Skip to main content

Download full Landscape architecture, fifth edition : a manual of environmental planning ebook all c

Page 1


Landscape Architecture, Fifth Edition : A Manual of Environmental Planning

https://ebookmass.com/product/landscapearchitecture-fifth-edition-a-manual-ofenvironmental-planning/

Download more ebook from https://ebookmass.com

More products digital (pdf, epub, mobi) instant download maybe you interests ...

Landscape Architecture, Fifth Edition: A Manual of Environmental Planning and Design 5th Edition, (Ebook PDF)

https://ebookmass.com/product/landscape-architecture-fifthedition-a-manual-of-environmental-planning-and-design-5thedition-ebook-pdf/

Varcarolis’ Manual of Psychiatric Nursing Care Planning: An https://ebookmass.com/product/varcarolis-manual-of-psychiatricnursing-care-planning-an/

Dysphagia Assessment and Treatment Planning: A Team Approach, Fifth Edition Rebecca Leonard

https://ebookmass.com/product/dysphagia-assessment-and-treatmentplanning-a-team-approach-fifth-edition-rebecca-leonard/

Transportation, land use, and environmental planning

Deakin

https://ebookmass.com/product/transportation-land-use-andenvironmental-planning-deakin/

Proposal Planning & amp;Writing, 5th Edition: Fifth Edition – Ebook PDF Version

https://ebookmass.com/product/proposal-planning-ampwriting-5thedition-fifth-edition-ebook-pdf-version/

Construction Operations Manual of Policies and Procedures, Fifth Edition – Ebook PDF Version

https://ebookmass.com/product/construction-operations-manual-ofpolicies-and-procedures-fifth-edition-ebook-pdf-version/

The Professional Practice of Landscape Architecture: A Complete Guide to Starting and Running Your Own Firm 2nd Edition, (Ebook PDF)

https://ebookmass.com/product/the-professional-practice-oflandscape-architecture-a-complete-guide-to-starting-and-runningyour-own-firm-2nd-edition-ebook-pdf/

Essentials of Landscape Ecology 1st Edition Kimberly A.

With

https://ebookmass.com/product/essentials-of-landscapeecology-1st-edition-kimberly-a-with/

Introduction to Managerial Accounting - Solutions Manual Fifth Canadian Edition Peter Brewer

https://ebookmass.com/product/introduction-to-managerialaccounting-solutions-manual-fifth-canadian-edition-peter-brewer/

PeoplePlaces

UrbanGreen,UrbanBlue

TheNewUrbanity

11SITEPLANNING

ProgramDevelopment

SiteSelection

SiteAnalysis

ComprehensiveLandPlanning

TheConceptualPlan

ComputerApplication

SiteDevelopment

Site-StructurePlanDevelopment

Site-StructureUnity

SiteSystems

12SITESPACES

Spaces

TheBasePlane

TheOverheadPlane

TheVerticals

13CIRCULATION

Motion Sequence

PedestrianMovement

TheAutomobile

CompleteStreets

TravelbyRail,Water,andAir

PeopleMovers

14.STRUCTURES

CommonDenominators

Composition

StructuresintheLandscape

TheDefinedOpenSpace

Habitations

Dwelling-NatureRelationships

HumanNeedsandHabitat

ResidentialComponents

15LANDSCAPEPLANTING

Purpose Process Guidelines

Advances

LandscapePlantingsinLow-ImpactDesign

PERSPECTIVE

DisavowalandQuest

Findings

Insights

EvolutionandRevolution

ThePlannedExperience

Retrospective

ProjectCredits

QuotationSources

Bibliography

Index

In1961,over50yearsago,thefirsteditionofLandscapeArchitecturewaspublishedandinstantlyfilledthevoidthatexistedforacomprehensive presentationoftheprofessionandhowtoplanforthehumanuseoflandharmoniouslywiththeenvironment.Theseweretheearlydaysofwhat becameknownastheenvironmentalmovement,sparkedbyaseriesofwake-upcalls,suchasRachelCarson’sbookSilentSpring,sending asignalthroughoutthecountry—and,indeed,theworld—thatpeoplehadtofundamentallychangethewaytheyviewedandinteractedwiththeir surroundings.NolongercouldwecontinuetothinkwehaddominionovertheEarthandignorethefactthatweareaninseparablepartofnature andnatureispartofusNolongercouldwedestroyourforests,abuseoursoil,polluteourairandwater,squanderournaturalresources,and overpopulatetheEarthwithoutdirefutureconsequences

Thefledglingprofessionoflandscapearchitecture,whichhadcomeintobeinglessthanahundredyearsearlier,wasintherightplaceattheright time,sotospeak,withtherightskillsandknowledgetotakeontheleadershiproleamongthedesignprofessionsinthisnewmovement Educatedandtrainedinarchitecture,civilengineering,botany,geology,horticulture,thenaturalsciences,andsocialissues,landscapearchitects wereuniquelyqualifiedtoassumethisroleAtthetime,however,theprofessionwasrelativelyunknownandmisunderstood,anditsliteraturethen wasforthemostpartoutdatedandfocusedonapreviouseraJohnSimondswouldchangethat

JohnhadstudiedlandscapearchitectureatMichiganStateUniversity,traveledtheworld,studiedEasternphilosophy,livedamongthenative peopleofBorneo,workedinconservation,becameastudentoftheenvironment,andembracedtheprinciplesoftheemergingscienceof ecologyIn1939,John—amemberoftheinfamous“classofrebelsâ€thatincludedGarrettEckbo,DanKiley,andCharles Rose—graduatedfromHarvardwithamaster’sdegreeinlandscapearchitecture

Thisplacedhiminauniquepositionthatenabledhimtobecometheprofession’smajoradvocatefortheenvironmentalmovementandtotell thestoryoftheroleoflandscapearchitectureinitJohnwrotethefirsteditionofLandscapeArchitecture“because,â€hesaid,“Ifelt compelledtogetthewordoutaboutthecomprehensiveprofessionoflandscapearchitectureâ€Overthenext30years,tworevisededitions werepublishedwithJohnasthesoleauthorThestoryofmyroleascoauthorbegansometenyearslater

OntheafternoonofDecember12,2004,myphonerang,thecallerIDread“JohnSimonds,â€andadreadfulthoughtflashedthroughmy mindIthadbeenseveralyearssinceJohnandIhadtalked,followingtwoyearsofintensecommunicationpreparingfortheAmericanSocietyof LandscapeArchitect’sCentennialCelebrationJohnwasnotwellatthattimeandIfeareditwashisfamilycallingtosaythathewasgravelyill orhadpassedawayFollowingmyhello,thesoundofJohn’svoiceengenderedasighofrelief,andwhathewasabouttosaywouldshiftmy emotionsfromfeartototalelation

“Barry,wouldyouconsiderworkingwithmeasthecoauthorofthefourtheditionofLandscapeArchitecture?â€Icouldn’tbelievewhatI washearingThenanotherflash—aflashbacktoNovember22,1963Mostpeoplewhowereoldenoughatthetimerememberthisastheday PresidentJohnFKennedywasassassinatedand,toaperson,rememberwheretheywereandwhattheyweredoingatthattimeOnthatdayI wasinthelibraryattheUniversityofCalifornia,Berkeley,completelyabsorbedinJohnSimonds’sfirsteditionofLandscapeArchitectureOf course,theassassinationofJohnFKennedywasaneventthattouchedeveryone,butformepersonallytheimpactthateventwouldhaveonmy lifeandcareerwasclearlysecondarytotheonethatJohnSimonds’sbookwouldhaveonmyfutureandfuturegenerationsoflandscape architects

