Issuu

[Rendez-vous]

L’animation européenne à son plus haut niveau au Cartoon Movie

Le rendez-vous bordelais qui a accueilli, du 3 au 5 mars, 831 participants en provenance de 42 pays a été marqué par la présence d’une importante délégation canadienne mais aussi par la très grande qualité de nombreuses présentations. ■ PATRICE CARRÉ

Ce Cartoon Movie a permis une fois de plus de prendre le pouls de l’animation européenne indépendante. Force est de constater que sa créativité ne se dément pas. Beaucoup de professionnels croisés dans les allées du palais des congrès de Bordeaux se disaient en effet frappés par le très haut niveau des projets présentés, mais aussi très heureux de la qualité des rendez-vous qu’ils avaient pu obtenir, diffuseurs et acheteurs jouant le jeu en se rendant aisément disponibles. Lors de la conférence de presse bilan, Annick Maes, directrice générale de Cartoon a rappelé que cette édition avait été marquée par un nombre record de candidatures, malgré la situation économique difficile de la filière. “Mais la créativité continue de fleurir et les producteurs ont démontré une résilience remarquable. Ces derniers jours nous ont donné un aperçu de ce que sera l’avenir du cinéma d’animation”, a-t-elle commenté. Parmi les tendances thématiques, beaucoup de projets traitaient de guerre, d’exil et de migration avec la volonté de toucher un public le plus large possible. Mais les œuvres destinées au segment ado-adulte ont poursuivi leur progression puisqu’elles représentaient cette année 38% de la sélection, contre 30% en 2025. Certaines de leurs sessions ont attiré beaucoup d’acheteurs preuve de l’intérêt du marché pour ce type d’œuvres en raison de leurs difficultés récurrentes de financement. Autre tendance : beaucoup de films situaient leur action en dehors de l’Europe, avec des récits incluant des personnages ou des décors africains à l’image de Kokum de Hassan Yola, Kigali Night de Samuel Lajus, Le cœur du djembé réalisé par Mathieu Vavril ou encore Aya in the Desert de Julia Horrillo Pla. Au total, 831 participants, venus de 42 pays, dont 44,6% de femmes, avaient fait le déplacement, contre 838 visiteurs l’an dernier. Parmi eux, figuraient 257 acheteurs, dont 20% de nouveaux entrants grâce au renfort de la délégation canadienne, et 448 sociétés étaient présentes, dont 11% participaient pour la première fois. Autre fait saillant : 68% des projets présentés cette année sont des coproductions, avec la présence de plus en plus de pays situés hors Europe. La France reste malgré tout très attractive en raison de ses nombreux guichets, beaucoup de producteurs français étant impliqués en tant que partenaire minoritaire. La venue cette année de la forte délégation canadienne, dans le cadre de l’opération Québec-Canada Land in Europe: A Space for Creation, pourrait encore accentuer cette tendance de collaborations extraeuropéennes, d’autant qu’elle sera également organisée lors du prochain Cartoon Forum

en septembre à Toulouse. “Beaucoup de personnes ont choisi d’immigrer au Canada pour y construire leur vie et fonder leur famille. Je pense que cela a beaucoup à voir avec notre sensibilité aux différents styles cinématographiques, a expliqué, lors de la conférence de presse, Élaine Dumont, directrice générale de la Sodec. Nous avons un besoin farouche d’être indépendants et de garantir notre souveraineté. C’est probablement la raison pour laquelle le Canada a conclu le plus grand nombre de traités avec des pays à travers le monde.”

LA COPRODUCTION ENCOURAGÉE

Les professionnels participant à cette 28e édition ont désigné, par leurs votes, les lauréats des trois catégories. Pour les Cartoon Movie Tributes, Les Films du Préau ont été élus distributeur européen de l’année. Le tribute du réalisateur de l’année a été remis à Reza Memari pour The Last Whale Singer, son deuxième long métrage après Le voyage de Ricky. Enfin Special Touch Studios (France), Creative Touch Studios (France), Paul Thiltges Distributions (Luxembourg), Yzanakio (Canada), Need Productions et Lunanime (Belgique) ont été désignés producteurs européens de l’année pour Allah n’est pas obligé, premier long métrage de Zaven Najjar, adapté du roman du même titre d’Ahmadou Kourouma (éd. Seuil), prix Renaudot en 2000. Présenté en développement à Cartoon Movie en 2018, le film, qui a été dévoilé en première mondiale au festival d’Annecy, est sorti dans les salles françaises le 4 mars. De son côté le fonds Eurimages du Conseil de l’Europe avait choisi de s’associer à neuf marchés de coproduction du monde entier, dont Cartoon Movie faisait à nouveau partie cette année, afin de remettre le prix Eurimages au développement de la coproduction. Doté en espèces d’une somme de 20 000 €, il vise à promouvoir le rôle du fonds dans l’encouragement des coproductions internationales dès les premières étapes d’un projet. Ce prix a été décerné à Acorn’s Adventure de Filip Mašek, produit en République tchèque par Pure Shore en coproduction avec les Allemands de Fabian&Fred. Enfin, l’association Les Femmes s’Animent a choisi de donner un coup de cœur au Cœur du djembé, un projet ivoirien développé au sein de son Talent Lab Parcours des femmes par Ani Eliam et Assa Ouattara. L’association a attribué son label à Night Tram de Michaela Pavlatova, pour “son exploration de la vieillesse et de l’invisibilité, portée par son sens de l’humour singulier”. La prochaine édition de Cartoon Movie aura lieu du 2 au 4 mars 2027. ❖

