Skip to main content

Immediate download Program evaluation: methods and case studies 9th edition, (ebook pdf) ebooks 2024

Page 1


Program

Evaluation: Methods and Case Studies 9th Edition, (Ebook PDF)

Visit to download the full and correct content document: https://ebookmass.com/product/program-evaluation-methods-and-case-studies-9th-e dition-ebook-pdf/

More products digital (pdf, epub, mobi) instant download maybe you interests ...

Health Program Planning and Evaluation 3rd Edition, (Ebook PDF)

https://ebookmass.com/product/health-program-planning-andevaluation-3rd-edition-ebook-pdf/

Business Ethics: Case Studies and Selected Readings (MindTap Course List) 9th Edition, (Ebook PDF)

https://ebookmass.com/product/business-ethics-case-studies-andselected-readings-mindtap-course-list-9th-edition-ebook-pdf/

Program Evaluation: Alternative Approaches and Practical Guidelines – Ebook PDF Version

https://ebookmass.com/product/program-evaluation-alternativeapproaches-and-practical-guidelines-ebook-pdf-version/

C How to Program: With Case Studies in Applications and Systems Programming, Global Edition Paul Deitel

https://ebookmass.com/product/c-how-to-program-with-case-studiesin-applications-and-systems-programming-global-edition-pauldeitel/

Chemical Product Formulation Design and Optimization: Methods, Techniques, and Case Studies Ali Elkamel

https://ebookmass.com/product/chemical-product-formulationdesign-and-optimization-methods-techniques-and-case-studies-alielkamel/

The ABCs of Evaluation: Timeless Techniques for Program and Project Managers (Research Methods for the Social Sciences Book 56) 3rd Edition, (Ebook PDF)

https://ebookmass.com/product/the-abcs-of-evaluation-timelesstechniques-for-program-and-project-managers-research-methods-forthe-social-sciences-book-56-3rd-edition-ebook-pdf/

Case

Studies in Psychotherapy 7th Edition, (Ebook PDF)

https://ebookmass.com/product/case-studies-in-psychotherapy-7thedition-ebook-pdf/

Practical

Approaches to Applied Research and Program Evaluation for Helping Professionals 1st Edition, (Ebook PDF)

https://ebookmass.com/product/practical-approaches-to-appliedresearch-and-program-evaluation-for-helping-professionals-1stedition-ebook-pdf/

Program Evaluation for Social Workers: Foundations of Evidence Based Programs 7th Edition, (Ebook PDF)

https://ebookmass.com/product/program-evaluation-for-socialworkers-foundations-of-evidence-based-programs-7th-edition-ebookpdf/

ProgramEvaluation

This text provides a solid foundation in program evaluation, covering the main components of evaluating agencies and their programs, how best to address those components, and the procedures to follow when conducting evaluations. Different models and approaches are paired with practical techniques, such as how to plan an interview to collect qualitative data and how to use statistical analyses to report results In every chapter, case studies provide real world examples of evaluations broken down into the main elements of program evaluation: the needs that led to the program, the implementation of program plans, the people connected to the program, unexpected side effects, the role of evaluators in improving programs, the results, andthefactorsbehindtheresults Inaddition,thestoryofoneoftheevaluatorsinvolvedineachcasestudyis presentedtoshowthehumansideofevaluation.

The Ninth Edition offers enhanced and expanded case studies, making them a central organizing theme The new edition also features online resources with an instructor test bank, sample program evaluation reports,andadditionalannotatedresources.

KennethJ.Linfield is Professor and Director of Graduate Training in the School of Professional Psychology at Spalding University in Louisville, Kentucky, USA where he teaches the Program Evaluation course in the doctoralClinicalPsychologyprogram.

EmilJ.Posavac is Professor Emeritus of Psychology at Loyola University of Chicago, USA where he served asdirectoroftheAppliedSocialPsychologyGraduateProgramandchairmanofthePsychologyDepartment

ProgramEvaluation MethodsandCaseStudies

NinthEdition

Nintheditionpublished2019 byRoutledge 711ThirdAvenue,NewYork,NY10017

andbyRoutledge

2ParkSquare,MiltonPark,Abingdon,Oxon,OX144RN

RoutledgeisanimprintoftheTaylor&FrancisGroup,aninformabusiness ©2019Taylor&Francis

TherightofKennethJ LinfieldandEmilJ Posavactobeidentifiedasauthorsofthisworkhasbeenassertedbytheminaccordancewith sections77and78oftheCopyright,DesignsandPatentsAct1988

Allrightsreserved Nopartofthisbookmaybereprintedorreproducedorutilisedinanyformorbyanyelectronic,mechanical,orother means,nowknownorhereafterinvented,includingphotocopyingandrecording,orinanyinformationstorageorretrievalsystem,without permissioninwritingfromthepublishers

Trademarknotice:Productorcorporatenamesmaybetrademarksorregisteredtrademarks,andareusedonlyforidentificationandexplanation withoutintenttoinfringe

FirsteditionpublishedbyPrenticeHall,Inc (1980)

EightheditionpublishedbyPearsonEducation,Inc (2011)

LibraryofCongressCataloging-in-PublicationData

Names:Linfield,KennethJ.,author.|Posavac,EmilJ.,author.

Title:Programevaluation:methodsandcasestudies/KennethJ LinfieldandEmilJ Posavac

Description:9thedition |NewYork:Routledge,2018 |RevisededitionofProgramevaluation,c2011 |Includesbibliographical referencesandindex

Identifiers:LCCN2018010276|ISBN9781138103962(hardback:alk paper)|ISBN9781315102429(ebook)

Subjects:LCSH:Evaluationresearch(Socialactionprograms) UnitedStates.

Classification:LCCH625U5P622018|DDC3616/1072 dc23LCrecordavailableathttps://lccnlocgov/2018010276

ISBN:978-1-138-10396-2(hbk)

ISBN:978-1-315-10242-9(ebk)

TypesetinTimesNewRomanMTStd bydiacriTech,Chennai

VisittheeResources:wwwroutledgecom/9781138103962

KenLinfielddedicatesthisbooktoPaulandLoisLinfield,hisparents,inmemoriam,andtotheloveof hislife,AmyLinfield,whohasalwaysbelievedinhim

EmilPosavacdedicatesthisbooktohisgrandchildren:Austin,Brett,andCaleigh.

