates their perceptual biases The biases are our epistemology55 Accordingly, the conceptual ordering employed by the militaryisatypeofepistemology,aformofknowing,andlikeallformsofepistemology,ithasflaws

In considering the intellectual world of policymakers and military personnel, one could draft a long list of epistemological biases, cognitive shortcuts and intellectual fallacies that have resulted in negativestrategicoutcomes Indeed,thereisasubstantialandgrowingbodyofacademicliterature on the topic of misperception, bias and confusion in international relations Much of the international relations literature on misperception in international politics concerns how states (or statesmen) fail to understand other states (or other statesmen) 56 A smaller body of literature concerns how military organizations (especially in the context of intelligence analysis) misperceive theiradversaries 57 Mostofthechaptersinthisvolume,however,concerntheinteractionofmilitary organizations with host nation societies, a subject on which there is relatively little literature 58 Since a comprehensive review is beyond the scope of this chapter, this scholarship breaks roughly into three different areas: sources of misperception, types of misperception, and (less frequently) outcomesofmisperception

Misperceptionliteraturethatfocusesprimarilyontheoriginsofmisunderstandingtendstolookat deeply rooted cultural, social and psychological constructs in order to explain downstream policy outcomes 59 Speaking very generally, this literature posits that ideas and concepts in the minds of policymakersandmilitarypersonnelexertaforceonbothhowandwhydecisionsaremade,andon howoperationsareconducted

One origin of misperception in international security policy is ethnocentrism Ethnocentrism, a term coined by W G Sumner in 1906, means the “view of things in which one’s own group is the centerofeverything,andallothersarescaledandratedwithreferencetoit”60 Ethnocentrismmay includestronggroupidentification,afeelingofculturalsuperiority,oranaversiontopeoplewhodo not share the same group identity61 All military organizations may be ethnocentric to differing degrees,sincetheabilitytokilltheenemyoftendependsonperceivingthemaslessthanhuman As KenBoothhasarguedin Strategy and Ethnocentrism,“ethnocentrismcontributestothe‘vilification ofthehuman’whichmakeskillingeasier”62 Whileethnocentrismmaybepsychologicallybeneficial to the military for certain purposes, on the negative side, ethnocentrism may also result in the underestimation of enemy capabilities, or lead to an overestimation of one’s own capabilities Prior tothekamikazeattackonPearlHarbor,theUS ArmyWarPlansDivisionaffirmedthattheJapanese “lack of originality is a national trait”63 The Japanese, on the other hand, viewed Americans as “undisciplined, unmilitary, and unconcerned with anything except pursuit of the jazzy life,” and expectedAmericansoldierstofleeatthefirsttasteofcombat 64

Another source of misunderstanding is orientalism, which according to Edward Saïd is “a style of thought based upon an ontological and epistemological distinction made between ‘the Orient’ and (most of the time) ‘the Occident,’” which views Arabs and Muslims as foreign, alien, exotic, and fundamentally‘Other’incomparisonwiththeWest 65 Westernculturalprejudicesandarchetypesof Arab and Islamic people as irrational, violent, emotional and childlike function as a justification for colonial domination 66 Patrick Porter, in Military Orientalism, expands Said’s thesis to current military conceptualizations of Arab and Islamic societies, offering a criticism of the US military’s westernviewof“Easternwar”HismainobjectionisthattheUS militarytakesaprimordialistview of culture “as an immobile, unified set of ideas and instincts, a natural ‘given’ force created by traditions and collective experiences, where identity is more or less fixed by inherited, socially transmitted factors”67 This approach to culture, Porter argues, leads to a misunderstanding of opposing forces In his view, for example, the Taliban should not be conceptualized as a tribal society,operatingwithintheparametersofPashtunwali,adheringtotraditionalsystemsofauthority Rather, the “wartime behavior of Afghans suggests that their culturally-rooted beliefs and taboos arenotdecisivelyimportant;”68 instead they “operate as culturalrealists,reinventing theircultural codes as they go”69 Military orientalism, according to Porter, in representing the ‘Other’ as exotic, strange,anddifferent,preventsaccurateunderstandingofopposingforces 70 Theconverseintellectualfallacyoforientalismisuniversalism,thebeliefthatotherpeopleare(or wanttobe)fundamentallyjustlikeus Americanforeignpolicyoftenoperatesunderthe“traditional assumption that our primary norms and values are in theory at least valid everywhere” Thus, for thepastsixtyyearswehavebeenengagedinbuildinganinternationallegalsystemanddeveloping international institutions that reflect “universally accepted principles” such as civil liberties, democracy and human rights 71 For example, “There was a tendency among promoters of the [2003–2011 Iraq] war,” as Francis Fukuyama observed, “to believe that democracy was a default condition to which societies would revert once liberated from dictators”72 The tendency towards

universalisminUS foreignpolicyhasnotchangedwithPresidentialadministrations Oneneedonly look at the 2010 National Security Strategy (NSS) for evidence of the assumption that “certain valuesareuniversal,”including“anindividual’sfreedomtospeaktheirmind,assemblewithoutfear, worship as they please, and choose their own leaders; they also include dignity, tolerance, and equality among all people, and the fair and equitable administration of justice” The NSS, despite much evidence to the contrary,73 states that “these values have been claimed by people of every race, region, and religion”74 Exporting our political institutions is indeed a lofty goal However, as Adda Bozeman once noted, “‘democracy’ with its Western connotations of parliamentary or congressional institutions, a multiparty system, elections, constitution law, and bills of rights is basicallyalientoeachofthenon-Westernrealms”75

Justastherearemanysubterraneanpsycho-socialoriginsofmisunderstanding,therearealsomany specifictypesofmisunderstandingbetweenstates,betweenopposingforcesandbetweenmilitaries andhostnationpopulations 76 Whattypesofmisperceptionarefoundinamilitarycontext?