WhenJohnfirstpublishedLandscapeArchitecturein1961,itwasbeforethedigitalrevolutionandmodernmethodsfacilitatingthepracticeofthe profession,includingcomputer-aideddesignandGeographicInformationSystemsHowever,whatJohnpresentedinthefirstandsubsequent editionsofLandscapeArchitectureisasapplicabletodayasitwaswhenfirstpublishedJohn’sgeniusincommunicatingtheprinciplesof landscapearchitecturalplanninganddesign,throughhiswriting,sketches,andsharedwordsofthewisdomofothers,isindeedtimelessandwill nodoubthelpshapethiscenturyasitdidthelast

Duringthefollowingmonths,weexchangedideasandworkedonthefourtheditionJohn’srolewastocompletetherevisedmanuscript,and minewastoreviewthemanuscriptandgatherphotographs—asJohndescribed,“BestinShowâ€â€”ofworksoflandscapearchitectureand relatedsubjectstoillustratethebookHeconsideredthewritingofLandscapeArchitecturehismostsignificantprofessionalaccomplishment, and,ofcourse,workingwithJohnascoauthorhasbeenoneofthegreathonorsofmycareer

Then,onMay26,IreceivedthephonecallthatIhadfearedthatDecember12calltobeAfterafallandabriefstayinthehospital,Johnreturned home,wherehepassedawaynearfamilyandfriendsWhenJohndied,hehadalreadyfinishedthemanuscriptforthefourthedition,leavinghis wife,Marj,inchargeoffinaleditingWithrenewedvigorandcommitmenttoJohn’slegacy—thelegacyofoneofthemostinfluential landscapearchitectsofthetwentiethcentury—myworkshiftedintohighgear,and,asMarjlikedtosay,“therestishistoryâ€(MarjSimonds diedinApril2012)

ThefourtheditionofLandscapeArchitecturehasbeenpublishedinthreelanguages—English,Chinese,andJapanese—anddistributed worldwide.Forthefirsttime,itisalsoavailableindigitalformat.ThisfiftheditionisthefirsttobepublishedwithoutJohn’sdirectinput. However,muchcarehasbeentakentopreservetheessentialcharacterandtimelessnessofwhathefirstcreatedintheearly1960s,while updatingothermaterialandprovidingrefreshingnewimagesandillustrations.Itismyhopethatfurthereditionsofthisbookwillcontinuetobe publishedintotheindefinitefuture,thusextendingthelegacyofJohnOrmsbeeSimondsandhiscontributionstowardmakingtheworldabetter place.

LandscapeArchitecturehasbeenwritteninresponsetotheneedforabookoutliningtheland-planningprocessinclear,simple,andpractical terms.InalargersenseitisaguidebookonhowtolivemorecompatiblyonplanetEarth.

Itintroducesustoanunderstandingofnatureasthebackgroundandbaseforallhumanactivities;itdescribestheplanningconstraintsimposed bytheforms,forces,andfeaturesofnatureandourbuiltenvironment;itinstillsafeelingforclimateanditsdesignimplications;itdiscussessite selectionandanalysis;itinstructsintheplanningofworkableandwell-relateduseareas;itconsidersthevolumetricshapingofexteriorspaces;it exploresthepossibilitiesofsite-structureorganization;itappliescontemporarythinkingintheplanningofexpressivehumanhabitationsand communities;anditprovidesguidanceinthecreationofmoreefficientandpleasantplacesandwayswithinthecontextofthecityandtheregion

ThisbookisnotintendedtoexplainallformsofthepracticeoftheprofessionortoexplicatethelatesttechnologyNorisitproposedthatthe readerwillbecome,perse,anexpertlandplannerAswithtraininginotherfields,proficiencycomeswithlongyearsofstudy,travel,observation, andprofessionalexperienceThereadershould,however,gainthroughthisbookakeenerandmoretellingawarenessofourphysical surroundingsThereadershouldalsogainmuchusefulknowledgetobeappliedinthedesignofhomes,schools,recreationareas,shopping malls,trafficwaysÂ…Âoranyotherprojecttobefittedinto,andplannedinharmonywith,theall-embracinglandscape

This,atleast,hasbeentheexpressintent

Theworkofthelandscapearchitect (architectofthelandscape) istohelpbringpeople, theirstructures,activities,andcommunities intoharmoniousrelationship withthelivingearth— withthe“want-to-beâ€oftheland

OncetherewasahunterwhospenthisdaystrackingthewideprairiesofNorthDakotawithhisgunanddogandsometimeswithasmallboywho wouldbegtotrotalong.

Onthisparticularmorning,hunterandboy,faroutontheprairie,satwatchingintentlyariseofgroundaheadofthemItwaspockedwithgopher holesFromtimetotimeasmallstripedgopherwouldwhisknervouslyfromthemouthofhisdentothecoverofmattedprairiegrass,soonto reappearwithcheekfoodpouchesbulging

“Smartlittleoutfits,thegophers,â€thehunterobserved“ImeanthewaytheyhavethingsfiguredoutWheneveryoucomeuponagopher village,youcanbesureitwillbenearapatchofgrainwheretheycangettheirfoodandclosebyacreekorsloughforwaterThey’llnotbuild theirtownsnearwillowclumps,forthere’swheretheowlsorhawkswillberoostingAndyou’llnotbefindingthemnearstonyledgesora pileofrockswheretheirenemiesthesnakeswillbehidingreadytosnatchthemWhenthesewiselittlecrittersbuildtheirtowns,theysearchout thesoutheastslopeofaknollthatwillcatchthefullsweepofthesuneachdaytokeeptheirdenswarmandcozyThewinterblizzardsthatpound outofthenorthandwesttoleavethewindwardslopesoftherisesfrozensolidwillonlydriftloosepowdersnowontopoftheirhomes

“Whentheydigtheirdens,â€continuedthehunter,“doyouknowthattheydo?Theyslanttherunwaysteeplydownfor2or3feetandthen doublebackupnearthesurfaceagainwheretheyleveloffanicedryshelfThat’swheretheylie—closeunderthesodroots,outofthewind, warmedbythesun,neartotheirfoodandwater,asfarastheycangetfromtheirenemies,andsurroundedbyalltheirgopherfriendsYes,sir, theysurehaveitallplannedout!â€

“Isourtownbuiltonasoutheastslope?â€thesmallboyaskedthoughtfully

“No,â€saidthehunter,“ourtownslopesdowntothenorth,intheteethofthebitterwinterwindsandcoldasafrostygunbarrelâ€He frowned“EveninsummerthebreezesworkagainstusWhenwebuiltthenewflaxmill,theonlymillfor40miles,wheredoyouthinkweputit? Webuiltitrightsmackontheonlyspotwhereeverybreezeinthesummertimecancatchthesmokefromitsstackandpouritacrossourhouses andintoouropenwindows!?â€

“Atleastourtownisneartheriverandwater,â€saidtheboydefensively

“Yes,â€repliedthehunter“Butwhereneartheriverdidwebuildourhomes?Onthelow,flatlandinsidetheriverbend,that’swhere Andeachspringwhenthesnowsmeltontheprairieandtheriverswells,itfloodsouteverycellarinourtownâ€

“Gopherswouldplanthingsbetterthanthat,â€thesmallboydecided

“Yes,â€saidthehunter,“agopherwouldbesmarterâ€

“Whengophersplantheirhomesandtowns,â€theboyphilosophized,“theyseemtodoitbetterthanpeopledoâ€