Contents

Preface

1 ProgramEvaluation:AnOverview

EvaluationAreasThatNeedtoBeConsidered

MeetingNeeds

Implementation Stakeholders

SideEffects ImprovementFocus Outcomes

Nuances(Mechanisms) MISSION

CommonTypesofProgramEvaluations

AssessNeedsoftheProgramParticipants

ExaminetheProcessofMeetingtheNeeds

MeasuretheOutcomesandImpactsofaProgram IntegratetheNeeds,Costs,andOutcomes

ImportantIssuesinEvaluations

TimeFramesofNeeds

ExtensivenessofPrograms

PurposeofProgramEvaluation

TheRolesofEvaluators

Principles,Competencies,andCredentialing

ComparisonofInternalandExternalEvaluators

EvaluationandService

ActivitiesOftenConfusedwithProgramEvaluation

EvaluationandRelatedActivitiesofOrganizations

SummaryandPreview

StudyQuestions

AdditionalResource

2 PlanninganEvaluation

Overview Evaluationmodels

AnImprovement-FocusedApproach

StepsinPreparingtoConductanEvaluation

IdentifytheProgramandItsStakeholders

BecomeFamiliarwithInformationNeeds

PlantheEvaluation

DysfunctionalAttitudesMakinganEvaluationChallenging

OurProgramIsExemplary AnEvaluationWillOffendtheStaff AnEvaluationWillInhibitInnovation

OurProgramWillBeTerminated TheInformationWillBeMisused EvaluationMethodsAreLessSensitiveThanPerceptionsofStaff EvaluationDrainsProgramResources EvaluationsHaveLittleImpact TheEffectofTheseAttitudes

SummaryandPreview

StudyQuestions

AdditionalResource

3 DevelopingandUsingaTheoryoftheProgram

DevelopingaProgramTheory WhyaProgramTheoryIsHelpful HowtoDevelopaProgramTheory ImplausibleProgramTheories

EvaluationQuestionsFlowfromProgramTheory

DoestheProgramorPlanMatchtheValuesoftheStakeholders? DoestheProgramorPlanMatchtheNeedsofthePeopletoBeServed? DoestheProgramasImplementedFulfillthePlans?

DotheOutcomesAchievedMeasureUptotheGoals? SeekingInformationabouttheLevelsofOutcomeExpected EvaluatingwithoutaTheoreticalModel CautionsinChoosingEvaluationCriteria

CriteriaMustReflectaProgram’sPurposes CriteriaMustBeundertheStaff’sControl StakeholdersMustParticipateinSelectingEvaluationCriteria IdentifyingGoalsandObjectives HowMuchAgreementonGoalsIsNeeded? DifferentTypesofGoals EvaluationQuestionsThatApplytoAllPrograms IstheProgramAccepted? AretheResourcesDevotedtotheProgramBeingExpendedAppropriately? SomePracticalLimitationsinSelectingEvaluationCriteria EvaluationBudget TimeAvailablefortheProject CriteriaThatAreCredibletotheStakeholders SummaryandPreview

StudyQuestions

AdditionalResource

4 DevelopingMeasuresofImplementationandOutcomes

SourcesofDataforEvaluation IntendedBeneficiariesoftheProgram ProvidersofServices

Observers

WhichSourcesShouldBeUsed?

GatheringInformationWisely

UseNonreactiveMeasures

UseOnlyVariablesRelevanttotheEvaluation

UseReliableMeasures

UseValidMeasures

UseMeasuresThatCanDetectChange

UseCost-EffectiveMeasures

TypesofMeasuresofEvaluationCriteria

WrittenSurveysandInterviewswithProgramParticipants

Checklists,Tests,andRecords

PreparingSpecialSurveys

FormatofaSurvey

InstructionsandPretests

SummaryandPreview

StudyQuestions

AdditionalResource

5 EthicsinProgramEvaluation

ExamplesoftheProblem

AProjectThatCannotBeDoneWell AdvocacyversusEvaluation

StandardsforthePracticeofEvaluation

EthicalIssuesInvolvedintheTreatmentofPeople

DetectingIneffectivePrograms

ObtainingInformedConsent

MaintainingConfidentiality

RoleConflictsFacingEvaluators

RecognizingtheInterestsofDifferentStakeholders

ProgramManagersAreConcernedwithEfficiency

StaffMembersSeekAssistanceinServiceDelivery

ClientsWantEffectiveandAppropriateServices

CommunityMembersWantCost-EffectivePrograms

TheValidityofEvaluations

ValidMeasurementInstruments

SkilledDataCollectors

AppropriateResearchDesign

AdequateDescriptionsofProgramandProcedures

AvoidingPossibleNegativeSideEffectsofEvaluationProcedures

CanSomeoneBeHurtbyInaccurateFindings?

ConsiderStatisticalTypeIIErrors

PayAttentiontoUnplannedNegativeEffects

AnalyzeImplicitValuesHeldbytheEvaluator

InstitutionalReviewBoardsandProgramEvaluation

EthicalProblemsEvaluatorsReport SummaryandPreview

StudyQuestions

AdditionalResource

6 TheAssessmentofNeed

DefinitionsofNeed

SourcesofInformationfortheAssessmentofNeed

DescribingtheCurrentSituation

SocialIndicatorsofNeed

CommunitySurveysofNeed

ServicesAlreadyAvailable

KeyInformants

FocusGroupsandOpenForums

InadequateAssessmentofNeed

FailingtoExamineNeed

FailingtoExaminetheContextofNeed

FailingtoRelateNeedtoImplementationPlans

FailingtoDealwithIgnoranceofNeed

UsingNeedsAssessmentsinProgramPlanning

SummaryandPreview

7 MonitoringtheImplementationandtheOperationofPrograms

TheStructureofthisChapter

IntroductiontoMonitoring MonitoringasaMeansofEvaluatingPrograms

WhattoSummarizewithInformationSystems

RelevantInformation

ActualStateofProgram

ProgramParticipants

ProvidersofServices

ProgramRecordsandInformationSystems

ProblemswithAgencyRecords

IncreasingtheUsefulnessofRecords

AvoidingCommonProblemsinImplementinganInformationSystem GuardagainsttheMisuseoftheInformation

AvoidSettingArbitraryStandards

AvoidServingtheNeedsofOnlyOneGroup

AvoidDuplicatingRecords

AvoidAddingtotheWorkoftheStaff

AvoidObsessionwithTechnology SummaryandPreview

8 QualitativeEvaluationMethods

EvaluationSettingsBestServedbyQualitativeEvaluations

AnAfter-SchoolProgram

EvaluatingaPoliticalCampaign GatheringQualitativeInformation

TheCentralImportanceoftheObserver ObservationalMethods

InterviewingtoObtainQualitativeInformation

CarryingoutQualitativeEvaluations

PhaseI:MakingUnrestrictedObservations

PhaseII:IntegratingImpressions

PhaseIII:SharingInterpretations

PhaseIV:PreparingReports

AreQualitativeEvaluationsSubjective? CoordinatingQualitativeandQuantitativeMethods

BringingNumberstoLife

GettingInsightsfromtheMostSuccessfulParticipants

GainingInsightsfromWhatWorksWell ChangingEmphasesasUnderstandingExpands

TheEvaluationQuestions

CostofEvaluation

PhilosophicalAssumptions

SummaryandPreview

StudyQuestions

AdditionalResource

9 OutcomeEvaluationswithOneGroup

One-GroupEvaluationDesigns

ObserveOnlyaftertheProgram ObservebeforeandaftertheProgram UsesofOne-Group,DescriptiveDesigns

DidtheParticipantsMeetaCriterion?