Inmilitarycirclesitissomewhatofaclichétoobservethat“generalsarealwayspreparedtofight the last war” Indeed, this type of reasoning by historical analogy is one type of misperception that servestoreducecomplexity77 In Analogies at War: Korea, Munich, Dien Bien Phu, and the Vietnam Decisions of 1965,YuenFoongKhongarguesthatpolicymakersemployhistoricalanalogiestohelp them perform diagnostic tasks, including defining the nature of the situation; assessing the stakes; providing prescriptions; evaluating alternatives by predicting success; evaluating moral rightness; and warning about dangers 78 Cognitive shortcuts may save time and reduce the complexity of reality to manageable levels, but they may also lead to false conclusions, inaccurate assumptions, and misguided comparisons 79 Specifically, analogies often lead to incorrect assessments, flawed conclusionsandbadpolicies BeforethewarinIraq,forexample,US seniorofficialsbegantoview Iraq as a new version of Nazi Germany in which Saddam Hussein was Hitler with a bigger moustache 80 Theproblemwithsuchanalogiesisthatthey“allowonetoglanceovertheparticulars ofIraqisocietyandargueaboutIraq’sfutureonthebasisofanalogiesratherthanconditionswithin Iraqitself”81

Another type of misperception (covered in several chapters of this book) is the frame, a heuristic mechanism for organizing experience and guiding action that affects how we understand the world and how the world understands us When military forces (or indeed people in general) perceive reality, they build a frame around their picture of the world That which is inside the frame is considered, posited, evaluated and analyzed Everything outside the frame is ignored, avoided, disallowedandunconsidered Byframingactsofpoliticalviolenceas“terrorism”,asMichaelBhatia hasnoted,“thissubjectbecomesknowninamannerwhichmaypermitcertainformsofinquiryand engagement, while forbidding or excluding others”82 Thus, the ‘terrorist’ frame, instead of clarifying, may actually obscure reality For example, labeling Hizbullah as a terrorist group hampers understanding of the actual plans, motives, and worldview of the organization 83 In “imagining Hizbullah as the ultimate alien who cannot be known or understood,” the production of actualknowledgeabouttheorganizationiscompromised 84

Frames used in the domain of national security policy such as ‘terrorism,’ ‘communism’ or ‘warlord’ may offer the illusion of an explanation for violence that otherwise appears gruesome, pointless, and inexplicable But condemnation is not explanation Such frames actually limit understanding of the “complex local variations, motives, histories and interrelationships” of armed groups 85 ForMichaelBhatia,thequestionsthatneedtobeaskedandansweredare:“Whoarethey those ragtag soldiers in the mountains, enclaves, jungles or urban ghettos? What do they want? What drives them both individually and as a group? And then, why do they hate ‘us’?”86 While Hizbullah may well use terrorism as a tactic, framing them as terrorists hinders accurate understanding of how they function as an organization and therefore prevents development of effectivestrategy

Insummary,militaryorganizationsgenerallyseektoreducetheprofuse,endlesscomplexityofthe battlespace To do that, they must rely to some degree on heuristics, cognitive shortcuts, and preexistingschemasforsortingtheworldintoorderlycategories Theheuristics,althoughnecessaryto accomplishcomplextasksinacomplexenvironment,mayalsolimitone’sabilitytocomprehendthe environment We now come to the third barrier: even when military personnel seek to understand their adversaries and the host nation population, they often discover that the culture of their own organizationscreatesbarrierstounderstanding

The ‘way of war’ problem

One afternoon in Seminar 15 of Joint Maritime Operations at the U.S. Naval War College, the discussion turned to the ability of the U.S. military to conduct counterinsurgency operations, includingthestructural,organizational,anddoctrinalimpedimentstodoingso.Oneofthestudents, an Army lieutenant colonel with multiple tours in Iraq and Afghanistan, grew frustrated and began to argue that the problem with U.S. counterinsurgency efforts was not about the size of brigades, rules of engagement, or the lack of training. Rather, he said, “our ‘solve’ is based on our idea of theirendstate.Ourownculturegetsinthewayofunderstandingwhatotherpeoplebelieveistheir ‘solve.’” In other words, U.S. forces come into theater with mission objectives and their own pre-

conceived ideas about how to complete those tasks Rarely, if ever, do US military commanders (whether at the strategic, operational, or tactical level) ask the host nation population: what are your objectives? How best can we achieve them? The reason for the omission of those questions results not from a lack of training, inappropriate force structure, battle rhythm or any number of potential variables, but from military culture itself The ‘way of war’ problem is the inability of American military personnel to understand the world from the subjective viewpoint of another cultureandthecorrespondingtendencytoimposepre-determinedsolutionsonotherpeople

Broadly, what is the US ‘way of war’? In 1973, Russell F Weigley argued in The American Way of War: A History of United States Military Strategy and Policy that since the American Civil War the US military has tended to engage in big wars using heavy firepower and strategies of annihilation in the quest for decisive victory For the US military “the complete overthrow of the enemy, the destruction of his military power, is the object of war”87 The US military, according to Weigley, historically utilized a narrow definition of strategy that tended to “give little regard to the nonmilitary consequences of what they were doing” and which “excluded from consideration the purposes for which a battle or war was being fought”88 The American way of war is characterized by big machines, big guns, big battles and big manpower As Lieutenant General David Barno has pointedout,inthis‘bigwar’paradigm“‘realsoldiers’rodetobattleinarmoredvehicles”89

While the US certainly has a long military tradition of fighting small wars and insurgencies (which would tend to contradict Weigley’s characterization),90 a way of war (like a social norm) is not necessarily what a nation does, but what it wants to do As Tom Mahnken has observed, “a nation’s ‘way of war’ is an expression of how the nation’s military wants to fight wars”91 A way of war is, in that sense, a preference The US military prefers to fight major combat operations, treating contingency operations and other types of small wars as mere diversions from the main event, or as a limited specialized function of special operations forces Historically in the US, few attemptsweremadetodevelopdoctrineorcapturelessonslearned,andknowledgewastransmitted orally from veterans to their younger cohort 92 Even at the apex of frontier warfare in the Western territories, “military leaders looked upon Indian warfare as a fleeting irritant” that distracted from the “nineteenth-century orthodoxy as exemplified in the War of 1812, the Mexican War, the Civil War,andtheSpanish-AmericanWar”93