Les de la

spectateurs sa carrière affichant par écran.

Source : Comscore www.leﬁlmfrancais.com

Cinéma États-Unis

Jumpers de Daniel pour Jumpers d’animation

Source : Comscore www.leﬁlmfrancais.com

fantôme des

Audiences télé

Cinéma France de téléspectateurs. lors de sa Le fantôme la victoire du mardi d’audience tropical de locale, produit Monthieux par Marc Maréchal, la chaîne de la soirée.

Source : Médiamétrie www.leﬁlmfrancais.com

N° 1552 - Semaine 10 - du 4 au 10 mars 2026

Allah n’est pas obligé une production sans frontière

ProduitparSpecialTouchStudiosetréaliséparZavenNajjar,Allahn’estpas obligé,adaptationduromand’AmadouKourouma,sortensallesle4mars.

Grand entretien

Guillaume Bachy & David Obadia (Afcae) : « Les salles A&E restent un maillage vivant du territoire.» p. 4

Intitutionnel

À 13 mois de la prochaine élection présidentielle, Catherine Pégard fait face à de multiples chantiers. p. 16

Exploitation

Cinéma emblématique du Quartier latin, le Saint-André des Arts a enregistré 73 000 entrées en 2025. p. 20

- France -

Plateformes

Déjà populaire auprès du jeune public, les plateformes attirent désormais les 50 ans et plus. p. 28

Allah n’est pas obligé, une production sans frontière

u ProduitparSpecialTouchStudiosetréalisé parZavenNajjar,Allahn’estpasobligésorten sallesle4mars.Cetteadaptationduroman d’AmadouKourouma,portéedepuisprèsde dixansparleproducteurSébastienOnomo,a mobilisédenombreuxcoproducteurs internationauxpouraboutiràuneproduction multi-studios.parJosephLeFer

Adapté du roman éponyme d’Ahmadou Kourouma (Seuil, 2000), récompensé par le Prix Renaudot et le Goncourt des lycéens, Allah n’est pas obligé sort en salles le 4 mars. Produit par Special Touch Studios, le long métrage d’animation est le premier film de Zaven Najjar. Un projet au long cours pour le producteur Sébastien Onomo, qui porte cette adaptation depuis près d’une décennie.

L’origine du film remonte aux années étudiantes du producteur à la Sorbonne-Nouvelle et à sa découverte de l'œuvre d’Ahmadou Kourouma. “Percuté par ce récit, je me suis dit qu'un jour, il faudrait que j’en fasse quelque chose, confie-t-il. Je n’avais alors aucune idée que je deviendrais producteur.”

Allah n’est pas obligé raconte le parcours de Birahima, un orphelin guinéen d’une dizaine d’années contraint de quitter son village pour rejoindre une tante installée au Libéria. Son voyage prend un tournant tragique lorsqu’il rencontre des enfants soldats.

L’idée d’une adaptation sous la forme d’un film d’animation se concrétise lorsqu’il rencontre Zaven Najjar en 2015. “Je lui ai fait lire le roman et son ressenti fut exactement le même que le mien à l’époque,” relate Sébastien Onomo, qui lui propose d’en faire son premier long métrage. Il acquiert alors les droits du livre en 2016. “Nous avons accéléré rapidement derrière avec la mise en production en 2022”, précise Sébastien Onomo après un développement d’un an et demi, ralenti par la pandémie. Le budget de 6,5 M€ a été réuni au terme d’un montage conséquent avec de nombreux coproducteurs étrangers.