DidtheParticipantsImprove?

DidtheParticipantsImproveEnough?

RelatingChangetoAmountofServiceandParticipantCharacteristics ThreatstoInternalValidity

ActualChangesintheParticipantsNotRelatedtoProgramParticipation ApparentChangesDependentonWhoWasObserved ChangesRelatedtoMethodsofObtainingObservations EffectsofInteractionsofTheseThreats

InternalValidityThreatsAreDouble-EdgedSwords ConstructValidityinPretest–PosttestDesigns

OverinterpretingtheResultsofOne-GroupDesigns UsefulnessofOne-GroupDesignsasInitialApproachestoProgramEvaluation

AssessingtheUsefulnessofFurtherEvaluations

CorrelatingImprovementwithOtherVariables

PreparingtheFacilityforFurtherEvaluation

SummaryandPreview StudyQuestions AdditionalResource

10 Quasi-ExperimentalApproachestoOutcomeEvaluation

IncreasingtheNumberofTimesObservationsAreMade PatternsofOutcomesoverTimePeriods

AnalysisofTime-SeriesDesigns

ObservingOtherGroups

NonequivalentControlGroupDesigns

ProblemsinSelectingAppropriateComparisonGroups

RegressionDiscontinuityDesign

ObservingOtherDependentVariables

CombiningDesignstoIncreaseInternalValidity

Time-SeriesandNonequivalentControlGroups

SelectiveControlDesign

SummaryandPreview

StudyQuestions

AdditionalResource

11 UsingExperimentstoEvaluatePrograms

ExperimentsinProgramEvaluation

BenefitsofExperiments

ExperimentalDesigns

ObjectionstoExperimentation

Don’tExperimentonMe!

WeAlreadyKnowWhatIsBest IKnowWhatIsBestforMyClient ExperimentsAreJustTooMuchTrouble

TheMostDesirableTimestoConductExperiments WhenaNewProgramIsIntroduced WhenStakesAreHigh WhenThereIsControversyaboutProgramEffectiveness WhenPolicyChangeIsDesired WhenDemandIsHigh

SuccessfullyImplementingandInterpretinganExperimentalDesign TakePrecautionsbeforeDataCollection

KeepTrackofRandomizationWhileanExperimentIsinProgress AnalyzetheDataReflectively

SummaryandPreview

StudyQuestions AdditionalResource

12 AnalysesofCostsandOutcomes

ProgramCosts

TypesofCosts

AnExampleBudget

TheNecessityofExaminingCosts

ComparingOutcomestoCosts

AnIllustrationofCost–BenefitAnalysis

TheEssenceofCost-EffectivenessAnalysis WhenOutcomesCannotBePutintotheSameUnits

SomeDetailsofCostAnalyses

UnitsofAnalysisMustReflectthePurposeoftheProgram FutureCostsandBenefitsAreEstimated WhoPaystheCostsandWhoReapstheBenefits?

UsingCost–BenefitandCost-EffectivenessAnalyses

MajorCriticismsofCostAnalyses

TheWorthofPsychologicalBenefitsIsHardtoEstimate PlacingaValueonLivesSeemsWrong

Cost–BenefitandCost-EffectivenessAnalysesRequireManyAssumptions

SummaryandPreview

13 EvaluationReports:InterpretingandCommunicatingFindings

DevelopingaCommunicationPlan

ExploreStakeholderInformationNeeds

PlanReportingMeetings

SetaCommunicationSchedule

PersonalPresentationsofFindings

NeedforPersonalPresentations

ContentofPersonalPresentations

AudienceforthePersonalPresentations

DistributingDraftsofReports

ContentofFormalWrittenEvaluationReports

RememberthePurposesoftheFormalReport

ProvideanOutlineandaSummary

DescribetheContextoftheEvaluation

DescribetheProgramParticipants

JustifytheCriteriaSelected

DescribetheData-GatheringProcedures

ProvidetheFindings

DevelopRecommendations

FormalReportsShouldLookAttractive

ProvideProgressReportsandPressReleases

SummaryandPreview

14 HowtoEncourageUtilization

ObstaclestoEffectiveUtilization

ConstraintsonManagers

ValueConflictsamongStakeholders

MisappliedMethodology

EvaluatingaProgramatArm’sLength

IgnoringWhatIsGoingReallyWell

DealingwithMixedFindings

Don’tAbdicateYourResponsibility

Don’tTaketheEasyWayOut

ShowHowtoUsetheEvaluationtoImprovetheProgram

UsingEvaluationsWhenanInnovativeProgramSeemsNoBetterThanOtherTreatments WhenCanEvaluatorsBeSureGroupsDoNotDiffer?

AreEvaluationsValuableEvenWhenNoAdvantagefortheInnovationIsFound?

DevelopingaLearningCulture

WorkwithStakeholders

AdoptDevelopmentalInterpretations

FrameFindingsinTermsofImprovements

TreatFindingsasTentativeIndicators,NotFinalAnswers

RecognizeServiceProviders’Needs

KeepEvaluationFindingsontheAgency’sAgenda

TheEvaluationAttitude

HumilityWon’tHurt

ImpatienceMayLeadtoDisappointment

RecognizetheImportanceoftheEvaluator’sPerspective

WorkonPracticalQuestions

WorkonFeasibleIssues

AvoidDataAddiction

MakeReportsAccessible

SeekEvaluationsofYourOwnWork

EncouragetheDevelopmentofaLearningCulture

SummaryandPossibleTrendsforProgramEvaluation

StudyQuestions

AdditionalResource

References

AuthorIndex

SubjectIndex

Preface

Welcome to the exciting field of program evaluation and to this introduction to the practice of it If you do not already know that program evaluation is a fascinating area, I encourage you to pay particular attention to the Evaluator Profiles throughout this book and the accounts of how many of them discovered this almost hidden treasure As you will learn, it involves a set of skills and practices that can provide valuable insights to crucial human services as well as provide important components for careers, or even an entire career But unlike many occupations such as medical doctors or professors, too many people know little or nothing about it, so few children say, “I want to be a program evaluator when I grow up ” Many current evaluators can tell wonderfulstoriesabouthowtheydiscoveredthisgreatfieldthattheyneverknewexisted