In the US where the preferred warfighting style is decisive victory using maximum firepower, post-conflict operations such as ‘nation building’ and ‘stability operations’ tend to be viewed with disdain and pushed to the margins As one military planner observed, “all the A-Team guys wanted to be on Phase III and the B-Team guys were put on Phase IV”94 Lethal operations during the high intensity phase of warfighting tend to be overvalued, while small wars (in which socio-cultural knowledgeandcross-culturalsubjectivityaremostcritical)tendtobemarginalized Asaresult,the socio-cultural knowledge and cognitive skills associated with this type of military engagement are not permanent features of training, education, wargaming or doctrine Evidence for this assertion canbefoundintheforgottenormisremembereddoctrineforcounterinsurgency,evenastheTaliban began shooting at ISAF forces; in the lack of a single course on military government offered at the war colleges, even as the US established an occupation authority in Iraq; in the focus on mechanized ‘initial entry’ operations at the combat training centers, even when US forces were highly unlikely to roll into a third theater of operations Lessons that should have been learned about the importance of regional economy, social structure, local political traditions, traditional authorityandtheimportanceofreligioninoperationsotherthanwarweremostlyignored 95

In his article “Irregular Enemies and the Essence of Strategy,” Colin S Gray lists thirteen characteristics of the American way of war, one of which is “culturally-challenged”96 He notes, “from the Indian Wars on the internal frontier, to Iraq and Afghanistan today, the American way of warhassufferedfromtheself-inflicteddamagegrowingoutofafailuretounderstandtheenemyof theday”97 Naturally,thequestionarises:whyistheAmericanmilitaryso“culturally-challenged?” The answer lies partially in pragmatic considerations such as force protection, in which risk to soldiers is reduced as much as possible Preventing or minimizing casualties is critical for ethical andpracticalreasons,butoneoftheby-productsofforceprotectionisthatitisolatessoldiersfrom the population and may therefore be counterproductive in a counterinsurgency campaign As one Marine officer explained, “it’s hard to get close to the population if you’re wearing body armor and manning a 050 cal”98 Another plausible explanation of the US military’s “culturally-challenged” way of war is the unit rotation policy, in which brigades are rotated out of theater every 9–12 months, preventing military personnel from developing relationships with local nationals (and preventinglocalnationalsfromdevelopingrelationshipswiththeunit) 99 Onecouldalsopointtothe hindrancescreatedbylawsandregulationsthatpreventtheUS governmentfromadaptingtolocal conditions and local priorities For example, as one Navy Judge Advocate General (JAG) noted, “We builtaschoolinthemiddleoftheSaharawithawheelchairramptocomplywiththeAmericanswith DisabilitiesAct”100

While pragmatic concerns cannot be entirely discounted as factors for why the US is “culturally challenged” in war, imperatives within the military system itself also offer an explanation The American military prefers to fight major combat operations and therefore, the system produces officers and troops highly qualified to fight major combat operations One of the distinguishing featuresofmajorcombatoperations(asopposedtocounterinsurgency,stabilityoperationsorpeace

enforcement) is the mechanization of war To prepare for conventional mechanized war, military personnel must first and foremost be competent operators of complex weapons systems Thus, the professional military education system, especially at the pre-commissioning and primary levels, has beendesignedtoproduceofficerswhoarenotnecessarilypoetsorstatesmen,butmastersoflethal technology AttheUS NavalAcademy(USNA),forexample,around65percentofthestudentsare science, technology, engineering or mathematics (STEM) majors, as required by US Navy regulations 101 To keep the ratio at 65 per cent, USNA midshipmen are actively encouraged to major in scientific disciplines As one Naval Academy faculty member observed: “the Navy thinks that all they need to know is machines; they believe their first job is to keep the water out of the bilges”102

The US military excels at producing firm, decisive, rule-abiding, technologically competent leaderstomeettheimperativesofmajorcombatoperations Irregularwarfare,“inwhichcombatis integratedwithcivilsociety,”mandatesaverydifferentsetofskills 103 Asnotedinthe Quadrennial Defense Review Report (2006), for example, “developing broader linguistic capability and cultural understanding is critical to prevail in the long war and to meet 21st century challenges”104 In the US, however, military officers have traditionally not been selected, educated, trained or rewarded fortheirdeepknowledgeofothersocietiesortheircross-culturalskills Ingeneral,theUS military does not value such skills except at rare moments (such as the mid-2000s) when they suddenly becomecritical

During the war in Iraq, American policy makers and senior military commanders shared a passionate commitment to stabilizing the country, providing security, and creating a democratic nation Their motivations cannot be faulted, and from their point of view they were doing the right thing Yet,fromtheperspectiveofmanyIraqis,Americanactionsdestroyedtheirsecurity,increased the level of violence, and empowered Shia elites After Saddam Hussein was deposed and the interimgovernmentestablished,about65percentoftheseatsinthenewly-formedIraqiGoverning Council went to Shia representatives From an American perspective, this made sense because it was political representation proportional to the population But from a Sunni perspective, deBa’athificationwasseenasde-Sunnification

Colonel Derek Harvey, a career Army intelligence officer, suggested that before building a strategy or designing an operation the US military should try to view the world from the Sunni perspective:

Think about what if your life, your future, the future of your grandchildren and your children, your place in society,yourwealth,evenyourhomes,yourjobs,yourcareersweresuddenlytakenfromyou ifthewholeworld as you knew it was gone, and the future looked bleak because it looked like it was going to be dominated by outsiders,as wellas by those thatyou had foughtonce before say the SCIRI[Supreme Councilfor the Islamic Republic of Iraq] and the Badr Corps, along with Iran and it looked like the Shi’a theocratic movement was in the ascendancy, linked to Jaafari and Dawah, the political group representing the Shi’a So think about it from theperspectiveofmanyoftheSunnis itdoesmakeadifferencewhenyoudothat105

Harvey articulates the essence of subjective perception: understanding how the world looks from another person’s point of view, seeing the situation as it looks through the eyes of the local people. Subjective perception is closely related to empathy, which has been defined as “a complex imaginative process in which an observer simulates another person’s situated psychological states whilemaintainingclearself-otherdifferentiation.”106

Without the ability to see the world from another person’s point of view, we propose solutions to political, economic, and social problems based on our own taken-for-granted and unexamined cultural norms, values, and ideas. We neglect to ask other people what they value, and what their “solve” might be. “Our solve” in Iraq was based on a Western model of proportional democratic representationinwhichethno-sectarianidentitydidnotdeterminepartymembership.Thissolution provedalmostunworkableinthecomplexpoliticalenvironmentofIraqwheretribal,political,ethnic and religious identities have always intersected and frequently conflicted. The Iraqi “solve” might have proved equally unworkable given the divided nature of the society, but real solutions must incorporate how people view their own security, government, and society. Simply imposing an external “solve” based on an exogenous political philosophy cannot alleviate underlying tensions or reduceconflict.