Quatrecoproducteursétrangers

Paul Thiltges Distributions (Luxembourg), Yzanakio (Canada) ainsi que Lunanime et Need Production (Belgique) se sont joints au projet. De son côté, Special Touch s’est appuyé sur ses différentes entités, dont Creative Touch dans les Hauts-de-France, afin d’accéder à plusieurs aides régionales. En plus du soutien du fonds Eurimages, le long métrage “a bénéficié d’apports de la Slovaquie, de l’Arabie Saoudite et des Etats-Unis,” selon Sébastien Onomo.

Pendant 18 mois, la fabrication a mobilisé de nombreux studios européens et canadiens. “Avec Laura Chrétien, directrice des productions chez Special Touch, et Nadine Mombo, productrice exécutive sur le film, nous nous sommes efforcés de répartir le travail en s'appuyant sur les forces de chaque pays et de chaque studio au sein des territoires,” expose Sébastien Onomo. En France, le studio TNZPV a pris en charge une partie de la 3D, notamment la modélisation des personnages. À La Réunion, Gao Shan est également intervenu.

p Allahn'estpas obligé,mêlantune esthétique2D/3D, estlepremierlong métragedeZaven Najjar.

La coordination de ces équipes dispersées, parfois sur des fuseaux horaires très éloignés, a constitué l’un des principaux défis de la réalisation du long métrage.

Le pipeline reposait sur le logiciel open source Blender afin de mêler 2D et 3D. Un parti pris technique cohérent avec la signature artistique de Zaven Najjar mais qui, selon Sébastien Onomo, “a toutefois nécessité des ajustements en cours de production.”

Special Touch a terminé le long métrage avant sa présentation en compétition au Festival international du film d'animation d'Annecy, en juin 2025. En France, la distribution est assurée par BAC Films. n

Trois prix au festival Anima

LesAnimaAwardsontcouronnéleslauréatsdela45ème éditiondufestivalinternationaldufilmd’animationde Bruxelles.Avec62séances“soldout”,35000spectateurs et1207accrédités,l’événementabattutoussesrecordsde fréquentation.Lacompétitioninternationaledeslongsmétrages aparticulièrementmisàl’honneurlefilmAllahn’estpasobligé deZavenNajjar,quiremportelePrixdumeilleurlongmétrage. “Allahn’estpasobligéestunehistoirepuissante,racontéeavec sincéritéetsansjugementenverssespersonnages,aestimé lejurypourlacompétitiondeslongsmétrages.Lerythme, l’humouretlaremarquabledirectionvocalecaptiventtoutau longdupéripledeBirahima.Lerécitmetenlumièreuneréalité déchirante,oùlagravitédusujetestcontrebalancéeavec sensibilitéparlasoliditéduscénario.”

LefilmdeZavenNajjaraégalementreçulePrixdupublicetle PrixMouvCinéteens,confirmantsonimpacttantcritiqueque populaire,quelquesjoursavantsasortieensalle.

Accueil Animation Cartoon Movie 2026 sélectio...

Cartoon Movie 2026 sélectionne 50 projets de longs métrages d’animation européens

Il y a 1 jour

Cartoon Movie 2026 sélectionne 50 projets de longs métrages d’animation européens

Cinéma Événements

La 28ᵉ édition de Cartoon Movie à Bordeaux réunira 50 projets de longs métrages d’animation issus de 21 pays, favorisant coproductions et financements internationaux.

Il y a 1 jour

La 28ᵉ édition de Cartoon Movie à Bordeaux réunira 50 projets de longs métrages d’animation issus de 21 pays, favorisant coproductions et financements internationaux.

Cartoon Movie 2026 sélectionne 50 projets de longs métrages d’animation européens

Anca Damian animation européenne Cartoon Movie 2026 coproduction Jim Queen longs metrages Patrick Imbert Québec-Canada Tomm Moore

La 28ᵉ édition de Cartoon Movie à Bordeaux réunira 50 projets de longs métrages d’animation issus de 21 pays, favorisant copr

La 28ᵉ édition de Cartoon Movie se tiendra à Bordeaux du 3 au 5 mars 2026, offrant une plateforme de financement et de visibilité pour 50 projets de longs métrages d’animation sélectionnés parmi 150 candidatures, soit une augmentation de 22 % par rapport à l’édition précédente. Ces projets seront présentés à des coproducteurs, distributeurs, agents de vente, responsables de plateformes de streaming, éditeurs et investisseurs, ainsi qu’à d’autres acteurs de l’industrie cinématographique.