This textbook is intended as a solid introduction to the field for those who are ready to build a good foundation. On the one hand, it covers all the main aspects and provides substantial practical insights. Studentswholearnthismaterialdiligently,especiallyiftheyalsohavetheopportunitytohavesomehands-on experiences while doing so, should be prepared then to venture into formal program evaluations, although many will be glad to start as part of a team. On the other hand, there are a number of specific aspects of professional program evaluation that would benefit from further specialized study, such as particular approaches to evaluation like empowerment and utilization, or specific forms of evaluation like needs assessment. This good introduction does not pretend to be fully comprehensive, and those who are ready to tacklethefullfieldhavemanyexcellentadvancedbooksandformalprogramstochoosefrom

Still, this ninth edition builds on a fine tradition even as it ventures into some new territory Emil Posavac’s editions have made a long-standing contribution to the field. I (Ken Linfield) have used his textbook every year since I started teaching our doctoral course now twelve years ago, and it was the one used for years before I started As I join in writing this new edition as the first author, I am especially pleased to expand the case studies and profiles to all fourteen chapters, providing more extended examples of a broader range of evaluations and evaluators The case studies provide details from the evaluators’ perspectives even as they have also been organized with the MISSION framework introduced in this edition The MISSION acronym is presented to help evaluators, especially those newer to the field, to remember easily the broad range of elements in program evaluation Meeting needs, Implementation, Stakeholders, Side effects, Improvementfocus,Outcomes,andNuances(seeespeciallyChapter1)

Another extension of the solid material in this text matches the developments of our time, adding resourcesavailableonlinetothehardcopytextbooksorthee-booksthatpresentthestandardchapters These “eResources” provide an important span of information that would not fit in a traditional textbook multiple examplesofevaluationreports,extensivedescriptionsandsummarytablesofthegrowingnumberofmodelsof evaluation,andmuchmore.Further,activehyperlinksandothermaterialslikespreadsheetsprovideadynamic option impossible with traditional textbooks And not only do the eResources also permit some level of interaction with the first author, there are some lighthearted sections as well check out the video of my “Program Evaluator” song and others. Perhaps more importantly, regular updates will address changes since thepublicationofthebookyouarereading

So welcome to the great field of program evaluation I invite you to find the portions that particularly connect with what you are passionate about improving services for people who have endured traumatic events, attending to a population that is important to you, building on essential values like evidence and integrity,oranother Enjoytheride!

1 ProgramEvaluation

AnOverview

Suppose you are working for the Student Counseling Center at Western Tech in a year or two The center planstoofferaSexualAssaultPreventionProgramtowomenandmeninthefollowingmonth,andyouhave beenaskedtodevelopaplanthatwillpermitthecenter’sstafftodecidewhether(a)tooffertheprogramagain because it is successful, (b) to alter the program in order to make it more useful to participants, or (c) to drop the program because it fails to meet a need You might stop reading for a moment and write down the steps you think are necessary to measure the success of such a program. Among other points, consider what evidence would indicate the program is successful, what would mean that it should be improved, and what wouldshowthatitshouldbeended

Because the center wishes to maintain and promote useful services to students, evaluating a program that mightreducesexualassaultsoncampusisanimportantassignment Thestaffofthecenterwouldnotwantto devoteresourcesforaprogramthatdoesnotmeettheneedsofstudentsoncampus;insuchacase,something more helpful should be offered instead. If the program is good, you would want your plan to detect its strengths; where it needs improvement, you would want to detect its limitations When you are finished with thistext,youwillbereadytotacklethisproject Tobegin,whatisprogramevaluation?

The practice of evaluating one ’ s own efforts is as natural as breathing. Cooks taste their gravy and sauce and basketball players watch to see whether their shots go in. Indeed, it would be most unwise after turning on the hot water to neglect to check the water temperature before stepping into a shower At a basic level, program evaluation is nothing more than applying this commonsense practice to settings in which organized efforts,called“programs,”aredevotedtohelpingpeoplewhoneededucation,medicaltreatment,jobtraining, safestreets,welfareassistance,safetywhiletravelinginairplanes,recreationalservices,oranyofthethousands of services provided in a modern society Program evaluation is a methodology to learn the depth and extent of need for a human service and whether the service is likely to be used, whether the service is sufficient to meet the unmet needs identified, and the degree to which the service is offered as planned and actually does help people in need at a reasonable cost without unacceptable side effects Utilizing research methods and concepts from psychology, sociology, administration and policy sciences, economics, and education, program evaluatorsseektocontributetotheimprovementofprograms

There are several crucial differences between the natural, almost automatic, evaluations we carry on as we work and play and the practice of program evaluation in organizational settings. These differences make program evaluation harder than the self-evaluations that we all do First, organizational efforts are nearly always carried out by a team whether that be a school team of teachers, coaches, and administrators; a hospital team of physicians, nurses, and technicians; or a welfare department team of social workers, counselors,andfileclerks Thisspecializationmeansthattheresponsibilityforprogrameffectivenessisshared among many people Furthermore, the results of such programs an educated student, a well patient, or an effectiveyoungmother arenotthesoleresponsibilityofanyindividual.

Second, most programs attempt to achieve objectives that can only be observed sometime in the future rather than in a matter of minutes, as is the case with a cook adding a spice to a simmering pot or a painter repairing a damaged wall. In other words, as the time between an activity and the desired outcome of that activity lengthens, it becomes less clear what we are to observe in order to decide that the activity is being carried out appropriately or not and what could be done to improve the result of the activity In fact, the choice of criteria to use in deciding whether a program is working well creates debates among evaluators, programpersonnel,clients,andfundingagencies.Howtorespondwhenaproblemisdetectedisoftenjustas controversial

Third,incontrasttoevaluatingourownefforts,therearemanydifferentpartiesinvolvedintheevaluations of programs For example, the effectiveness of teaching in a school may be assessed by evaluators who work for the central administration or the school board. It would not be surprising that individual staff members mightfeelthreatenediftheevaluatorsdonothavetheirtrustbecause,inanextremecase,thelivelihoodofthe teachersmightbeharmedbyanincompetentlydoneprogramevaluation

Last, programs are usually paid for by parties other than the clients of a program Funds for the salaries of nurses are obtained from payments to hospitals by insurance companies and government agencies, and schoolteachers are paid through taxes collected by school districts Although nearly all nurses and teachers want to do effective work, their job security is at least in the short term more dependent on keeping the programfunderssatisfiedthanservingtheirpatientsandstudentswell.