“Yes,â€musedthehunter,“andsodomostoftheanimalsIknowSometimesIwonderwhyâ€

NASA

Peopleareanimals,tooWestillretain,andarelargelymotivatedby,ournaturalanimalinstinctsIfwearetoplanintelligently,wemust acknowledgeandaccommodatetheseinstincts;theshortcomingsofmanyaprojectcanbetracedtothefailureoftheplannertorecognizethis simplefact

TheHumanAnimal

Homosapiens(thewiseone)isananimal(asuperiortype,wecommonlyassume,althoughneitherhistorynorcloseobservationaltogether supportthisassumption)

Ahumanstandingintheforest,withbareskin,weakteeth,thinarms,andknobbyknees,wouldnotlookveryimpressiveamongtheother creaturesAsananimal,thebearwithpowerfuljawsandrakingclawswouldclearlyseemsuperiorEventheturtleseemsmorecunningly contrivedforbothprotectionandattack,asdothedog,theskunk,andthelowlyporcupineAllcreaturesofnature,uponreflection,seemsuperbly equippedforlivingtheirlivesintheirnaturalhabitatandformeetingnormalsituationsAllexceptthehumans

Lackingspeed,strength,andotherapparentnaturalattributes,wehumanshavelongsincelearnedthatwecanbestattackasituationwithour mindsTruthtotell,wehavelittleotherchoice

WealoneofalltheanimalshavetheabilitytoweighthefactorsofaproblemandreasonoutasolutionWeareabletolearnnotonlyfromourown experiencesbutalsofromthedisasters,thetriumphs,andthelesserexperiencesofuntoldthousandsofourfellowsWecanborrowfromand applytothesolutionofanyproblemtheaccumulatedwisdomofourspecies

Intelligence,byonedefinition,mustbetheabilitytorespondadaptivelytotheenvironment—thatis,theabilitytoplanacourseofactionbased uponinformationgainedthroughthesenses

JohnToddSimonds

Ouressentialstrength—theveryreasonforoursurvivalandthekeytoallfutureachievement—isouruniquepowerofperceptionanddeduction Perception(makingoneselfawareofallconditionsandapplicablefactors)anddeduction(deriving,throughreason,anappropriatemeansof procedure)aretheveryessenceofplanning

Downthroughthedim,chaoticages,theforceofthehumanmindhasmetandmasteredsituationaftersituationandhasraisedus(throughthis planningprocess)toapositionofsupremacyoveralltheothercreaturesoftheearth

01 02 Starke.tif

Thethoughtprocessesofperception-deductionareinturnimplementedbythephysicalprocessesofaction,reaction,andinteractionThesefive dynamicdrivesformever-repeatingcyclesandspintheintricatewebbingofallhumanlife

Wehave,infact,inheritedtheEarthThisvastglobeonwhichwedwellisours,ourstodevelopfurther,asanagreeablelivingenvironmentSurely, we,withourtwinklingminds,shouldbynowhavecreatedforourselvesaparadiseuponthisearth

Havewe?Whathavewedonewithoursuperlativenaturalheritage?

Wehaveplunderedourforests

Wehaverippedatourhillsandlaidthemopentoerosionandever-deepeninggullies.

Wehavebefouledourriversuntileventhefishandwildlifehaveoftenbeenkilledordrivenoffbythestenchandfumes

Ourtrafficwaysarelinedwithbrashcommercialhodgepodgeandcrisscrossedwithsenselessfrictionpoints

Wehavebuiltourhomestightrowondrearyrow,withlittlethoughtforrefreshingfoliage,cleanair,orsunlight

Lookingaboutuswithacriticaleye,wefindmuchtodisturbandshockusOurclutteredhighways,sprawlingsuburbs,andstrainingcitiesoffend moreoftenthantheyplease

Andwhatisman?Amongstotherthingsheisanorganismendowedwithamultipleorgan,thebrain,supportedbythesensesandtheglands,in whichtheformativepropertyoforganicprocessesisappliedtothememoryrecordsofexperienceThebrainordersitsownrecords,andall mentalprocessesexpressthisbasicactivityArtandscience,philosophyandreligion,engineeringandmedicine,indeedallculturalactivitiesare basedontheorderingofexperienceandtheexploitationoftheresultingdesign

LancelotLawWhyte

WearethevictimsofourownbuildingWearetrapped,bodyandsoul,inthemechanisticsurroundingswehaveconstructedaboutourselves Somewhereinthecomplexprocessofevolvingourlivingspaces,cities,androadways,wehavebecomesoabsorbedinthepowerofmachines, soabsorbedinthepursuitofnewtechniquesofbuilding,soabsorbedwithnewmaterialsthatwehaveneglectedourhumanneedsOurown deepestinstinctsareviolatedOurbasichumandesiresremainunsatisfiedDivorcedfromournaturalhabitat,wehavealmostforgottentheglow andexuberanceofbeinghealthyanimalsandfeelingfullyalive

Manycontemporaryailments—ourhypertensionsandneuroses—arenomorethanthephysicalevidenceofrebellionagainstourphysical surroundingsandfrustrationatthewideninggapbetweentheenvironmentweyearnforandthestifling,artificialoneweplannershavesofar contrived

Lifeitselfisdictatedbyourmoment-by-momentadjustmenttoourenvironmentJustasthebacterialcultureinthepetridishmusthaveits scientificallycompoundedmediumforoptimumdevelopmentandthepottedgeraniumcuttingitsproperandcontrolledconditionsofgrowthto produceathrivingplant,sowe—ascomplicated,hypersensitivehumanorganisms—musthaveforouroptimumdevelopmentahighly specializedmilieuItisbafflingthatthenatureofthisecologicalframeworkhasbeensolittleexploredVolumeshavebeenwrittenonthe conditionsunderwhichraretypesoforchidsmaybestbegrown;numerousmanualscanbefoundontheproperraisingandcareofguineapigs, whiterats,goldfish,andparakeets,butlittlehasbeenwrittenaboutthenatureofthephysicalenvironmentbestsuitedtohumanculture

Thenaturalisttellsusthatifafoxorarabbitissnaredinafieldandthenkeptinacage,theanimal’scleareyeswillsoonbecomedull,itscoat willloseitsluster,anditsspiritwillflagSoitiswithhumanstoolongortoofarremovedfromnatureForweare,firstofall,animals

Everythingwehavetodotolive,naturemakesusdowithlustandpleasure

Seneca

WehavelearnedtounleashtheawesomepowercontainedwithintheatomNowwemustlearnthemeansbywhichtocontrolitUSDOE Humanreasonisrootedtotheearth

KennethClark

Wearecreaturesofthemeadow,theforest,thesea,andtheplainWearebornwithaloveoffreshairinourlungs,drypathsunderourfeet,and thepenetratingheatofthesunonourskinWearebornwithaloveforthefeelandsmellofrich,warmearth,thetasteandsparkleofclearwater, therefreshingcoolnessoffoliageoverhead,andthespaciousbluedomeoftheskyDeepdowninsidewehaveforthesethingsalonging,a desiresometimescompelling,sometimesquiescent—butalwaysitisthere

Ithasbeenproposedbymanysagesthat,otherthingsbeingequal,thehappiestpersonisonewholivesinclosest,fullestharmonywithnatureIt mightthenbereasoned:Whynotrestorehumanstothewoods?Letthemhavetheirwaterandearthandsky,andplentyofitButistheprimeval forest—preserved,untouched,orsimulated—ouridealenvironment?HardlyForthestoryofthehumanraceisthestoryofanunendingstruggle toamelioratetheforcesofnatureGradually,laboriously,wehaveimprovedourshelters,securedamoresustainedandvariedsupplyoffood, andextendedcontrolovertheelementstoimproveourwayofliving …Âandwhenhelooked