Le Cartoon Movie 2026 aura lieu à Bordeaux du Bordeaux du 3 au 5 mars. © Cartoon

20/01/2026, 19:47 Cartoon Movie 2026 sélectionne 50 projets de longs métrages d’animation européens - Ecran total

La sélection reflète la vitalité de l’animation européenne, avec des projets provenant de 21 pays. La France arrive en tête avec 15 films, suivie de l’Allemagne (6) et de l’Espagne (5). Les pays d’Europe centrale et orientale (République tchèque, Croatie, Estonie, Géorgie, Hongrie, Pologne et Roumanie) totalisent 11 projets, tandis que les pays nordiques (Danemark, Norvège, Suède) sont représentés par 4 projets. La Belgique, l’Italie, l’Irlande

La sélection reflète la vitalité de l’animation européenne, avec des projets provenant de 21 pays. La France arrive en tête avec 15 films, suivie de l’Allemagne (6) et de l’Espagne (5).

Les pays d’Europe centrale et orientale (République tchèque, Croatie, Estonie, Géorgie, Hongrie, Pologne et Roumanie) totalisent 11 projets, tandis que les pays nordiques (Danemark, Norvège, Suède) sont représentés par 4 projets. La Belgique, l’Italie, l’Irlande

La sélection reflète la vitalité de l’animation européenne, avec des projets provenant de 21 pays. La France arrive en tête avec 15 films, suivie de l’Allemagne (6) et de l’Espagne (5).

https://ecran-total.fr/2026/01/19/cartoon-movie-2026-selectionne-50-projets-de-longs-metrages-danimation-europeens/ 1/5 et les Pays-Bas comptent chacun 2 projets, l’Autriche, la Grèce, le Luxembourg et l’Ukraine complètent la sélection avec un projet chacun.

L’égalité femmes-hommes progresse dans l’animation européenne : 37 % des projets comptent au moins une réalisatrice, 52 % sont portés par une productrice principale, et près de la moitié des films mettent en scène un personnage principal féminin. La diversité et l’inclusion sont également présentes dans 38 % des projets.

https://ecran-total.fr/2026/01/19/cartoon-movie-2026-selectionne-50-projets-de-longs-metrages-danimation-europeens/ 1/5

Avec un budget global de 275,2 millions d’euros, le coût moyen par film s’élève à 5,5 millions d’euros. La coproduction reste un levier majeur, 29 projets (58 %) associant des pays membres du programme Europe Créative MEDIA et des pays extérieurs comme le Canada, le Japon, le Nigéria ou le Royaume-Uni. L’animation 2D domine la sélection (54 %), suivie par la 3D (30 %).

France -

La sélection comprend 30 projets en développement (60 %), 12 en phase de concept (24 %) et 7 en production (14 %). Le sneak preview de Jim Queen de Marco Nguyen et Nicolas Athané sera présenté à l’événement. Parmi les réalisateurs confirmés figurent Tomm annick.maes@cartoonmedia.eu

Le Cartoon Movie 2026 aura lieu à Bordeaux du Bordeaux du 3 au 5 mars. © Cartoon

Anca Damian animation européenne

Cartoon Movie 2026 coproduction Jim Queen longs metrages Patrick Imbert Québec-Canada Tomm Moore

Le Cartoon Movie 2026 aura lieu à Bordeaux du Bordeaux du 3 au 5 mars. © Cartoon

et l’inclusion sont également présentes dans 38 % des projets.

En matière de public, 52 % des projets ciblent les familles et les enfants, tandis que 38 % s’adressent aux jeunes adultes et adultes, en progression par rappor t à 2025. Deux films visent le public préscolaire : Betty Balloon et Onno & Ontje – Friends are the Best Gift. Huit projets avaient déjà été présentés à Cartoon ou Cartoon Springboard.

Neuf projets sont adaptés de livres ou romans graphiques, dont Betty Balloon, Blaise,

Cornebidouille, Igi, Monster Mia, Nine Lives Left, Pirate Mo and the Legend of the Red Ruby, Onno & Ontje et Sam and Julia. Les thématiques abordées incluent l’amitié, la famille, l’éducation et la diversité, avec des personnages en situation de handicap dans Akira’s Flying Wheelchair, DREAMERS – The Hunt for Shadowclaw et The Wild and the Tame.