Such complications as these make program evaluation considerably more difficult to do than the evaluations of our own activities that we perform so easily and naturally This text focuses its discussion on evaluations of programs in human services, such as education, medical care, welfare, rehabilitation, or job training Program evaluation is one form of the general discipline of evaluation that includes employee assessment, quality control in manufacturing, and policy analysis, among other activities (Scriven, 2003) The various kinds of evaluation are sometimes confused with each other. All forms of evaluation involve discovering the value and worth of something; however, the focuses, purposes, and methodologies are quite different

EVALUATIONAREASTHATNEEDTOBECONSIDERED

A common assumption by people who are not familiar with program evaluation is that all evaluators do is measuretheoutcomeofaprogram perhapscountinghowmanyoftheclientsinasubstanceabusetreatment program no longer use the substance, either at the end of the program or at a later time, or determining the typicalchangeinknowledge(hopefullyanincrease)forthosewhohaveattendedaseriesofworkshops.Aswill beseenbelow,measuringoutcomesisaveryimportantpartofprogramevaluation Butitisonlyonepart We will make the case briefly here and then repeatedly throughout this text that program evaluation is a much broader set of activities than just measuring the outcome of a program and that good evaluators consistently think about this wider range of elements The following paragraphs introduce the seven general areas that program evaluators need to consider It should be noted that some evaluations may not explicitly include all these elements, and at times a single one of the components may be a complete evaluation (for example, a needsassessment) Butchoosingnottoincludeoneormoreelementsshouldbeadeliberatedecisionbasedon a clear rationale, not a matter of focusing so intently on a limited set of areas that one forgets other considerations.

MeetingNeeds

Most often, program evaluations are conducted on existing programs where there is a reasonable likelihood thattheprogramswillcontinueinsomewhatsimilarfashionfortheforeseeablefuture.Asaresult,theoriginal need that led to the program may not be raised as an important point of the evaluation; nearly everyone involved may just assume that doing something to address that need is a worthwhile activity In fact, many people may be unable to imagine not having certain programs. Most of us assume that education is necessary for children and that we must have police and fire departments in our communities without needing to documentprecisedetailsofwhatthosechildrendonotyetknoworofthepotentialforcrimeandfires Asyou willseeinChapter6, “The Assessment of Need,” there are a number of important aspects of this component ofprogramevaluationbeyondjustdocumentingthatthereisalegitimateproblemthattheprogramaddresses Oneoverarchingpoint,however,isafocusonunmetneeds Althoughweallneedtobreatheair,wedonot havelargenumbersofprogramsprovidingairnorevaluationstodiscussthem.Ratherobviously,programsare developed when one or more needs are not already addressed So evaluators consider unmet needs whether in an area that has never been addressed or the extent to which current needs are not fully met by existing programs.Variousotheraspectscanalsobeconsidered,suchashowtheneedmightbeexpectedtochangein thefutureorhowtheneedisperceiveddifferentlybydifferentpeople

Implementation

Acommonproblemwithprogramsisthatsomeareeitherneverimplementedasplannedorareimplemented in such a way that people in need receive no or minimal benefit. Consequently, it is essential that evaluators confirmpointsrangingfromthefactthatprogrampersonnelhavebeenhiredandofficeshavebeenopenedto documenting how many clients have found the program and the nature of the services provided When the primary focus addresses such issues, the project may be called an implementation evaluation, in contrast to an outcomeevaluationthatalsoconsiderstheresultsoftheinterventions

Although the monitoring function of program evaluation may at first strike the reader as unnecessary, there are many examples of programs that, although funded, were never put into practice. Even more common, descriptions of programs in agency materials may be accurate only with regard to what was intended, but not what is currently happening In fact, a recent estimate notes “that failure rates for organizational change implementation typically range from 28% to as high as 93%” (Durand, Decker, & Kirkman, 2014, p. 404). To be fair, the actual practices could be better than originally planned, rather than worse In any case, an essential area for evaluators is monitoring the details of how the program has been implemented.

Stakeholders

In the process of conducting an evaluation, evaluators might generally expect to have some contact with the clientswhoareservedbytheprogram,especiallyindirectcontact,byconsideringdatafromtheclientssuchas informationontheirchangedconditionortheirresponsestoaquestionnaire.Butitisessentialthatevaluators takeintoaccountthemanypeoplewhoareinvolvedwithaprograminonewayoranother,thosewhoprovide theserviceaswellasthosewhoreceiveit,andthosewhoaresupportivefromadistanceaswellasthosewhose connection is either mixed or even opposed to some degree. The idea that all of these people have a stake of someformintheprogramhasledtotheterm“stakeholders”asageneralwaytotalkaboutthem

Staff providing the services are obviously highly involved both because they deal day-to-day with the clients and because they generally are paid to provide the services. Paying attention to staff as stakeholders involves many points such as recognizing that therapists often know important details about clients beyond what is contained in agency records, that staff may either resist change or be eager for it, and that most employeeshavesomelevelofapprehensionabouttheresultsofanevaluationintermsoftheirownfuture.Of course, there are a range of staff positions in most agencies therapists, administrators, support staff, and others Inaddition,mostagencieshaveaboardthatoverseesgeneraloperations Oftenthereareothersinthe community who care about the program in some way typically including family and perhaps friends of clients,peopleinthecommunitywhoarepassionateaboutthespecificneedbeingaddressed,andoccasionally those who are affected by financial aspects of the program At times, those who live near a treatment facility mayhavereactionstodetailsoftheoperationsuchastrafficorclients’behaviororstillotherpoints

On the one hand, it is impossible for evaluators to know everything about all stakeholders and completely unrealistic to try to make all stakeholders happy But on the other hand, it is essential that evaluators make reasonableeffortstolearnaboutthemajorstakeholdersandanyimportantcurrentissues Acommonelement isthatthestaffprovidingservices,administrativestaff,andboardmembershavedifferentexpectationsforthe evaluation itself If administrators want to improve efficiency, board members want to lower costs, and therapists want more freedom to extend treatment, there are important implications for the progress of an evaluationandwhatevaluatorsshouldexpectregardingcooperationfromthestakeholders.