Atskyorsea,itwaswith thetestingeyes

Ofthemanwhoknowsthe weatherunderhisskin,

Themanwhosmellstheweather

inthechangedbreeze

Andhastriedhimselfagainstit andlivedbyit

StephenVincentBenét

WearetrappedintheroadsideworkingsofourownmachineryTomLamb,LambStudio

ThesearetheFourthatare nevercontent,thathavenever beenfilledsincetheDews beganÂ…

Jacola’s*mouth,andthe glutoftheKite,and thehandsoftheApe,andtheEyes ofMan

RudyardKipling

*Jacolaisthehyena

Whatalternatives,then,areleft?Isitpossiblethatwecandeviseawhollyartificialenvironmentinwhichtobetterfulfillourpotentialandmore happilyworkoutourdestiny?ThisprospectseemsextremelydoubtfulAperceptiveanalysisofourmostsuccessfulventuresinplanningwould revealthatwehaveeffectedthegreatestimprovementsnotbystrivingtosubjugatenaturewholly,notbyignoringthenaturalconditionorbythe thoughtlessreplacementofthenaturalfeatures,contours,andcoverswithourconstructions,butratherbyconsciouslyseekingaharmonious integrationThiscanbeachievedbymodulatinggroundandstructuralformswiththoseofnature,bybringinghills,ravines,sunlight,water,plants, andairintoourareasofplanningconcentration,andbythoughtfullyandsympatheticallyspacingourstructuresamongthehills,alongtherivers andvalleys,andoutintothelandscape

Ecologicaldesignissimplytheeffectiveadaptationtoandintegrationwithnature’sprocesses SimVanderRynStuartCowan

ThevisualclutterofstriproadsidedevelopmentBarryWStarke,EDA

Thereisthatstupendouswholeofaconstructedenvironment,which,likefate,envelopscivilizedlifeItmustnotbeallowedtoconflictseriously withÂ…Ânaturallaws

TheancientideaofaworldwiselyorderedtofunctionaffordsanemotionalgratificationthathasshowneminentandlongtestedsurvivalvalueItis theinspirationforallplanninganddesigning

RichardJNeutra

WeareperhapsuniqueamongtheanimalsinouryearningfororderandbeautyItisdoubtfulwhetheranyotheranimalenjoysa“view,†contemplatesthemagnificenceofavenerableoak,ordelightsintracingtheundulationsofashorelineWeinstinctivelyseekharmony;weare repelledbydisorder,friction,ugliness,andtheillogicalCanwebecontentwhileourtownsandcitiesarestillorientedtocrowdedstreetsrather thantoopenparks?Whilehighwaysslicethroughourcommunities?Whilefreighttrucksrumblepastourchurchesandourhomes?Canwebe satisfiedwhileourchildrenontheirwaytoschoolmustcrossandrecrossmurderoustrafficways?Whiletrafficitselfmustjaminandoutofthecity, morningandevening,throughcloggedandnoisyvalleyfloors,althoughthesevalleyroutesshould,byallrights,begreen,free-flowingparkways leadingintospacioussettlementsandtheopencountrysidebeyond

Thebasicpremiseofscienceisthatthephysicalworldisgovernedbycertainpredictablerules

Weofcontemporarytimesmustfacethisdisturbingfact:oururban,suburban,andruraldiagramsareforthemostpartill-conceived.Our communityandhighwaypatternsbearlittlelogicalrelationshiptooneanotherandtoourtopographical,climatological,physiological,and ecologicalbase.Wehavegrown,andoftencontinuetogrow,piecemeal,haphazardly,withoutreason.Wearedissatisfiedandpuzzled.Weare frustrated.Somewhereintheplanningprocesswehavefailed.

Geniusofplacesymbolizesthelivingecologicalrelationshipbetweenaparticularlocationandthepersonswhohavederivedfromitandaddedto itthevariousaspectsoftheirhumannessNolandscape,howevergrandioseorfertile,canexpressitsfullpotentialrichnessuntilithasbeengiven itsmythbythelove,works,andartsofhumanbeings

RenéDubos

Soundplanning,wecanlearnfromobservation,isnotachievedproblembyproblemorsitebysiteMasterfulplanningexamineseachprojectin thelightofaninspiredandinspiringvision,solveseachproblemasapartofatotalandcompellingconcept,whichuponconsiderationshouldbe self-evidentStatedsimply,acentralobjectiveofallphysicalplanningistocreateamoresalubriouslivingenvironment—amoresecure, effective,pleasant,rewardingwayoflifeClearly,ifwearetheproductsofenvironmentaswellasofheredity,thenatureofthisenvironmentmust

beavitalconcernIdeallyitwillbeoneinwhichtensionsandfrictionshavebeeninthemaineliminated,wherewecanachieveourfullpotential, andwhere,astheplannersofoldPekingenvisioned,mancanliveandgrowanddevelop“inharmonywithnature,God,andwithhisfellow manâ€*1

Suchanenvironmentcanneverbecreatedwhole;oncecreated,itcouldneverbemaintainedinstaticformByitsverydefinitionitmustbe dynamicandexpanding,changingasourrequirementschangeItwillnever,inallprobability,beachievedButstrivingtowardthecreationofthis idealenvironmentmustbe,inalllandplanninganddesign,atoncethemajorproblem,thescience,andthegoal

Allplanningmust,byreason,meetthemeasureofourhumanityItmustmeetthetestofoursenses:sight,taste,hearing,scent,andtouchItmust alsoconsiderourhabits,responses,andimpulsesYetitisnotenoughtosatisfytheinstinctsofthephysicalanimalaloneOnemustsatisfyalso thebroaderrequirementsofthecompletebeing

Ourplanningprofessionshaveacommongoalintheiraimtodetermine,tocreate,andthenkeepcurrentoptimumrelationshipsbetweenpeople andtheirenvironments…

Likethemodernmedicalpractitioner,weseektobringaboutinhumansapsychosomaticbalance,anall-overhealthinthewholemanThis involvespsychologicalfactorsaswellasphysicalandphysiologicalones…

Thesuccessofaworkofdesignmaybesoundlyevaluatedonlybyitsover-alllong-termeffectonthehealthy,happysurvivalofhumansAnyother evaluationofarchitecture,landscapearchitecture,orcityplanningmakeslittleifanysense

NormanTNewton

Asplanners,wedealnotonlywithareas,spaces,andmaterials,notonlywithinstinctsandfeeling,butalsowithideas,thestuffofthemindOur designsmustappealtotheintellectTheymustfulfillhopesandyearningsByempatheticplanning,onemaybebroughttoone’skneesinan attitudeofprayer,orurgedtomarch,orevenelevatedtoahighplaneofidealismItisnotenoughtoaccommodateGooddesignmustdelight andinspire

Ourfivesensestogethergiveusanorganofacquaintance,withwhichweperceiveandexperiencetheouterworld

HansVetter

Aristotle,inteachingtheartandscienceofpersuasion,heldthattoappealtoanypersonanoratormustfirstunderstandandknowthatpersonHe describedindetailthecharacteristicsofmenandwomenofvariousages,stations,andcircumstancesandproposedthatnotonlyeachperson butalsothecharacteristicsofeachpersonbeconsideredandaddressedAplannermustalsoknowandunderstandPlanninginallageshas beenanattempttoimprovethehumanconditionIthasnotonlymirroredbutactivelyshapedourthinkingandcivilization