Unfortunately, the U.S. military system tends to produce soldiers who cannot imagine another’s “solve” and who are not inclined to adopt the subjective viewpoint of another person. Their understanding of the world remains bounded by their own experience, entrenched in their own point of view. This has operational consequences. As one young officer told me, “the problem we haveinIraqisthatwe’reallwhitekidsfromthesuburbs.Wecan’timaginewhatit’sliketoliveina world where the police are not the good guys they’re the enemy.”107 When the mission includes ensuring the security of local civilians and the reconstitution of local security forces then suspending preconceptions about the role, function, and nature of security services and understandingthatsecurityinBasrameanssomethingdifferentthaninBatonRougeisagoodplace tostart.

In sum, the American military generally prefers to fight major combat operations and its educational system produces officers and troops highly qualified for this purpose. However, what makes a good officer in a conventional war does not necessarily prepare her for counterinsurgency

orstabilityoperations Theabilitytoadoptthesubjectiveviewpointofanotherperson toempathize with someone from a different society makes it possible to promulgate a “solve” that is theirs, not ours This should be the starting point for counterinsurgency and all other forms of irregular warfare,notmerelyanafterthoughtinanafter-actionreview

The social theory problem

Even if a military officer felt comfortable with complexity, found a way of slowing the fire hose of battlespace information to a trickle, found time to think slowly without overly relying on heuristics, and was able to hear the solutions that other people have discovered for themselves, that officer would encounter yet another problem: no two people (least of all anthropologists) agree what cultureis,orsometimesevenwhetheritexists.Ifthemilitarywantedtounderstandtheoperational environment using academic theory, they would be hard pressed to find concepts that could be put intopracticeoperationally.Thismightbecalledthesocialtheoryproblem.

To execute irregular warfare missions, military personnel require skills to help them interact with foreign people and knowledge about the culture and society of those people. Philosophers who specialize in epistemology distinguish between acquaintance knowledge (“knowledge how”) and propositional knowledge (“knowledge that”).108 Acquaintance knowledge can be viewed as a process involving the application of expertise, such as knowing how to fire a weapon.109 Propositional knowledge can be conceived of as a state of mind, a mental condition of “understanding gained through experience or study; the sum or range of what has been perceived, discovered, or learned.”110 Firing a gun, for example, does not require knowledge of theoretical physicsbutitdoesrequirebalance,breathing,andcoordination,allpartofthepracticalknowledge ofshootingaweapon.111 Similarly, application of cultural knowledge to operational problems faced by the military requires both knowledge about the local society (“knowledge that”) and knowledge of how to engage people within the society appropriately, through negotiations for example (“knowledgehow”).

Socio-cultural knowledge, as used here, means propositional understanding of the theoretical concept of culture and propositional understanding of any specific culture (including one’s own), whetherthatknowledgeistacitorexplicit,individualorcollective.Ontheotherhand,socio-cultural acquaintance knowledge (“knowledge how”) is referred to here as cultural competence. These are differentthingsandthemilitaryneedsbothtobeeffectivedownrange.AsoneSpecialForcesofficer noted,

Not all soldiers possess the natural ability to effectively interact with civilians Our conventional forces are not trained in performing these complex interactions … Soldiers need a level of maturity coupled with training in effective techniques that are culturally specific and focus on highlighting adaptive thinking in order to interact withlocals,andbuildthebridgetomutualtrustbyprovidinganopenconduitforcommunication.112

As this observation indicates, cultural competence is essentially a skill, which has been defined by BrianSelmeskiasaknowledgesetthatenablesindividualsto“quicklyandaccuratelycomprehend, then appropriately and effectively engage individuals from distinct cultural backgrounds to achieve the desired effect despite not having an in-depth knowledge of the other culture”113 Cultural competenceistheskillthatallowssocio-culturalknowledgetobeappliedindifferentsituations

Socio-cultural knowledge and cultural competence should also be distinguished from technical domain knowledge, which refers to expert knowledge about a particular technical area such as economic policy, agricultural development, and educational reform Technical domain knowledge is necessary but not sufficient for any military engagement that involves the administration or reconstructionofinstitutions Institutions,likethepeoplethatcreateandmaintainthem,oftenhave superficial similarities in form or function Clam shells, like Euros, can serve as a means of exchange;serialmonogamy,likepolyandry,providesameanstosatisfysexualdesireandreproduce the human species While the form and function may be similar, the cultural meaning may differ widely HowIraqisthinkabouttheroleandfunctionofpolicediffersfromthewayinwhichsomeone inruralAlabamathinksabouttheroleofthesheriff Ifthemilitary’smissioninvolvessecuritysector reform in a foreign country, technical knowledge of policing must be complemented by cultural understanding of the beliefs, norms, concepts and prejudices associated with the police in that particularsociety AsBrigadierGeneralFerdinandIrrizarryhasobserved:

Youcan’tjusttakealawyerfromBoiseandsendhimtoAfghanistanandexpecttheruleoflawtoemanatefrom himlikeagarden Thedisciplinesmustbeunderstoodinregionalcontext Takeagreatcityplanner,buthe’s useless if he doesn’t understand how cities work in Asia He has to convert his concept of city planning to the situationontheground114

In order for a military unit to operate effectively in another society, they ideally need to possess all three types of knowledge: technical domain knowledge, cultural competence, and socio-cultural knowledge.Butwhatexactlydoesthemilitaryrequireintermsofsocio-culturalknowledge?