Huit projets bénéficient d’un soutien régional en Nouvelle-Aquitaine, dont Blaise, Inspecteur Croquettes, Jim Queen, Pangea et Smecheria ou les confidences d’un tricheur Le Bien Chasser contre l’Apocalypse et Firebird sont produits localement, tandis que Chintis Lundgren et Draško Ivezić participent à Saima: Scenes From a Midlife Crisis

Parallèlement aux sessions de pitch, Cartoon Movie accueillera les Cartoon Talks, explorant synergies entre animation, jeu vidéo et édition, avec des conférences sur le Green Distribution Guide, le Green Animation Guide et une table ronde XR/VR. L’événement lancera également l’initiative « Québec-Canada Land in Europe : A Space for

https://ecran-total.fr/2026/01/19/cartoon-movie-2026-selectionne-50-projets-de-longs-metrages-danimation-europeens/ 2/5

CINÉMA

Cartoon Movie 2026 a retenu 50 projets de films

Movie de Cartoon Movie a 50 projets de films

Date de publication : 15/12/2025 - 14:37

Le comité de sélection a reçu un nombre record de soumissions soit 150, avant de retenir les 50 projets qui participeront à cette nouvelle édition. Elle se tiendra à Bordeaux du 3 au 5 mars 2026.

Au total 50 projets en provenance de 21 pays participeront à cette édition 2026 de Cartoon Movie, l'événement de coproduction et de pitch dédié aux longs métrages d'animation européens qui se tiendra à Bordeaux du 3 au 5 mars 2026. C’est un peu moins que lors de l’édition précédente qui avait retenu 57 titres.

La France domine une nouvelle fois la sélection avec 15 longs métrages, suivie de l’Allemagne (six projets), de l’Espagne (cinq projets) et de la Pologne et la Tchéquie (trois projets). Et les pays nordiques en présentent quatre.

Plus de la moitié des projets, soit 30, sont au stade du développement, 15 seront présentés au stade du concept et sept sont déjà en production. Un seul fera l’objet d’une sneak preview, Jim Queen. Si les projets ciblant la famille sont majoritaires, soit 21 au total, ils sont talonnés par les 19 visant les ados-adultes, conﬁrmant à la hausse une tendance qui se faisait déjà jour l’an dernier. 38% des projets sélectionnés visent ce public contre 30% en 2025.

Et parmi tous ces titres, cinq sont soutenus par la Région Nouvelle-Aquitaine et accompagnés par ALCA : Blaise (KG Productions), Inspecteur Croquettes (La Station Animation), Jim Queen (Bobbypills), Pangea (Miyu Productions) et enﬁn Smecheria ou les conﬁdences d'un tricheur (Walking the Dog en Belgique, en coproduction avec Hutong Productions et Aparte Film ). Pangea et Inspecteur Croquettes doivent par ailleurs être fabriqués dans des studios d'Angoulême.

Les talents féminins sont bien représentés puisque 37% des projets sont menés par au moins une réalisatrice et plus de la moitié sont portés par au moins une productrice.

La liste complète des projets est disponible ici

RECEVEZ NOS ALERTES EMAIL GRATUITES

Prix de sociétés honorées Alerte nouvelles les premières images LA

Patrice Carré © crédit photo : Cartoon

Nirvana En tournage

le Louxor

BATAILLE DE GAULLE Avance sur longs métrages soutenus

DOSSIER 16

CARTOON MOVIE 2026

La force du storytelling européen

Cette 28e édition se prépare à réunir, du 3 au 5 mars, à Bordeaux environ 800 professionnels, parmi lesquels va figurer une importante délégation québécoise. Ils pourront découvrir les 50 projets sélectionnés cette année, en provenance de 21 pays. Douze d’entre eux sont au stade du concept, 30 en développement, sept en production et un film sera présenté en avant-première. La sélection est à nouveau dominée par la France avec 15 projets majoritaires. ■ PATRICE CARRÉ