Nature

NaturerevealsitselftoeachofusaccordingtoourinterestsTothenaturalist,natureunfoldsawonderlandofspiderweb,eggmass,andfern frondTotheminer,natureisthetenaciousyetprodigioussourceofminerals—coal,copper,tungsten,lead,silverTothehydroelectricengineer, natureisanabundantreservoirofpowerTothestructuralengineer,natureineveryguiseisaneloquentdemonstrationoftheuniversalprinciples offormcreationtobeunderstoodandapplied

SpiralnebulaNASA

Natureismorethanabankofresourcestodrawon:itisthebestmodelwehaveforallthedesignproblemsweface

ofacresofwell-watered,wooded,rollinggroundarebeingblithelyplowedunderandleveledforroads,homesites,shoppingcenters,and factoriesSmallwonderthatsomanyofourcitiesare(climatologicallyspeaking)barrendesertsofasphalt,masonry,glass,andsteel

DustbowlSloan,USDepartmentofAgriculture

Forthemoment,itseems,wehavelosttouchPerhaps,beforewecanprogress,wemustlookbackWemustregaintheoldinstincts,relearnthe oldtruthsWemustreturntothefundamentalwisdomofthegopherbuildingahomeandvillageandthebeaverengineeringadamWemust applytheplanningapproachofthefarmerworkingfromdaytodayinthefields,fullyawareofnature’sforces,forms,andfeatures,respecting andrespondingtothem,adaptingthemtoapurposeWemustdevelopadeeperunderstandingofourphysicalandspiritualtiestotheearthWe mustrediscovernature

TheGreeksandRomanshadneverbotheredaboutthefuturebuthadtriedtoestablishtheirparadiserighthereupontheearth…

ThencametheotherextremeoftheMiddleAgeswhenmanbuilthimselfaparadisebeyondthehighestcloudsandturnedthisworldintoavaleof tearsforhighandlow…

TheRenaissancewasnotapoliticalorareligiousmovementItwasastateofmindIntheRenaissancemennolongerconcentratedalloftheir thoughtsandtheireffortsupontheblessedexistencethatawaitedtheminHeavenTheytriedtoestablishtheirparadiseuponthisplanet,and truthtotell,theysucceededinaremarkabledegree HendrikVanLoon

Tothephysicalplanner,naturerevealsitselfastheeternal,living,formidable,yetbeneficentsettingforeveryprojectandplanItisessentialtothe successofoureffortsthatwecometoknowandunderstandnatureJustasahunterisathomewithnature—drinksofthesprings,usesthe cover,huntsintotheprevailingwinds,knowswhenthegamewillbefeedingonthebeechnutsandacornsoftheridgesandwhenontheberriesin thehollows;justashesensesthecomingofastormandinstinctivelyseeksoutshelter;andjustasasailorisathomeonthesea,readstheshoal, sensesthesandbar,interpretsthesky,andobservesthechangingconformationoftheoceanbottom—justsomustplannersbeconversantwith allfacetsofnature,untilforanymajortractofland,localbuildingsite,orlandscapeareawecaninstinctivelyrecognizethenaturalcharacteristics, limitations,andfullestpossibilitiesOnlybybeingthusawarecanwedevelopasystemofcompatiblerelationships

ThefirstchartoftheGulfStreamwaspreparedabout1769underthedirectionofBenjaminFranklinwhilehewasdeputypostmastergeneralof thecoloniesTheboardofcustomsinBostonhadcomplainedthatthemailpacketscomingfromEnglandtooktwoweekslongertomakethe westwardcrossingthandidtheRhodeIslandmerchantshipsFranklin,perplexed,tooktheproblemtoaNantucketseacaptain,TimothyFolger, whotoldhimthismightverywellbetruebecausetheRhodeIslandcaptainswerewellacquaintedwiththeGulfStreamandavoideditonthe westwardcrossing,whereastheEnglishcaptainswerenotFolgerandotherNantucketwhalerswerepersonallyfamiliarwiththestreambecause, heexplained,“Inourpursuitofwhales,whichkeeptothesidesofitbutarenotmetwithinit,werunalongthesideandfrequentlycrossitto

Another random document with no related content on Scribd:

TABLE XII

RATIONS VARIED FOR SEX AND AGE

VARIATIONS OF SEX AND AGE

The unit of measurement for the calories of energy is the amount of heat required to raise the temperature of one kilogram of water from zero to 1° centigrade or 4° Fahrenheit.

In estimating the number of calories of energy given off by the different foods, Dr. Hall represents

To determine the relative energy which a food represents, it is only necessary to multiply the number of grams of protein in that food by 4, the fat by 9.4, and the carbohydrates by 4, and add the results.

Thus according to the food required for the average man at light work given on page 225:

grams of proteins × 4 = 427.20 calories of energy

for the average man at light work.

TABLE XIII

The following gives a balanced supply for a day according to the preceding tabulation:

Dr. Chittenden’s experiments would indicate that a man leading a very active life, and above the average in body weight, can maintain his body in equilibrium indefinitely with a daily intake of thirty-six to forty grams of protein, or albuminoid food, with a total fuel value of 1600 calories.

In order to bring oneself to as limited a diet as Professor Chittenden’s men followed, however, it would be necessary to have all food weighed so as to be sure of the correct proportions; otherwise the actual needs would not be supplied and the body would suffer.

It is a question whether the men with whom he experimented could have followed so limited a diet for an indefinite period.

As stated, however, authorities differ on the amount of food required.

Dr. Hall suggests 106 grams of protein

Ranke suggests 100 grams of protein

Hultgren and Landergren suggest 134 grams of protein

Schmidt suggests 105 grams of protein

Forster and Moleschott suggest 130 grams of protein

Atwater suggests 125 grams of protein

A wise provision of Nature enables the body to throw off an excess of food above its needs without injury, within limitations; but, as stated, there is no doubt that the average person exceeds these limits, exhausting the digestive organs and loading the system with more than it can eliminate; the capacity for mental work becomes restricted, and the whole system suffers.

Mixed Diet versus a Vegetarian Diet

From the fact that only from two to four ounces of nitrogenous food are required to rebuild daily tissue waste, it is apparent that this amount can readily be supplied from the vegetable kingdom, since nuts, legumes, and cereals are rich in proteins; yet there is a question whether a purely vegetable diet is productive of the highest physical and mental development. Natives of tropical climates live on

vegetables, fruits, and nuts, and it may be purely accidental, or be due to climatic or other conditions, that these nations have not made the greatest progress. Neither have the Eskimos, who live almost entirely on meat, attained the highest development.

The greatest progress and development, both as nations and as individuals, have been made by inhabitants of temperate climates, who have lived on a mixed diet of meat, eggs, milk, grains, vegetables, fruits, and nuts. They have shown more creative force, which means reserve strength.

The Eskimo has demonstrated, however, that a diet of meat alone supplies all physical needs; the meat tissue providing growth and repair and the fat supplying all of the carbonaceous elements. The fat, as previously stated, yields more heat than starches and sugars, and Nature provides this heat for climates in which most warmth is required. This may be the reason why natives of warm climates have formed the habit of using vegetables and grains for their heat and energy rather than meat. It is also the natural reason why man in temperate climates eats more meat in winter than in summer.