To begin with, different types of operations generate different kinds of sociocultural knowledge requirements. For example, humanitarian aid missions generally have the objective of providing succor and support to a civilian population, whether the cause is a man-made famine or a natural

disaster. During this type of mission, the military must obviously understand the country’s basic infrastructure,sincethiswillinfluencedecisionsaboutthemosteffectiveaiddistributionroutesand abouthowtorestorebasicservices Inaddition,themilitarywouldneedtoevaluatethepresenceof ‘spoilers’ seeking advantage or attempting to derail the relief mission, understand the existing medical and health care system, identify the roles and responsibilities of local government, and identify food preferences If the local people view peanuts as animal fodder, peanut butter is probably not the best choice for human food relief A major combat operation, on the other hand, will probably not require knowledge about the local population’s food preferences, but might require arcane knowledge about the conceptualization of unseen, demonic forces for conducting psychologicaloperations(the‘WhiteDeath’Russiansoldiersbelievedlurkedinthesnowduringthe Finnish-SovietWinterWar,forexample) 115

Different types of operations create certain socio-cultural knowledge; equally, different levels of war generate different socio-cultural knowledge requirements 116 At the strategic level, a combatant commander responsible for an entire theater charged with deterring future conflict, among other tasks, should certainly understand the religious beliefs and political ideologies concerning conflict resolution in that society At an operational level, a Joint Force Commander “must ensure that the campaign plan and strategy are built to accommodate the nature and character of the indigenous population”117 Thus, the commander probably should have a comprehensive understanding of the social structure (including tribes, ethnic groups, civic organizations, and so on), the economic system (including patterns of production, distribution, and consumption), the legal system (including the judiciary, law enforcement, and penal code), and so on At a tactical level on a squad or platoon, the personal engagement of soldiers and marines with localnationalswouldrequireunderstandingsocialnormsandbehaviorssothat,atabareminimum, US forces can avoid grossly offending the locals In other words, the implied tasks at different levels of war necessitate different types of socio-cultural knowledge of varying complexity to accomplishthosetasks

Differentphasesofconflictalsorequiredifferentkindsofsocio-culturalknowledge Inplanninga campaign, the US military divides the time sequence into six phases: shape, deter, seize the initiative, dominate, stabilize, and enable civil authority118 Phase Zero, the shaping phase of the campaign,involvesactivities:

to enhance international legitimacy and gain multinational cooperation by shaping perceptions and influencing adversaries’ and allies’ behavior; developing allied and friendly military capabilities for self-defense and multinationaloperations; andmitigatingconditionsthatcouldleadtoacrisis119

Putsimply,PhaseZeroreferstothepreventionofconflict,andtodothatsocio-culturalknowledge is critical. The kind of socio-cultural knowledge required during Phase Zero which at a minimum includes an understanding of prevailing political views, existing ethno-sectarian tensions, attitudes towardsregionalpowers,normsregardingthescopeofauthorityofkeyleaders,conceptsregarding transparency and corruption, and so on would be quite different than the type of knowledge necessaryfor“seizingtheinitiative,”whichwouldlikelybemuchmorelimitedinscope.

The knowledge requirements listed above are guesswork: deductions made on the basis of observation and experience. The truth of the matter is that in the mad, chaotic rush to fix the problems in Iraq and Afghanistan, there was no formal process (at least that I witnessed) to align military requirements with programs, contracts, and research funding for socio-cultural research. According to the Defense Science Board, “no single repository, coordination entity, or management function exists today” for DoD social science efforts.120 No process existed in the bureaucracy for determining what kind of sociocultural knowledge was necessary for what particular missions, prioritizing research, or much less funding it. The DoD and the various branches of the military (Army, Navy, Air Force, Marines), all of whom had vastly different missions (drug interdiction, governanceoperations,counterinsurgency,unconventionalwarfare,amphibiousassault),generated their own requirements for socio-cultural data. Sometimes these requirements overlapped and sometimestheywere sui generis.Sometimestheywerebroadandgeneral,andatothersincredibly specific. Sometimes the requirements emerged from the bottom up, such as the Joint Urgent Operational Needs Statements from deployed brigades that eventually created the Human Terrain System (HTS). Sometimes these requirements were issued from the top down, such as Department of Defense Directive, 3000.05, Military Support for Stability, Security, Transition, and Reconstruction (SSTR) Operations, which mandated (among other things) that the Commanders of theGeographicCombatantCommandsincludeinformation“onkeyethnic,cultural,religious,tribal, economicandpoliticalrelationships”asacomponentoftheirintelligencecampaignplanning 121 What did the operational military need to know? As my co-authors and I observed in a 2011 book chapter,

toourknowledge,noindividualsoragencieshavethusfarengagedinanempiricalstudytoidentifyandvalidate whatitis thatcommandersactually wantor need to know aboutthe socio-culturalenvironmentin their area of operations

Consequently, as part of a multiyear project to revise the training curriculum for the Army’s Human Terrain System, we sought to determine what military socio-cultural knowledge requirements actually were. Our specific goal was to identify “core concepts,” the categories of

socio-cultural information about local populations most commonly used by Human Terrain Teams (HTTs) To do this, we indexed all the “requests for research” made by teams deployed in both Afghanistan and Iraq to our research center in the US, which gave us an idea of the research projects teams were conducting downrange Additionally, we surveyed and interviewed team members regarding their research projects, methods of collection and analysis, and forms of final products Based on this process, we were able to identify the major concepts salient for brigades and higher echelons in two theaters of war The things that commanders wanted to know were remarkably consistent between both theaters and over time They included concepts such as social structure, roughly defined as the “relations between groups of persons within a system of groups” through which people organized themselves (for example, tribal, kin-based, geographical, ideological),122 and how these social groups create and reproduce social identity, inform decision making, and influence leadership structures Other critical concepts included the political system (both formal and informal), the economic system (both formal and informal), and interests/ grievances(particularlypertainingtosecurity,intra-andextra-groupconflict,andadministrationof justice)

Our efforts as part of the HTS represented one way to ascertain the type of socio-cultural knowledge needed by military units Another way to empirically assess military socio-cultural knowledge requirements would be to collect and analyze commanders’ critical information requirements (CCIRs) in order to ascertain what kinds of socio-cultural and/or technical domain knowledge they express a need for Doctrinally, CCIRs have two primary components: priority intelligence requirements (PIR), which are focused on opposing forces and other threats, and friendlyforceinformationrequirements(FFIR),whicharefocusedonthecapacityandstateofone’s own forces and those of coalition partners 123 The war in Afghanistan demonstrated that a third category was needed Under the command of LTG David Rodriquez, ISAF Joint Command (IJC) identified and defined the concept of Host Nation Information Requirements (HNIR), concerning friendly nation institutions or organizations A 2009 draft of the IJC’s HNIR articulates broad categories of required knowledge, such as civil society leadership (formal and informal), public confidence in leadership, relationship of leadership to power structures, relationship of leadership tointernationalcommunity,constitutionalgovernment,tribalandtraditionalgovernment,assistance programs, governmental accountability, perception of government, host nation security forces, perception of access to justice, effectiveness of judicial system, infrastructure, economic resources, perceptionofqualityoflife,reintegrationprograms,andsoon 124 Intheory,onecouldaggregateall the HNIRs across all theaters to build a composite picture of socio-cultural knowledge requirements,buttomyknowledgethishasnotbeendone