Premier fait notable de cette 28e édition : jamais le nombre de soumissions n’a été aussi élevé, puisque le Cartoon a reçu cette année 150 candidatures, ce qui représente une augmentation de 22% par rapport à l’édition précédente. “La sélection a été très difficile, sachant que nous avons vraiment voulu donner la priorité aux nouveaux projets, résume Annick Maes, directrice générale de Cartoon. Cela prouve que le storytelling, en Europe, constitue réellement notre force et que l’animation indépendante reste particulièrement séduisante.” Autre constat, le fait que de plus en plus de projets sont déjà accompagnés de coproducteurs, y compris au stade du concept. Sur les 50 projets, 29 – soit 58% de l’ensemble –sont des coproductions associant des pays membres du volet Media du programme Europe Créative mais aussi bon nombre de territoires extraeuropéens (Canada, Côte d’Ivoire, Japon, Mexique, Nigeria, Afrique du Sud, Suisse et Royaume-Uni). La France domine à nouveau la sélection avec 15 projets (cinq de plus que l’an passé), suivie de l’Allemagne avec six projets et de l’Espagne avec seulement cinq, alors que celle-ci occupait habituellement la deuxième place. Les pays d’Europe centrale et orientale totalisent 11 propositions, parmi lesquelles Night Tram, le nouveau long métrage de la réalisatrice tchèque Michaela Pavlátová, accompagnée une nouvelle fois en France par Sacrebleu Productions, ou encore The Wild and the Tame de Tibor Bánóczki et Sarolta Szabó, qui avaient auparavant réalisé White Plastic Sky. Le nord de l’Europe est quant à lui représenté par quatre soumissions, la Norvège en portant la moitié dont Sander’s Midsummer de Hanne Berkaak, qu’elle développe en parallèle de Pesta, découvert il y a deux ans à Bordeaux. L’Italie, l’Irlande, les Pays-Bas et la Belgique interviennent chacun avec deux titres, les Belges étant représentés par Dreamwalker de Rudi Mertens, produit par Vivi Film (Veerle Appelmans) et coproduit du côté français par Parmi Les Lucioles, ainsi que par Smecheria or the Confidences of a Cheat, documentaire animé d’Antoine Fontaine coproduit entre la Belgique (Walking The Dog), la France (Hutong Productions) et la Roumanie (Aparte Film). Enfin, l’Autriche, la Grèce, le Luxembourg et l’Ukraine complètent la sélection avec un projet chacun. L’Afrique est de la partie au travers de plusieurs films, que ce soit en matière de sujet, comme pour Kigali Night de Samuel Lajus [cf. p. 17] et Kokum de Hassan Yola, coproduit par le Luxembourg (Paul Thiltges Distributions) et la France (Special Touch Studios), ou en matière de production avec Le cœur du Djembé de Mathieu Vavril, produit en France par Cottonwood Media, en coproduction avec Booya Studios en Côte d’Ivoire et Umedia en Belgique. L’ensemble des œuvres sélectionnées représente un budget total de 275,2 M€, le coût moyen par film s’élevant à 5,5 M€. La tendance au décrochage continue donc, mais à la baisse. Ce coût moyen était en effet de 5,6 M€ l’an dernier, contre 7,2 M€ en 2024, année qui avait constitué un pic en la matière. Parmi les cinéastes confirmés présentant de nouveaux projets figurent Tomm Moore avec Kindred Spirits (Cartoon Saloon, Irlande), Anca Damian avec Starseed (Aparte Film, Roumanie) ainsi que Patrick Imbert avec L’odyssée d’Hakim (Folivari et Solab Films, France ;

N° 4222 du 27 février 2026

Présentation de Désert d’Aurel, en

cf. p. 17). Huit des projets sélectionnés cette année au Cartoon Movie ont déjà participé à cet événement ou à d’autres rendez-vous Cartoon à des stades de développement antérieurs. C’est le cas notamment de Dreamwalker et de Pirate Mo and the Legend of the Red Ruby de Florian Westermann (Ulysses Filmproduktion, Allemagne). D’autres, tels que Aya in the Desert de Julia Horrillo (Alhena Production, Espagne) et Silence Sometimes d’Álvaro Robles (Filmakers Monkeys, Espagne et Ánima Estudios, Mexique), sont passés par le Cartoon Springboard, destiné aux jeunes talents sortis des écoles

d’animation européennes. Il est important de souligner que certains projets sélectionnés à Cartoon finissent par accéder aux plus hautes récompenses. L’an dernier, à la suite du triomphe de Flow aux Oscars, une conférence de presse improvisée avait donné la parole au producteur Ron Dyens et à son coproducteur belge Gregory Zalcman (Take Five). C’est, en effet, lors d’un précédent Cartoon que s’était concrétisée leur collaboration avec le studio letton Dream Well, débouchant sur la coproduction du film de Gints Zilbalodis. Les trois studios avaient d’ailleurs reçu le Cartoon Movie Tribute les couronnant producteur européen de l’année. Cette année, deux projets en lice pour recevoir l’Oscar du meilleur long métrage d’animation sont passés auparavant par Bordeaux : Amélie et la métaphysique des tubes de Mailys Vallade et Liane-Cho Han, en 2020, et Arco d’Ugo Bienvenu, en 2021. Verdict le 15 mars au Dolby Theatre de Los Angeles.