An unperverted, natural instinct will always be found to have a sound physiological basis. For example, if, by reason of some digestive disturbance, one has become emaciated, all of the fat having been consumed, and the cause of the disturbance is removed by an operation or otherwise, one is seized with an almost insatiable desire for fat, often eating large chunks of the fat of meat or large quantities of butter or cream at a meal. When obstructions are removed, Nature makes immediate effort to readjust her forces.

Those who object to eating meat should study carefully to learn if the proper proportion of protein is supplied with each day’s rations. The legumes—peas, beans, nuts, and grains—must be supplied. While the wheat kernel contains twelve per cent. of protein, the white flour does not contain as large a percentage and it will be noted by reference to Tables II and III, that the majority of fruits and vegetables contain little nitrogenous substance.

Unless the whole of the grain and the legumes form a goodly proportion of the diet the danger is in consuming too large a bulk of waste and too much starch in a purely vegetable diet.

In a vegetarian diet, one is liable to eat too freely of cereals; as a result, the liver becomes clogged and torpid and the stomach and intestines are deranged and rendered incapable of full digestion and absorption. The clogged system refuses to assimilate more food.

It follows, therefore, that, unless one is a thorough student of dietetics,themixeddietisbyfarthesafesttofollow.

One can better run short of starch or fat in one day’s rations than to be short of protein, because if the two or four ounces daily requirement is not provided the tissues are consumed and the blood is impoverished. It is a rare condition in which a reserve of glycogen and fat is not stored in the system. On the other hand, an excess of nitrogenous foods calls for a very active circulation and plenty of oxygen in the system.

It has been held that the vegetarian has a clearer brain, and, if this be true, it may be due to the fact that he is not eating too much and thus his system is not overloaded.

Experience, however, does not prove that he has greater mental, physical, and moral power and efficiency.

In fasting, likewise, the mental power is at first clear and forceful, but the reason becomes unbalanced if the fast be too prolonged.

A complete diet may be selected without animal flesh, but includinganimalproductsofeggs, milk,cream, andbutter , together with vegetables, fruits, cereals, andnuts, yet, if the vegetable diet beselected,thelegumes,thewholeofthegrains,andnuts,mustbe giventheirshareineachday’srations.

Diet when Traveling

Each year sees an increase in the number of travelers. The question of diet many times is of great importance. For those of abundant means the question is simplified, oftentimes, by the railway dining-car service, but for those who from economic reasons must patronize the wayside railway restaurants or other eating places, the diet question is not so easily solved.

A carefully planned lunch-box is often an aid to the preservation of regular habits and a preventative of digestive disturbances, due to a sudden and radical change of diet.

The inactivity and sedentary habit enforced by a long journey, in which there is small chance for exercise, generally causes constipation. The shaking of the boat or train also aids this, as it interrupts normal peristalsis. The motion of the boat or train often produces nausea and vomiting and thus deranges the digestive organs.

Greasy or illy prepared food hastily eaten at a lunch counter provokes various gastric and intestinal ills.

The danger of infected or polluted water complicates the problem, especially when the sick or infants are involved. Many an attack of typhoid fever has been traced to the drinking water used during a vacation trip.

The invention of the vacuum bottle has solved one need of the traveler. The invention of the electric heater has solved another.

Sterilized and cooled milk may be carried by means of the vacuum bottle for use with children or the sick, and the portable stove will enable the boiling and sterilizing of water, when a larger supply is needed than can be carried in a vacuum bottle. By its means, also, a hot drink can be prepared for the aged, the invalid, or other individual, when necessary, as in an emergency.

All fried and greasy food and unripe fruits should be avoided.

One had better lessen the amount of food than suffer the gastric difficulties occasioned by too much fatty food.

Hard whole wheat crackers with fruit and milk can be had at almost any eating house. These give a well-balanced meal and are often preferable to prepared dishes. Fresh fruit, especially the acid fruits, should form a large part of the diet.

The traveler, on extended journeys, should always provide some of the easily carried condensed foods, so that if the food obtained by the way is unpalatable or illy prepared, or in case food is unobtainable, the needs of the system may be met. Beef meal, whole wheat or oatmeal crackers, malted milk, chocolate, meat extracts, etc., occupy little space and may often prove invaluable.

Tablets of soda and also of lime are easily carried and may be used when soda water or lime water is needed as in nausea or indigestion.

If it is possible, the water drunk while traveling should be boiled.

The bowels must be kept active and fresh fruits and water are the best aids in accomplishing this.

The remedies recommended for car sickness or seasickness are legion; what is an aid in one case is almost or quite without avail in another. Lemon juice or a slice of lemon in the mouth is generally of most avail, though lime water in some cases has proven of service. Attacks can often be mitigated or avoided by not starting on a journey when overtired, by light eating for several days previous to beginning a journey, with care in securing good elimination and plenty of fresh air.

If traveling by boat a reclining chair on deck is far preferable to lying in a berth in a stuffy stateroom.

Nausea can often be prevented or remedied by deep breathing or by the sipping of hot water with a little soda.

FOOTNOTES:

[10] For table of weights see pages 357-359.

CHAPTER IX

DIETS

BEFOREgivinganydiets,letmefirstofallimpresstheimportance of eating slowly, of good cheer, of light conversation during a meal, and of thoroughly masticating the food. Remember it is the foodassimilatedwhichnourishes.

The following diets allow sufficient food for average conditions, when the vital organs are normal.

Fruit, as previously stated, contains a very small quantity of nutrition. It is more valuable for its diuretic effect, and to stimulate the appetite; for this reason it may well be eaten before a meal.

The citrus fruits tend to neutralize too high acidity of the blood, increasing its alkalinity. For this reason, also, they are best before a meal, particularly before breakfast; they have a more laxative and cleansing effect if eaten before the other food. The custom has been, however, to eat fruits after dinner for dessert and they are so given in the following menus.

Table XI (page 207) gives the total amount of protein, carbohydrate, and fat needed daily for the work of the body. The method of determining the number of calories produced by each variety of food is also given on page 208.

By a little study of the food one ordinarily eats in connection with this tabulation and the tables given on pages 233 to 241, it can be determined whether the food taken each day is well or illy balanced and whether one is eating too much or not enough.

Table XIII (page 209) gives the balanced supply for a day of the most commonly used foods and may be consulted as a basis from which to work in constructing balanced meals.

Because of the wide variation in methods of preparing food in the home, an exact and absolute standard cannot be fixed.

All foods contain combinations of mineral salts, particularly calcium (lime), sodium, magnesium, and potassium. In each food, however, some mineral predominates. For instance, potatoes contain both calcium and potassium but the potassium content is larger than the calcium. For this reason when potassium salts are needed in a diet, potatoes and other potassium-containing foods make a valuable contribution. When potassium needs to be limited these foods should be omitted from the diet. When calcium is needed, as in growing children, calcium-containing foods should be made a large part of the diet.

In conditions of health the construction of a balanced diet is a comparatively simple matter. In conditions of disease, however, the question of diet is often one that can only be solved by a skilled dietitian, after a chemical analysis. Unfortunately, the number of these in the United States is not large and their services are not available in many cases in which they are needed.

A diet in which the acid-forming elements are in excess will ultimately result in a lessening of the alkalinity of the blood. The blood then, to maintain its balance, withdraws alkaline substances from the tissues. A balance must, therefore, be maintained between the acid and alkaline foods. This has a bearing on scurvy and also in gout.

Foods which are called acid, that is, they tend to lessen the normal alkalinity of the blood, are, oats, barley, beef, wheat, eggs, rice, and maize. When the proportion of acid in the blood is too great the supply of these foods should be lessened.