Recently,evaluationresearchershaveexploredtheprinciplesthatappeartosupportsuccessfulcollaboration withstakeholders,suchasclarifyingthemotivationforcollaboration(Shulha,Whitmore,Cousins,Gilbert,& al Hudib, 2016) as well as what can be learned about the involvement of stakeholders in evaluation more generally, such as noting that studies have found substantial evidence both for benefits and for liabilities (Brandon&Fukunaga,2014)

SideEffects

Effortstosolveproblemsusuallycreatesomeundesirablesideeffects(Sieber,1981).Forexample,medications

thatrelieveonehealthproblemmaycreateproblemsinothersystemsofthebody;sometimesthesesideeffects areminor,sometimestheyrequiremedicalattentionorachangeinmedication,andsometimes,thoughrarely, they are fatal. Patients and physicians must therefore weigh the dangers of side effects, neither minimizing theirimportancenoravoidinghelpfultreatments.Evenwhenthebenefitsappearclearlytooutweighthecosts to medical professionals, others may perceive these effects differently An important current challenge is that some parents come to different conclusions about the comparative value of vaccinations than physicians (Harmsen, Mollema, Ruiter, Paulussen, de Melker, & Kok, 2013). A parallel situation occurs in the area of educational and social service programs Welfare policies can help people during crises to reestablish their productive roles in society; on the other hand, welfare policies can create long-term dependency (McKnight, 1995).Programstoprovidesocialsupporttoisolatedpeoplecanhavenegativeeffectsthathavetypicallybeen ignored(Lincoln,2000) Specialeducationclassespermitchildrenwithuniqueneedstolearnatacomfortable pace, yet being in such a class carries a stigma Consequently, program planners seek to develop services that providebenefitsbutminimizenegativesideeffects.Ontheotherhand,unforeseensideeffectsareoccasionally positive:Whenpeoplelearnnewskills,self-esteemoftenincreases(Dawes,1994;Felson,1984)

ImprovementFocus

Most of these seven areas cover elements of programs that good evaluators consider, measure, and even analyzewithformalstatisticalprocedures Theareaofimprovementfocus,incontrast,describesanattitudeor approach that evaluators take throughout the course of an evaluation This pervasive aspect involves considering not just how good the program is now, but how it can become better in the future. The improvement focus is especially important when the evaluation occurs early in the life of a program and is intended to catch and fix any problems Such evaluations are often called formative evaluations in contrast to summative evaluations that may come at or even after the conclusion of the program. Formative evaluations explicitly look for ways to improve the program, whether by correcting actual mistakes or unanticipated problemsorbybuildingonparticularlysuccessfulcomponents Evenwithsummativeevaluations,however,an improvementfocuswillmakeanimportantcontributionwhethertheprogramisdirectlyreplicatedoradapted tofitnewsettings,circumstances,ormethods.

To be clear, this improvement focus does not mean that evaluators are never critical of problems or shortcomings, let alone of failures in a program Remember that the primary purpose of an evaluation is to determinethevalueorworthofaprogram,soifaparticularinterventioniswastingtimeormoney,or,worse, actively harming clients, evaluators have an obligation to report on these problems clearly But even with substantial limitations, most programs have value that can be identified and used as a basis for better work in thefuture.Althoughitispossiblethatanevaluationmayfindthereisnothingredeemableinagivenprogram, suchconclusionsarerareespeciallywhenevaluatorstaketheimprovementfocusseriously

Outcomes

It should be fairly obvious that an evaluation of a program would consider the results such as how clients improveorotherdetailsabouthowthoseinvolvedintheprogramhavechangedbecauseoftheirparticipation If the proof of the pudding is in the eating, the proof of the program is commonly seen in those who have gone through the program. Those who attend educational programs are expected to know more. Clients in treatmentforproblemsshouldshowfewer(orno)problems;theymightalsoshowhigherlevelsoffunctioning increased strengths, not just fewer weaknesses Broader programs such as in public health might be expected to lead to changes at the community level lower incidence of particular diseases or other problems among the entire population, not just with identified individual The concept of outcomes is a general one, butthedetailsvaryconsiderablydependingontheparticularprogram

Asnotedabove,formanypeopleexaminingoutcomesisthemostobvious,ifnottheonly,aspecttheylook for in an evaluation Although it is essential that good evaluators think about the other areas, outcomes need substantial attention, too Improvement in clients could be seen in a reduction of problems, in an increase of skills, or in both. Clients’ own perception of skill may be important as may observations by others that their abilities have increased The most appropriate time frame for documenting changes might be at the end of treatment, six months after treatment, or six years later Increasingly, it is not enough for evaluators to show

that those who participated in programs are different following the program there is an emphasis on showing that the program contained the “active ingredients” that caused the change (Gates & Dyson, 2017) Chapters 8 through 11 will address the many ways that evaluations consider evidence, not just that there are goodoutcomes,butthattheprogramsareresponsibleforthosegoodoutcomes Asyouwillsee,attimesthere areatbestgentlehintsthattheprogrammayhaveledtothechangeswhereasunderthebestconditions,there may be very clear reasons to believe that the program caused the good effects. Evaluators examine outcomes andtheevidencethatthoseoutcomesarecausedbytheprogram

When the specifics about outcomes are clear, the task may still not be finished There are a number of ways to compare aspects of the outcomes that are important in some evaluations Although many agencies haveoneprogramwithasinglefocusandthegoalissimplytohavegoodresultsfromit,othershavemultiple programswithmoresophisticatedcriteriaandwhereprogramsarecomparedwithoneanotherintermsofthe value of the benefit overall or in terms of the cost for a given benefit A program with moderately good outcomes may not have good enough results to justify its continuation if resources are threatened. The larger area of outcomes can thus be subdivided into various kinds of comparisons by cost, by value to the stakeholders, or by other constraints such as how long it takes to achieve a given result All these ways of examining outcomes are potential areas for evaluators to consider, and will be addressed in a variety of ways laterinthistext

Nuances(Mechanisms)

Although evaluations have often aimed simply to document that participants have benefitted sufficiently, another growing trend is to examine more sophisticated questions such as specific reasons why the good outcomes have occurred both in terms of what mechanisms were involved as well as considering how those in different groups or conditions experience better or worse results (Solmeyer & Constance, 2015). Were all the services provided (and funded) essential ingredients in the good results or were some of the activities pleasant for the clients but otherwise irrelevant ways to use staff time, effort, and the funders’ money? Elements of therapy that continue out of habit or tradition rather than because they have been shown to lead to improvements are good candidates to be reconsidered and, potentially, eliminated. Another important point is that some of those receiving services may not benefit like the rest of the group either because of their existing characteristics or because they react to the treatment differently A treatment that works well with older adolescents but is not effective with the youngest clients might appear to yield good outcomes overall, but understanding the different effects could lead to using a different, but better, treatment for the younger children

One important aspect of examining mechanisms in an evaluation is that measures of the suspected mechanisms must be included If therapists or evaluators believe that cognitive restructuring is an essential part of useful therapy, the evaluators will need to assess how much each client successfully restructured thoughts. With such measures, the evaluators can analyze the degree to which clients with greater restructuring tended to improve more If the effect is consistent and large enough, that would provide evidence to support the use of that component In addition to specific techniques, a somewhat broader construct such as a measure of the degree to which the planned intervention is followed can also address the question of mechanisms (Abry, Hulleman, & Rimm-Kaufman, 2015) More detailed discussions of these specificswillappearinthesectionsondataanalysis,especiallyChapter11onexperimentalapproaches

MISSION

Many evaluators new to the profession find it challenging to remember these aspects of good evaluations To helpstudentsandothers,“MISSION”isanacronymforthesesevenareas MeetingNeeds,Implementation, Stakeholders, Side Effects, Improvement, Outcomes, and Nuances. These seven elements provide an allpurpose set of categories for evaluators to consider regardless of the evaluation As noted above, it is possible that in a particular case, the evaluator might choose to minimize or even ignore the issue of needs if all stakeholders were already so thoroughly convinced of their reality. But not addressing one of these areas should be a deliberate choice And more than one evaluator has forgotten to pay attention to side effects only to regret the oversight later To help students remember these elements, the MISSION acronym will be a

theme throughout this text, explicitly used in the case studies to illustrate both the various forms these componentscantakeaswellasthetimeswhengoodevaluationsmaypaylittleorevennoattentiontosomeof them.