GRANDE DÉLÉGATION QUÉBÉCOISE

Au niveau du public visé, 52% des projets s’adressent aux familles et aux enfants, tandis que les œuvres destinées au segment dit ado-adulte poursuivent leur progression. Elles représentent en effet 38% de la sélection, contre 30% en 2025. “C’est une évolution régulière, commente Annick Maes. Je pense qu’une nouvelle génération de cinéastes, mais aussi certains producteurs renommés, voient l’animation comme un mode d’expression de plus en plus intéressant pour raconter leurs histoires tout comme réaliser des documentaires.”

Cette édition sera aussi marquée par une forte présence québécoise. “J’ai rencontré la Sodec à Berlin l’an dernier. Elle souhaitait renforcer la coopération avec l’Europe, notamment en raison de la nouvelle situation politique aux États-Unis, détaille la directrice générale. Je lui ai donné mon accord à condition qu’elle fasse le déplacement avec une importante délégation qui comprendrait des éditeurs, des vendeurs et des diffuseurs susceptibles d’acheter des films.” Une sélection de six titres, trois issus du Québec et trois d’autres provinces canadiennes, à la recherche de coproducteurs européens sera présentée lors d’une session dédiée. L’opération baptisée “Québec-Canada Land in Europe: A Space for Creation” sera également organisée lors du prochain Cartoon Forum, en septembre à Toulouse. Enfin, le Cartoon confirme plus que jamais son ancrage néo-aquitain, le territoire étant représenté par huit projets. Cinq sont soutenus par la Région et accompagnés par l’Alca : Blaise de Dimitri Planchon et Jean-Paul Guigue (KG Productions), Inspecteur Croquettes de Benoît Delépine, Antoine Robert et Frédéric Felder (La Station Animation), Jim Queen de Marco Nguyen et Nicolas Athané, qui sera présenté en avant-première (Bobbypills), Pangea de Simon Rouby (Miyu Productions) et Smecheria ou les confidences d’un tricheur d’Antoine Fontaine (Hutong Productions en tant que coproducteur). Par ailleurs, Le bien chasser contre l’apocalyspe de Boris Belghiti, Maxime Paccalet et Pierre Razetto [cf. p. 17] est produit par Kawanimation, basé à Bordeaux, et Firebird de Matej Podskalsky et Anna Podskalska est coproduit par Novanima Productions, société implantée en Nouvelle-Aquitaine [cf. p. 9] ❖

Vue du Palais des congrès qui accueille le Cartoon Movie.

2025.

SIX PROJETS À SURVEILLER

CORNEBIDOUILLE de Mathias Varin

Les Armateurs* et Folimage*

Concept – 2D – Famille

L’idée de départ vient d’un podcast produit par Paradiso Media avec L’École des Loisirs. Inspiré de la saga créée et écrite par Pierre Bertrand, et illustrée par Magali Bonniol, puis enrichi par des chansons, il avait rencontré un fort succès auprès des enfants. Cette franchise particulièrement populaire va donc devenir un long métrage produit par Les Armateurs*, en coproduction avec Folimage*.

La réalisation a été confiée à Mathias Varin (Les cahiers d’Esther), lequel a travaillé avec Pierre Bertrand sur le scénario, le principe étant de retracer la genèse des albums de Cornebidouille. Les recherches graphiques ont été menées par Zoïa Trofimova puis reprises par Mathias Varin pour les décors, qui restent à finaliser, Benoît Chieux ayant créé les personnages. L’un des principaux défis consiste à respecter le style graphique original des albums tout en le modernisant et en l’adaptant aux contraintes de l’animation, en sachant que le personnage de Cornebidouille a une forme sphérique, complexe à animer. Le film aura une forte dimension musicale car plusieurs chansons seront intégrées. Le Cartoon Movie accueillera la première présentation officielle du projet aux diffuseurs et vendeurs internationaux présents, voire à des coproducteurs.

FLICK ! de Nicolas Pegon

Wizz et Studio Fost

Développement – 2D – Ado-adulte

Cette histoire originale est portée par Nicolas Pegon, qui l’a proposée au studio Wizz (groupe Quad), avec lequel il travaille depuis une quinzaine d’années en tant que graphiste, auteur et réalisateur de publicités et de trailers de jeux vidéo. “Flick ! est inspiré de mes lectures de comics underground américains”, précise le cinéaste qui crée aussi de la BD. L’action se situe dans les Vosges, le film adoptant le ton de la comédie noire, à la façon des frères Coen. Servi par des dialogues particulièrement savoureux, le scénario – qui en est à la V2 – est centré sur un duo totalement inassorti, qui sera incarné vocalement par William Lebghil et Mara Taquin. La BO a été confiée à Laura Brand, jeune musicienne qui compose essentiellement pour du banjo, dans l’esprit du folk américain. Le studio Fost est également entré dans l’aventure. “Au départ, nous nous sommes rencontrés à Annecy pour les aider en tant que prestataires en raison de notre expérience, précise Christelle Marienneau pour Fost. Mais comme nous avons beaucoup aimé le projet, nous nous sommes rapprochés un peu plus.” Le Cartoon sera l’occasion de présenter un trailer donnant une idée précise du projet, de sa couleur globale et de son avancement.