Alkaline foods, or those which leave no acid residue, are carrots, turnips, potatoes, onions, milk, blood, peas, lemon and orange juice, and beans. These may be used when there is too much acid in the system.

Neutral foods are sugar, the vegetable oils, and animal fats.

All the content of the foods must be taken into consideration in building a diet, the carbohydrate, fat, and protein being considered as well as the mineral. A consideration of the mineral content, however, should not be neglected. One-eighth grain of iron is taken daily in the ordinary mixed diet. The fact that in one quart of milk, according to Hutchinson, there are 1/2 grains of calcium shows how valuable this food is to the growing child for bone and tissue building. It must also be considered when constipation results from a milk diet. Milk and its derivatives are poor in iron, while meat, fish, potatoes, fruits, and bread are poor in calcium. Animal foods are rich in sodium; vegetables and fruits in potassium.

The following shows the foods which contain mineral salts, in larger proportions.

Calcium (lime)

Potassium

Sodium Magnesium

Milk contains 11/2 grams of lime (calcium) in every quart; next in lime content come eggs, then cereals, especially rice, radishes, asparagus, spinach, veal, olives (16%), apples and strawberries. Tea, coffee, rhubarb, and cabbage cause deposits of the oxalate of calcium.

Egg yolk, potatoes, apples, lemons, limes, oranges, olives (60%) and strawberries.

Sulphur Cabbage, asparagus, fibrin of meat, eggs, casein of milk, corn, turnips, cauliflower, and asparagus.

Iron Yolk of egg, beef, spinach, dandelions, apples, lettuce, lentils, strawberries, navy beans, peas, potatoes, wheat, and oatmeal.

Phosphorus Meat and most vegetables.

A knowledge of the carbohydrate content of foods is useful also in making up a diet, especially in diabetes. Friedenwald and Ruhrah give the following in their order:

Less than 5%

String beans, asparagus, spinach, pickles, lettuce, cucumbers, greens, celery, Brussels sprouts, rhubarb, sauerkraut, tomatoes, ripe olives, cauliflower.

From 5 to 10%

Leeks, eggplant, pumpkin, kohlrabi, cabbage, radishes, collards, watermelon, mushrooms, beets, okra, strawberries, turnips, lemons, rutabagas, squash, musk melons, peaches, onions, cranberries.

From 10 to 15%

From 15 to 20%

Blackberries, green onions, oranges, green olives, tomato catsup, currants, raspberries, apricots, parsnips, pears, apples, lima beans.

Nectarines, huckleberries, cherries, green peas, almonds, potatoes, succotash, fresh figs, prunes, grapes, baked beans, green corn.

Over 20% Plums, boiled potatoes, bananas, sweet potatoes.

In the following menus the effort has been to give a correct balance of the various food elements with the approximate calories furnished by each meal. They are suggestive only and may be varied according to the season of the year, the habits of work, or the tastes of the individual, care being taken to preserve the relative proportions.

For instance, if much starch or fat is taken at a meal and little protein, the balance should swing in the other direction for another meal, the amount of protein being increased and that of carbohydrate decreased.

Common sense must rule in the matter, as one individual would be illy fed on a diet which would be entirely adequate for another of more sedentary habit and weaker digestion. All the habits of life such as exercise, breathing, and mental activity must be taken into consideration.

As previously remarked, there must be a variety in the diet which will stimulate the appetite, and, unless the tastes of the various members of a family are capricious, they may be gratified.

If potatoes are not relished rice may be substituted.

Plain bread may be varied by rolls or biscuits.

Well-masticated nuts may supply the protein usually served in meat and are often a welcome change.

The protein balance is important as this substance is the basis for growth and repair of the tissues of the body.

When the protein balance of the family meal is provided by meat, if for any reason one member of the family does not care for meat, the protein may be supplied by eggs, or by the legumes as shown on pages 232-234.

Letme repeatthateveryone shouldwatchhislikes anddislikes in the matter of food and guard against allowing himself to become finicky; he should not cultivate a dislike for a food which may disagreewithhimatacertaintimeorthetasteofwhichhedoesnot like,ifthatfoodiswholesome.

Remember that the likes and dislikes for food are largely matters of cultivation and one misses much enjoyment and much of health which comes from a well-nourished body by habitually sitting down to a table in a pessimistic frame of mind because the food served does not suit the fancy.

It is very difficult for a mother to provide a meal which suits each member of her family and consideration for her as well as for self should teach one to guard against a critical attitude.

The following is an example of a badly balanced menu. It was given a family, including a child, by a mother who “had no time to study foods. She gave her folks what was the easiest to get and filled them up the quickest.” This mother may have wasted hours in gossip with the neighbors, or on “fancy work.”

Breakfast

Rolls with butter

2 cups coffee

Luncheon

Fried sweet potato

Bread and butter

Prunes

Tea

Dinner

Macaroni with cheese

Bread and butter

Boiled potato

Boiled rice with milk

Tea with milk and sugar

The cardinal sin of such a diet is in the lack of protein, the great predominance of starch, and the inadequate supply of fat. An excessive amount of sugar, however, was taken in the tea. This was taken to satisfy the taste, not realizing that the system demanded it for energy.

The child was given one egg and one slice of bread for breakfast. Being a light eater it asked for no more, but her mother wondered why the child was so pale and suffered from constipation.

No water was given with any meal.

Therearethousandsofsuchillynourishedchildreninourschools, lacking in brain power and readily subject to infection, because of badlycombinedorpoorlypreparedfood.

The number of calories in such a diet may suffice to sustain life, but the balance is insufficient, the amount inadequate, the tissues are not repaired, the secretions lack some of their necessary ingredients or are scanty, and the functions of the body are not well performed.

Sedentary Occupation

The following diet is for one who has attained full growth and who exercises no more than to walk a few blocks a day. The diet may seem light, but when one is sitting indoor most of the time, and has little outdoor exercise, less waste protein is oxidized and less starch, fat, and sugar are required for heat and energy. If too

much carbonaceous food is consumed, one will store up too much and become too large. If more protein is consumed than is oxidized and eliminated one is liable to various derangements of the system.

Every person at sedentary employment should exercise each day without fail, being particular to bring a thorough circulation to the vital organs. He should fully inflate his lungs many times a day and see to it that the air in the room is pure.

In nearly all of the following menus coffee and tea have been omitted because, as before stated, they are not foods but stimulants, and the caffein and thein may overstimulate the nerves and the heart. They sometimes retard digestion. Some other warm drink should be substituted when there is digestive disturbance, or when the digestion is weak. They should never at any time be used strong. They are used simply for their pleasing flavor, or for warmth.

The following diet is suggested for one of sedentary habit who is not exercising and does not use up much mental or physical energy.

DIET I

Breakfast

Fruit

Cereal coffee or toast coffee

Dry toast (one slice), or one muffin, or one gem

1 slice of crisp bacon

1 egg

If one has taken brisk exercise, or is to take a brisk walk of two or three miles, a dish of oatmeal or some other cereal, with cream and sugar, may be added.

Luncheon

Fruit

Creamed soup or purée

Meat, cheese or peanut butter sandwich, or two thin slices of bread and butter

Cup of custard, or one piece of cake, or two cookies

If purée of peas or beans is used the sandwich may be omitted and one slice of bread is sufficient. If the soup contains much cream or is made of corn or potato, the cake or cookies may be omitted.

Dinner

Meat, gravy, potatoes or rice

One vegetable (green peas, green beans, cauliflower, greens, corn. Do not use dried baked beans or dried peas with lean meat)

Salad or fruit

Ice cream or pudding, such as bread, rice, tapioca, cornstarch, or chocolate, or an easily digested dessert.