Taken together, the HNIR requirements detailed above and the empirical research on “core concepts” offers some insight into the type of socio-cultural knowledge that the US military found necessaryinAfghanistanandIraq Toimplementforeignpolicydownrange,themilitarywouldneed amodelofsocietythatcouldbeappliedoperationallyindifferentphasesofconflict(from“shaping” to “enabling civil authority”), at different levels of war (from the strategic to the tactical), and during different types of operations (from humanitarian aid missions to major combat operations) This model would need to be scalable from small societies (such as nomadic pastoralists) to very large ones (complex, urbanized countries) This model would need to capture at a minimum social organization, economic systems, political systems, legal systems, identity formation, traditional authority structures, types of power and modes of acquisition, decision making, norms and sanctions,therelationshipbetweenthesocietyandexternalforces,beliefsandsymbols,andhowall ofthesemovingpartsfittogether125 Thismodelwouldfirstandforemosthavetoberelevanttothe military’s mission, as noted by Brigadier General Benjamin C Freakley in a 2005 article “Cultural AwarenessandCombatPower”

Our real, long term, dilemma is defining the significant military aspects of culture as they might apply in any theater and further determining how these various aspects of culture manifest themselves and might influencetacticaloperations126

Unfortunately, the type of information required for counterinsurgency and stability operations bore little resemblance to what the intelligence system had been designed to produce for the military customer in major combat operations. This flaw came as a revelation to some but had actually been identified almost a decade earlier. During the 1993 Somalia operation, the military discovered that it needed something more than in-depth orders of battle, targeting data, and traditional military capabilities analysis “Commanders on the ground,” according to Lieutenant General James R Clapper, Jr, then director of the Defense Intelligence Agency, needed “detailed information regarding local customs, ethnicity, biographic data, military geography, and infectious diseases” Producing intelligence on these factors can be very challenging As Clapper notes, “we provided detailed analysis on more than 40 clans and subclans operating in Somalia far more difficultthancountingtanksandplanes”127

With few exceptions, the US military intelligence system had been designed to provide informationontheorderofbattleofopposingforces,focusedonquantifyingaknownopponentand laying out his capabilities in neat templates 128 The order of battle intelligence paradigm relies on lists, taxonomies, and categories to describe the enemy’s composition, disposition, strength, capabilities,limitations,andmostlikelycoursesofaction Thisapproachreducescomplexity,butin

sodoingreifiesmultidimensionalsocialrealityintoachecklistofcharacteristicsonaJIPOE

‘In the city of Najaf, most of the population is Shia Muslim,’ an intelligence officer might report This kind of triviamaybeusefulinalimitedway,butitdoesnotgettotheheartofthematter:howtheculturalmakeupofa populationmightaffectoperationsorthelikelycoursesofactionacivilianpopulationcouldbeexpectedtotake intheeventofamilitaryoperationintotheheartoftheaforementionedcity129

For military personnel whose tasks and missions involved working with the population whether in building governance capacity, establishing rule of law, or restoring infrastructure the order of battle approach to the human terrain was flatly inadequate. The complexity of the operating environment renders “a basic collection of facts, polling data, anecdotal references, and statistics insufficient for true understanding within the partnered commands.”130 Commanders and their staffs need “comprehensive” information about the host nation, and moreover they need to understandcontext:

The commander must be served with answers to real and complex issues without losing context as data is brought forward and presented as “truth” If the commander is served only with threat informational (PIR) and friendly force information (FFIR), decisions can (and often do) skew toward security operations and leave civil considerationsandcapacityquestionsunresolved131

As one Army officer put it, “I could have read Lonely Planet and had a better idea of what was goingoninHelmandthanIgotfromourIPB”132

Checklists do not work for counterinsurgency because they neither clarify relationships between elements nor provide explanations In order to help them understand the meaning of a behavior, ritual,orobjectwithinagivencontext,militarypersonnelneedexplanationsaddressingwhy,rather than lists of facts addressing what In the words of USMC General Anthony Zinni, the former commanderofUS CentralCommand(CENTCOM)andspecialenvoyfortheUnitedStatestoIsrael and the Palestinian Authority, “What I need to understand is how these societies function What makes them tick? Who makes the decisions? What is it about their society that’s so remarkably different in their values, in the way they think, compared to my values and the way I think in my Western,white-manmentality?”133

ThelimitsofthemilitaryintelligencesystemcameintosharpfocusinAfghanistan In Fixing Intel: A Blueprint for Making Intelligence Relevant in Afghanistan,then-MajorGeneralMichaelT Flynnet al madethecasethatthe“tendencytooveremphasizedetailedinformationabouttheenemyatthe expense of the political, economic, and cultural environment that supports it” has hindered counterinsurgencyeffortsinAfghanistan Theywrite:

Having focused the overwhelming majority of its collection efforts and analytical brainpower on insurgent groups, the vast intelligence apparatus is unable to answer fundamental questions about the environment in which U.S. and allied forces operate and the people they seek to persuade. Ignorant of local economics and landowners, hazy about who the powerbrokers are and how they might be influenced, incurious about the correlations between various development projects and the levels of cooperation among villagers, and disengaged from people in the best position to find answers whether aid workers or Afghan soldiers US intelligence officers and analysts can do little but shrug in response to high level decision-makers seeking the knowledge,analysis,andinformationtheyneedtowageasuccessfulcounterinsurgency134