COMMONTYPESOFPROGRAMEVALUATIONS

The primary goals of program evaluation, just discussed, can be met using a number of different types of programevaluations;themajoronesinvolvestudiesofneed,process,outcome,andefficiency

AssessNeedsoftheProgramParticipants

An evaluation of need seeks to identify and measure the level of unmet needs within an organization or community. Assessing unmet needs is a basic first step before any effective program planning can begin. Program planning involves the consideration of a variety of alternative approaches to meet needs. In selecting some alternatives and discarding others, planners engage in a form of program evaluation, one that occurs beforetheprogramisevenbegun.Thecloseassociationbetweenprogramplanningandprogramevaluationis indicatedinthetitleofthejournalProgramPlanningandEvaluation.

As part of the assessment of need, evaluators may examine the socioeconomic profile of the community, the level of social problems within the community, and the agencies and institutions currently serving the community. Through close contact with residents and local leaders, evaluators can learn which aspects of a program are likely to be useful and which might be unacceptable, thus adding depth to the inferences drawn fromstatisticalsummariessuggestingcriticalunmetneeds Sometimesprogramevaluatorsbelievethatthereis apressingneedforasenseofself-determinationorempowerment(Fetterman&Wandersman,2004).

ExaminetheProcessofMeetingtheNeeds

Once a program has been developed and begun, evaluators turn to the task of documenting the extent to which implementation has taken place, the nature of the people being served, and the degree to which the program operates as expected The activities making up the program, such as hours of counseling, number of classes held, and hours police officers patrolled, are called “outputs” Evaluations of process involve checking on the assumptions made while the program was being planned. Do the needs of the people served or the community match what was believed during planning? Is there evidence to support the assessment of needs made during the planning stage? Do the activities carried out by the staff match the plans for the program? What evidence can be found that supports the theoretical assumptions made by the program planners? It is crucial to learn how a program actually operates before offering the same services at additional locations or withotherpopulations

Under normal situations, the information necessary for an evaluation of process is available in the records of an agency sponsoring the program; however, the information may be recorded in a way that is hard to use. For example, information on application forms often is not summarized, and records of actual services received may not permit easy analysis Furthermore, sometimes no records are kept on a day-to-day basis In Chapter 7 on program monitoring and information systems, some very simple methods of developing an information system for a human service setting are illustrated In addition to quantitative information, an evaluation of process may well benefit from unstructured interviews with people using and not using the service.Suchqualitativeinformationoftenprovidespointsofviewthatneitherevaluatorsnorserviceproviders hadconsidered

MeasuretheOutcomesandImpactsofaProgram

If a study of implementation shows that a program has been implemented well and that people seek and secure its services, a measurement of the program ’ s outcomes may become a focus of an evaluation An evaluation of outcome can take on several levels of complexity The most elementary level concerns the conditionofthosewhohavereceivedservices.Areprogramparticipantsdoingwell?Dotheypossesstheskills being taught? A more challenging evaluation would compare the performance of those in the program with

thosenotreceivingitsservices.Anevenmorechallengingevaluationwouldshowthatreceivingtheprogram’s servicescausedachangeforthebetterintheconditionofthoseparticipatingintheprogram(Boruch,1997)

Although program managers hope that their programs will elicit positive changes in people, the causes of behavioral changes are difficult to pin down. For example, many people begin psychotherapy during a life crisis If after several months of counseling they feel better, the change could be due to the counseling, the naturalresolutionofthecrisis,orsomethingelseentirely Inaworksetting,achangeinproceduresmayresult inbettermoralebecauseofincreasedefficiencyorbecausetheworkersfeelthatmanagementcaresabouttheir well-being Or perhaps an improved national economic outlook reduced the workers’ anxiety about possible job loss Discovering the causes of behavioral changes requires sophisticated techniques since an organization must continue to provide services while the evaluation is being conducted. Experienced evaluators are not surprisedbytensionsbetweengatheringinformationandprovidingservices

Besides the limitations on the choice of research design, evaluators seeking to assess the outcome of a program often discover that people hold different opinions about what constitutes a successful outcome. A job-training program paying unemployed people to learn job skills may have been planned so that they can later obtain jobs with private companies City officials may view the training as a reward for people who have worked in local election campaigns, and the trainees may view the program as a good, albeit temporary, job. Anevaluatorwouldnotadoptjustoneoftheseviewsofthedesiredoutcomeoftheprogram

Assessing the maintenance of improvement creates another problem when evaluating outcomes People leaving a drug rehabilitation program typically return to the same community that contributed to their problems in the first place Despite their good intentions, people treated for alcoholism are often unable to withstand the influence of their peers Changing long-standing behaviors is difficult Although positive changes may be observed after a person ’ s participation in a program, the changes may be only superficial and disappearinamatterofmonths,weeks,ordays Ifso,wastheprogramafailure?Whenpositiveoutcomesdo occur, their effects can influence other behaviors and even improve the condition of other people (eg, children);suchlong-termoutcomesarecalled“impacts.”

IntegratetheNeeds,Costs,andOutcomes

Evenwhenevaluatorscanshowthataprogramhas helpedparticipants,theymustalsodealwiththequestion of costs Just as a family must make choices in how a budget is spent, governments and agencies must select from among those services that might be supported. A successful program that requires a large amount of resources simply may not be a good choice if a similar outcome can be achieved with lower cost If an evaluator is asked to compare two or more programs designed to effect similar outcomes, efficiency can be assessed in a fairly straightforward manner; this would be called a cost-effectiveness analysis (Levin & McEwan, 2001) Real difficulties occur when evaluators are asked to compare the efficiency of programs designed to achieve different outcomes, sometimes for different groups of people For example, should a university spend funds to reduce alcohol abuse among students or to increase the number of tutors available? Although competing purposes are seldom contrasted in such a stark fashion, no organization can do everything that might be worthwhile; choices have to be made Evaluations that incorporate high level integration of multiple elements have the potential to provide information to administrators to help them makesuchchoices(King,2017)

Note that there is a logical sequence to these four general types of evaluations Without measuring need, programs cannot be planned properly; without a plan, implementation would be haphazard; without effective implementation, outputs are not provided adequately and good outcomes cannot be expected; and without achievinggoodoutcomes,thereisnoreasontoworryaboutefficiency Aprematurefocusonaninappropriate evaluationquestionislikelytoproduceanevaluationwithlittlevalue(Wholey,2004).