Diet II gives the calories of energy required by a business man or brain worker who uses much mental force.

DIET II

Diet III gives approximately the calories required for one taking moderate exercise.

DIET III

Luncheon

For the Girl or Boy from 13 to 21

There is no time in life when one needs to be so watchful of the diet as during these years. Growth is very rapid and much protein is needed to build tissue, particularly to build the red blood corpuscles. Anemia may be produced by a faulty diet or by one which lacks eggs, meat, fresh vegetables or fruit, particularly in developing girls.

The red meats, the yolk of eggs, spinach and all kinds of greens are important articles of diet at this time, because of the iron which they contain. They should be supplied freely. Butter and milk are valuable and regularexerciseswithdeepbreathingareimperative.

If the appetite wanes, be sure that the girl or boy is getting sufficient brisk exercise in the fresh air.

DIET IV

Breakfast

Fruit

Oatmeal, shredded wheat biscuit or triscuit, or some other well cooked cereal with cream and sugar

One egg, boiled or poached (cooked soft), or chipped beef in cream gravy

Cereal coffee, toast coffee, or hot water with cream and sugar

Buttered toast, gems, or muffins

Luncheon

Cream soup, bean soup, or purée with crackers or dry toast

Bread and butter

Fruit and cake, or rice pudding, or bread, tapioca, cocoanut, or cereal pudding of any kind, or a cup of custard, or a dish of ice cream

Dinner

Meat (preferably red meat)

Potatoes

Vegetables, preferably spinach, or greens of some kind, or beets boiled with the tops

Graham bread

Fruit, graham bread toasted or graham wafers. Cake of some simple variety. Candy (small quantity)

A growing child is usually hungry when it returns from school, and it is well to give a little easily digested food regularly at this time, but not sufficient to destroy the appetite for the evening meal. Irregular eating between meals, however, should be discouraged. An egg lemonade is easily digested and satisfying. If active and exercising freely, craving for sweets should be gratified to a limited extent.

The growing boy or girl takes from six to eight glasses of water a day.

Overeating, however, should be guarded against for many of the dietary habits of adult life are formed in this period, and the foundation of many dietetic difficulties and disturbances of the system are laid.

If one is not hungry at meal time, the chances are that he is not exercising sufficiently in the fresh air.

Thoroughmasticationshouldbeinsistedon.

One should encourage the habit of eating hard crusts or hard crackers to exercise the teeth and to insure the swallowing of sufficient saliva.

The schoolboy or schoolgirl, anxious to be out at play, is especially liable to bolt the food or to eat an insufficient amount. This should be especially guarded against and parents should insist on the proper time being spent at meals.

The dislike for meat or for certain vegetables or articles of food, which develops in this period, should be guarded against. All wholesome food should be made a part of the diet and the child should not be indulged in its likes or dislikes, but should be instructed in overcoming these.

Very few foods disagree at all times with a normal child and if they do the cause usually lies in a disordered digestion which needs to be restored by more careful attention to exercise, deep breathing, and to elimination of the waste of the system.

The Athlete

The young man active in athletics needs practically the same food as given in Diet IV, yet more in quantity. He needs to drink water before his training and at rest periods during the game.

If he is too fat, he should train off the superfluous amount by exercise and by judiciously abstaining from much sugars, starches, and fats.

Diets for reduction, however, must be governed by the condition of the kidneys and the digestive organs.

Deep breathing habits are imperative though he must be careful not to overtax lungs or heart by hard continuous straining, either at breathing or at exercise.

The Laboring Man

The man engaged in muscular work requires plenty of food; he can digest foods which the professional or business man, or the man of sedentary habits, cannot. He will probably be able to drink coffee and tea without any disturbance to nerves or to digestion. In his muscular work he liberates the waste freely and needs fats, starches, and sugars to supply the heat and energy. This is especially true of men who work in the fresh air; the muscular action liberates waste and heat and the full breathing freely oxidizes the waste, putting it in condition to be excreted through lungs, skin, kidneys, and intestines.

He should have more meat, eggs, and nitrogenous foods, and he also needs more carbonaceous foods to supply heat and energy, as given in Diet V. Three hearty meals a day are necessary.

His muscular movements keep the circulation forceful and the vital organs strong so that his diet may be almost as heavy as that of the

football player. Meat or eggs, twice a day, with tea or coffee, and even pie may be eaten with impunity. He needs a good nourishing breakfast of bacon and eggs or meat, also potatoes, or a liberal allowance of bread and butter, corn bread, muffins, etc.

DIET V

Breakfast

4 tablespoonfuls fresh or stewed fruit with sugar

3 tablespoonfuls oatmeal with milk and sugar

1 portion ham four inches square with fat

2

Luncheon

Dinner 1/2 pint oyster stew or vegetable purée

baked potatoes

4 tablespoonfuls macaroni with tomatoes and butter sauce

slices thick bread and butter

2 portions roast beef (fat)

Condition of Age

The following constitutes an average which will supply the daily requirement for the aged, or for one at any age whose organs are not functioning strongly.

DIET VI

Breakfast

Cereal, well cooked, with cream or sugar. Oatmeal is preferable because it is laxative

One egg, boiled, poached, or baked (soft)

One slice of toast

Cereal coffee

Bouillon or soup

Meat small portion

Potato (preferably baked)

One vegetable

Dinner

Cup custard, or bread, rice, or other light pudding with lemon cream sauce

Supper

Soup

Bread and butter

Stewed fruit

Tea

These individuals need little meat. Tea, if used, should not be strong and, for reasons given on page 104, should never be allowed to steep.

If the habit of life is active, if one exercises regularly, and if the constitution is vigorous and the body not too encumbered with fat, a greater variety and amount of food may be allowed, but great regularity should be observed concerning the diet and the hours for meals. Thorough mastication is more than ever a necessity.

If inclined to constipation, or if the kidneys are inactive, grapes or an apple, or some fruit, well chewed, may be eaten just before

retiring.

Careful attention must be given to securing thorough removal of waste by attention to the eliminative organs, not overloading them.

TABLES OF USE IN MAKING UP BALANCED DIETS

The following table from Dudley Roberts is of material help in making up combinations of foodstuffs for balanced diets:

The following tables[11] are exceptionally valuable in compiling diets in various combinations. One can readily determine the number of grams in various servings of different foods. For example: a small serving of beef (round), containing some fat, weighs 36 grams; 40 per cent., 14.4 grams, is protein, and 60 per cent., 21.6 grams, is fat (no carbohydrates). One ordinary thick slice of white, home-made bread weighs 38 grams; 13 per cent., 4.94 grams, is protein; 6 per cent., 2.28 grams, is fat, and 81 per cent., 30.78 grams, is carbohydrate.

The proportion of proteins, carbohydrates, and fats required by the average individual as suggested on page 208 can be readily made up from various combinations of foods. Each individual may ascertain whether he is taking too much food, or too large a proportion of proteins or of carbohydrates or fats.

TABLE OF 100 FOOD UNITS

NAME OF FOOD

[13]Beef, r’nd, boiled (fat)

[13]Beef, r’d, boiled (lean)

COOKED MEATS

(lean)

VEGETABLES

FRUITS (FRESH OR COOKED)

DAIRY PRODUCTS

CAKES, PASTRY, PUDDINGS, AND DESSERTS

SWEETS AND PICKLES

Turn static files into dynamic content formats.

Create a flipbook