Flynn et al proposed a variety of means to ameliorate the intelligence crisis in Afghanistan, including division of work along geographic lines, rotation of analysts from the regional commands to field units, and aggregation of information What Flynn et al did not address is how to shift the conceptual underpinning of the military intelligence system The primary difference between military intelligence and socio-cultural knowledge are the questions asked and the purpose behind those questions Military intelligence typically asks: who is my enemy? Where is my enemy? Why does he fight? The purpose behind those questions is to identify the enemy in time and space in order to neutralize the threat A socio-cultural knowledge system would need to ask the questions: whatis the localpoliticalsystem? Who has power,of whattype,and why? Whatis the localjudicial system?Whatarethelawsandsanctions,whomakesthem,andwhatistheprocessforadjudication and punishment? What is the economic system? How do people obtain goods and resources? What dotheyproduceandconsume?Thepurposebehindthesequestionsisthefacilitationofgovernance, economic or legal functions, either in support of a host nation government or in its absence (whetherthroughconquest,collapse,orlackofcapacity) Whethertheknowledgesystemofmilitary intelligence could be adapted to include socio-cultural knowledge (or whether a separate system shouldbedeveloped)remainsanopenquestion

The military intelligence system was not designed to produce comprehensive socio-cultural knowledge or explain the context and logic of a society The same could be said of most social sciences, including anthropology Indeed, anthropology as a discipline does not possess a standard definition of culture,135 much less a comprehensive theory of culture and society scalable and adaptable to different population groups The last time such a comprehensive, scalable, and adaptable theory existed in anthropology was structural functionalism in the 1930s and 1940s,136 discreditedasapartofthecorruptintellectuallegacyofimperialism AsHerbertLewisnotedin The Misrepresentation of Anthropology and Its Consequences, “the basic questions that our predecessorsstruggledwith100yearsagoarestillwithus,butthehard-wonlessonstheytaughtus are being forgotten”137 Instead of exploring the intellectual legacy of these classic authors, young

anthropologistsaretaughtingraduateschoolthattheyarecolonialists.AsLewiswrites:

Theonlyreasontoreadthemistoproducedevastatingdeconstructionsandcriticalreadings Thattheremaybe ideas that could be of use today, or bodies of data that can be appreciated and built upon, seems out of the question Thisisverytroublingbecausetheintellectualproblemsthatareattheheartofourfieldhavenotbeen solvedbythehermeneuticists,thepostmodernists,thepoststructuralists,thepostcolonialists138

Indeed, some anthropologists doubt whether their discipline has increased understanding of humankindatall.InthewordsofSirEdmundLeach,

during the hundred years of their existence academic anthropologists have not discovered a single universally validtruthconcerningeitherhumancultureorhumansocietyotherthanthosewhicharetreatedasaxioms:for example,thatallmenhavelanguage139

While this lack of any useful social theory or established social facts may actually come as good newstothoseanthropologistswhodisapproveoftheirdisciplinebeing‘weaponized,’itnevertheless comesasbadnewsforthemilitary

The question arises: why have anthropologists failed to develop a scalable, adaptable theory of societythatcouldbeusedoperationallybythemilitary?Theanswerhasseveralinterrelatedparts Anthropology the ‘handmaiden of colonialism’ was initially a practical science, applied at the margins of empire in support of governance and administration of the colonies As early as 1908, anthropologists began training administrators of the Sudan civil service 140 “Government Anthropologists” were appointed in Nigeria and the Gold Coast (now Ghana)141 to facilitate the policy of indirect rule, in which native institutions were incorporated into the machinery of colonial administration The relationship between anthropology and the British government was formalized in1926withthecreationoftheInternationalInstituteofAfricanLanguagesandCultures,financed by various colonial governments and led by Lord Lugard, the former governor of Nigeria and architect of indirect rule The Institute based its mission on Bronislaw Malinowski’s article “Practical Anthropology,” which argued that anthropological knowledge should be applied to solve the problems faced by colonial administrators, including those posed by “savage law, economics, customs, and institutions”142 Some anthropologists also served as colonial administrators, such as S F Nadel,whowasSecretaryofNativeAffairsinEritrea afterthe SecondWorldWar143 Whether anyofthisresearchwasactuallyusefulremainsanopendebate 144

Such “practical anthropology” had its detractors E E Evans-Pritchard and some of his contemporaries believed that applying anthropology to government problems amounted to an assault on scientific objectivity145 In 1934 Evans-Pritchard wrote to a fellow anthropologist from Cairo:

The racket here is very amusing. It would be more so if it were not disastrous to anthropology. Everyone is advising government Raymond [Firth], Forde, Audrey [Richards], Schapera. No one is doing any real anthropologicalwork allareclingingtotheColonialOfficecoach.Thisdeplorablestateofaffairsislikelytogo on, because it shows something deeper than making use of opportunities for helping anthropology. It shows an attitude of mind and is I think fundamentally a moral deterioration These people will not see that there is an unbridgeablechasmbetweenseriousanthropologyandAdministrationWelfarework146

AlthoughEvans-Pritchardbelievedthattheapplicationofknowledgewouldcompromisescientific work,147 he nevertheless served in combat during World War II, leading tribesmen against the ItalianArmyinEthiopiain1941 148

The debate concerning the scientific validity of applied research continued during World War II andafter149 Buttheanthropologicalrejectionofappliedresearch particularlyresearchperformed for government sponsors began with Project Camelot, an Army-sponsored study on the causes of stability and instability in developing countries The story begins when President John F Kennedy signed National Security Action Memorandum No 124 in 1962, calling for “proper recognition throughout the US government that subversive insurgency (‘wars of liberation’) is a major form of politico-military conflict equal in importance to conventional warfare”150 This type of warfare required knowledge of the societies in which the conflict was taking place Testifying before Congress in 1965, Dr R L Sproul, director of the Defense Department’s Advanced Research ProjectsAgency(ARPA),nowknownasDARPA,said:

Itis[our]primarythesisthatremoteareawarfareiscontrolledinamajorwaybytheenvironmentinwhichthe warfareoccurs,bythesociologicalandanthropologicalcharacteristicsofthepeopleinvolvedinthewar,andby thenatureoftheconflictitself151

Based on the recommendations of the Smithsonian Institution and the Defense Science Board,152 theSpecialOperationsResearchOffice(SORO),whichhadbeenestablishedin1957toserveArmy’s psychologicalwarfaredirectorate,wasexpandedin1962