IMPORTANTISSUESINEVALUATIONS

TimeFramesofNeeds

Short-TermNeeds

Manyprogramsaresetuptohelppeopleincrises.Forexample,medicalcareisneededforinjuriesorillnesses, and emotional and financial support are often needed after a crime, a natural disaster, or a home fire Some educational services are designed to meet specific needs of employees required to learn new skills. To be effective,suchservicesshouldbeavailableonshortnotice.

Long-TermNeeds

To meet some needs, services must be available for a long period of time. Children need education for many years Psychotherapy, treatment for chronic illnesses, training for prison inmates, and rehabilitation for alcoholismanddrugabuseareexamplesofprogramsthatfocusonproblemsthatcannotberesolvedinashort timeperiod.

PotentialNeeds

Ideally,potentialproblemscanbeaverted.Preventiveprogramsaresupportedsothatproblemscanbeavoided or at least postponed. The effectiveness of immunization, health education, or business security programs is judgedbythedegreetowhichproblemsdonotoccur Clearly,evaluationsofpreventionprogramsmustdiffer fromevaluationsofprogramsdevelopedtorelievecurrentproblems

ExtensivenessofPrograms

Someprogramsareofferedtosmallgroupsofpeoplewithsimilarneeds,othersaredevelopedforuseatmany sites throughout a county or a state, and yet others are written into federal laws to be offered throughout a nation. Although tools useful in program evaluation apply to evaluations carried out at all levels, there are considerable differences between an evaluation of a day hospital program in Memorial Hospital and an evaluation of psychiatric services supported by Medicaid Although it would be quite reasonable for these evaluations to use some of the same measures of adjustment, the decisions faced by the administrators of the local program differ so greatly from those faced by Medicaid managers that the evaluations must differ in scale,focus,andtypeofrecommendations

The discussions throughout this text focus on evaluations of smaller programs likely to be encountered by evaluators working for school districts, hospitals, personnel departments, social service agencies, city or state governments, and so on Although some national programs are mentioned, most readers of an introductory text are more familiar with local government or educational programs than they are with national programs. Even when a program is supported by federal funds, implementation at a local agency differs markedly from thoseinotherlocalities Thecharacteristicsofprogramsarenotlikemedications,whichcanbegivenineasily specified 20 mg doses Thus, organizations with support from local governments, foundations, and federal agenciesareallexpectedtocarryoutprogramevaluationsandsubmitthemtothefundingsource.

For studies done at a local level, statistical procedures seldom need to be particularly complicated partially because many administrators find statistics to be an incomprehensible if not intimidating topic Complicated analyses require data from larger numbers of people than are usually available to evaluators working with local organizations Evaluators can often show how to improve data summaries and presentationssothatprograminformationcanbeusedtoanswerquestionsfacedbyprogramadministrators

PURPOSEOFPROGRAMEVALUATION

There is only one overall purpose for program evaluation activities: contributing to the provision of quality services to people in need. Program evaluation contributes to quality services by providing feedback from programactivitiesandoutcomestothosewhocanmakechangesinprogramsorwhodecidewhichservicesare to be offered Without feedback, human service programs (indeed, any activity) cannot be carried out effectively. Our bodily processes require feedback systems; similarly, feedback on behavior in organizations is alsocrucialforthesuccessofanorganization.Delayedfeedback,notclearlyassociatedwiththebehaviorbeing examined,isnotveryinformative

Figure 1.1 illustrates the place of program evaluation as a feedback loop for a human service program. Assessingneeds,measuringtheimplementationofprogramstomeetthoseneeds,evaluatingtheachievement ofcarefullyformedgoalsandobjectives,andcomparingthelevelofoutcomewiththecostsinvolvedrelativeto similar programs serve to provide information from which to develop program improvements (Schermerhorn, Hunt, & Hunt, 2008; Wholey, 1991) or to make wise choices among possible programs (Levin & McEwan, 2001)

Feedback can be provided for different purposes. First, as noted earlier, evaluations can strengthen the plansforservicesandtheirdeliveryinordertoimprovetheoutcomesofprogramsortoincreasetheefficiency of programs; these formative evaluations (Scriven, 1967) are designed to help form the programs themselves Alternately, summative evaluations can help us decide whether a program should be started, continued, or chosen from two or more alternatives (Scriven, 1967) There is a finality to summative evaluations; once the valueandworthoftheprogramhavebeenassessed,theprogrammightbediscontinued Inactuality,veryfew single evaluations determine whether or not a program will be continued (Cook, Leviton, & Shadish, 1985). Many sources of information about programs are available to administrators, legislators, and community leaders Because program evaluation is only one of these sources, evaluators are not surprised when clear evaluationfindingsdonotleadtospecificdecisionsbasedontheevaluation.Chelimsky(1997)usestheterms evaluation for development and evaluation for accountability to refer to the formative and summative purposes, respectively

Once a program has been carefully refined using feedback from formative evaluations and found to be effective using a summative evaluation, frequent feedback is still needed to maintain the quality of the program. This third form of evaluation is called “monitoring”; its purpose is quality assurance (Schwartz & Mayne,2005;Wholey,1999) Thiscanbeassimpleascheckingthespeedometerfromtimetotimewhileon a highway and as complicated as examining how international aid is used (Svensson, 1997) Monitoring criticalprocessandoutcomevariablestoverifythataneffectiveprogramstayseffectiveisacrucialactivityafter programshavebeensuccessfullyimplemented.Furthermore,monitoringcanbeexpectedtoidentifyproblems when the community or economic conditions change As efforts are made to resolve those problems, monitoring feedback takes on a formative function as well If problems cannot be resolved, monitoring can cometoserveasummativepurposealso.

Some evaluations are also carried out to learn about programs; Chelimsky (1997) uses the term evaluation for knowledge to describe these This purpose is seldom part of the work of evaluators working on specific programs. Their work might be used by others to deepen our understanding of, for example, rehabilitation programs, but this occurs only after evaluations are completed and shared Evaluators recognize the need to develop better understandings of programs and intervention strategies; however, this text does not focus on such types of evaluation because they involve more ambitious undertakings than most evaluators deal with regularly

THEROLESOFEVALUATORS

Figure11Theplaceofevaluationasafeedbackloopforahumanserviceprogram

Turn static files into dynamic content formats.

Create a flipbook