According to a letter from the Office of the Director of the SORO, Project Camelot was “a study whose objective is to determine the feasibility of developing a general social systems model which wouldmakeitpossibletopredictandinfluencepoliticallysignificantaspectsofsocialchangeinthe developing nations of the world”153 Project Camelot was designed to test over eight hundred untestedandoftencontradictoryhypothesesaboutinternalwar,suchaswerethesewarsgenerated by poverty? Or did they result from rapid economic progress?154 While this research sounds in retrospectrelativelyinnocuous,itwasdenouncedbyRadioHavanaandRadioMoscowasaformof

“imperialism” and criticized by anthropologists as a means to control, enslave, and even annihilate the communities being studied 155 In Washington, following Congressional hearings on the subject, SecretaryofDefenseRobertMcNamaracanceledProjectCamelotin1965 156

The commonly accepted narrative among anthropologists (often recounted in graduate seminars) is that their protests resulted in the cancellation of Project Camelot In fact, Project Camelot was curtailedbecauseofaturfwarbetweentheDepartmentofStateandDepartmentofDefense Inthe viewoftheStateDepartment,suchresearchimpliedthatthemilitarywasengaginginforeignpolicy matters, extending beyond its purely military remit In the words of Seymour Deitchman, a former SpecialAssistantintheDoDOfficeoftheDirectorofDefenseResearchandEngineering, theDoDwascondemnedfortryingtolearnsomethingaboutitstask,sinceifittriedtodosothisimplieditwas seeking control of foreign policy On the other hand, the military were condemned for being insensitive to the nuancesofinternationalaffairsanddiplomacy Eitherway,theDoDwasoutofline157

Across the board, the Vietnam War created a wide rift between the military and academics. “Laying the blame at the boots of the military rather than in the hands of the politicians, many university-basedsocialscientiststurnedtheirbacksontheproblemsof[Departmentof]Defenseon moral grounds.”158 Anthropologists in particular sought to cleanse themselves of the toxic muck of government influence that corrupted the moral and intellectual purity of their research and endangered their informants. As Kathleen Gough Aberle wrote in 1967, “We must dissociate ourselves from the acts of governments that seek to destroy these people [about whom we have gatheredknowledge]ortoinfringetheirrights.”159 Appliedresearchcametobeseenasinherently biased in favor of the sponsor’s interests and ‘pure’ research was nothing more than misguided positivism.160 Anthropology re-cast itself not as a practical, applied discipline that could be used to solve problems of government and administration but rather as an advocacy program for the oppressed.In1970,EricR.WolfandJosephG.Jorgensenarguedin Anthropology on the Warpath in Thailand thatanthropologyis“arevolutionarydiscipline,”andthat“anthropologistsmustbewilling to testify on behalf of the oppressed peoples of the world…”161 Neither research nor scientific objectivitywastobethebasisofanthropology;politicalactivismwasthenewgoal.162

Rather than finding practical and constructive means by which to actually influence policy, strategy, and operations, studying the “dysfunctions of … policy-making”163 became anthropologists’ main focus. They barricaded themselves in the Ivory Tower and spent their time discussing“howmanycross-cousinscoulddanceontheheadofapin.”164 InthewordsofMargaret Mead,

I think the withdrawal of anthropologists just going and sucking their thumbs in corners or marching in demonstrations was lamentable If enough anthropologists had been willing to work on Viet Nam, we might havebeenabletodosomethingthatmadesomesense Buttheyhadallwithdrawn165

In recasting anthropology as a revolutionary discipline, anthropologists rejected its history as the ‘handmaiden of colonialism’ and began to critique their own relationship to power. Many anthropologistscametoviewitasaformofOrientalism,“akindofWesternprojectionontoandwill togovernovertheOrient.”166 InthewordsofPeterPels:

Around 1970, anthropologists were often told to shun collaboration with the powerful in colonial planning and strategy. Instead, they should side with “indigenous” peoples in the (neo-)colonial struggle, to help the latter to achieve the modernization that a perfidious combination of an ideology of modernization and a strategy of exploitationdeniedthem.Inotherwords,reinventionsofanthropologyoftenusedimagesofcolonialismastheir cutting edge. Only in the last 25 years, however, such critique and reflexivity have become structural, owing to the increasing stress on the third view of colonialism, as a struggle that constantly renegotiates the balance of domination and resistance Since one cannot simply demarcate a “past” colonialism from struggles in the present, the anthropology of colonialism systematically interrogates contemporary anthropology as well as the colonialcircumstancesfromwhichitemerged Theanthropologyofcolonialismisalwaysalsoananthropologyof anthropology, since in many methodological, organizational and professional aspects the discipline retains the shapeitreceivedwhenitemergedfrom(ifpartlyinoppositionto)early20thcenturycolonialcircumstances167

Inshort,anthropologistsbegantoscrutinizetheirowndisciplineanditscoloniallegacy Scientific objectivity came to be seen as a form of oppression that mystified and concealed the anthropologists’ relationship to power and contributed towards the colonization of the subject “Scientific objectivity,” in the words of Eric R Wolf and Joseph G Jorgensen, “implies the estrangementoftheanthropologistfromthepeopleamongwhomheworks”168 Infact,in2010 the executive board of the American Anthropological Association adopted a long-range plan that removes the word “science” from the organization’s mission statement 169 As one blogger noted, using the term “science” in the association’s mission statement maintained “the colonizing, privileging,superiorpositionalityofanthropologythatcontinuestoplaguethediscipline”170 Oneof thefundamentalprocessesofscienceistheaggregationofknowledgeinordertorevealunderlying truth Yetgeneralization,writesAbu-Lughod,ismorallyquestionable,inthat“aspartofprofessional discourseof‘objectivity’andexpertise,itisinevitablyalanguageofpower”171

To return to the original question: why have anthropologists failed to develop a scalable, adaptable theory of society that could be used operationally by the military? In short, many anthropologists believe that applied research is inherently tainted, that their proper role is one of political advocacy, and that scientific objectivity is not possible Given the anti-positivism of most contemporary anthropologists, it is highly unlikely that a unified field theory of society will be

Turn static files into dynamic content formats.

Create a flipbook
Military anthropology: soldiers, scholars and subjects at the margins of empire montgomery mcfate - by Education Libraries - Issuu