KIGALI NIGHT de Samuel Lajus

Parmi Les Lucioles Films

Développement – 2D – Ado-adulte Le point de départ de Kigali Night réside dans le parcours personnel de Samuel Lajus. Objecteur de conscience au Rwanda dans les années 1990, il y travaille au Centre culturel français, alors investi par l’armée française, mais quitte le pays avant le déclenchement du génocide et sans avoir pris conscience des différents signaux d’alerte qui pourtant se multipliaient. “Samuel est un réalisateur spécialisé dans les films géopolitiques, explique son producteur Jérôme Duc-Maugé (Parmi Les Lucioles Films). Son récit évoque sa responsabilité individuelle mais aussi celle en tant que Français, ce qui lui confère une portée universelle.” Samuel Lajus a d’abord collaboré avec le romancier Grégoire Polet puis a poursuivi le travail d’écriture avec la jeune autrice italo-libanaise Romy Coccia Di Ferro, afin d’aboutir à la version du scénario qui sera envoyée aux partenaires potentiels après le Cartoon. La direction artistique a été confiée à l’auteur de BD et illustrateur Xavier Coste. Le projet a été sélectionné pour la cinquième édition de la Résidence Annecy Festival en 2025. Cela a permis de poser les bases du trailer qui sera montré à Bordeaux. Le film sera coproduit avec Eklektik Productions en Belgique et Melusine Studio au Luxembourg.

L’ODYSSÉE D’HAKIM de Patrick Imbert Folivari et Solab Films

Développement – 2D – Ado-adulte Un peu moins de cinq ans après la belle carrière en salle du Sommet des dieux, Patrick Imbert va présenter à Bordeaux son nouvel opus, L’odyssée d’Hakim. Tout est parti d’une

bande dessinée de Fabien Toulmé, dont Chloé Ceotto-Servel (Solab Films) a immédiatement voulu acheter les droits. Elle a ensuite proposé à Patrick Imbert, très intéressé, d’en faire l’adaptation. “Il était naturel d’aller voir Folivari, parce que Patrick a fait ses films avec Damien (Brunner) et a ses habitudes de fabrication dans leur studio. Nous nous sommes donc associés pour être coproducteurs sur le projet”, raconte Chloé Ceotto-Servel. La partie graphique a nécessité un long développement avant d’aboutir aux images qui seront dévoilées pendant le Cartoon, avec l’idée de mettre en avant la direction choisie. Le scénario est un condensé de la trilogie qui épouse au mieux la trajectoire d’Hakim. La particularité du projet est sa façon d’aborder avec un regard très différent ce parcours de migration, grâce à un personnage central qui se réinvente à chaque étape. Il propose aussi un questionnement profond sur la nature de l’exil, lequel résulte rarement d’une décision choisie.

LE BIEN CHASSER CONTRE L’APOCALYSPE de Boris Belghiti, Pierre Razetto et Maxime Paccalet Kawanimation

Concept – 2D-3D – Ado-adulte Basé à Bordeaux, Kawanimation a commencé par faire des courts métrages avant de passer à l’animation ado-adulte. La genèse du projet présenté cette année au Cartoon Movie réside dans la série Le bien chasser dont deux saisons ont déjà été produites par la société pour France.tv Slash. Elle se caractérise par un ton humoristique et décalé s’inscrivant dans la lignée des Lascar s, avec une dimension de satire sociale. France.tv Slash n’ayant pas souhaité lancer une troisième saison, ses producteurs ont décidé de prolonger cet univers par le long métrage. “Nous avions une frustration car nous considérons qu’il y a une matière encore assez riche grâce à des personnages bien campés, résume Alexis Laffaille pour Kawanimation. Par ailleurs, l’industrie de la série est relativement cadrée, mais cette fois nous avons envie de raconter des choses un peu folles.” Si l’univers graphique a beaucoup évolué entre les saisons 1 et 2, il est à présent solidement défini avec une grammaire établie. En outre, du fait des saisons préexistantes, la majorité des assets existe déjà et le pipeline est bien rodé : un argument qui pèse son poids en faveur de la fabrication du projet dans une économie de long métrage.

LOLLIPOP TATTOO de Lisa Marie Russo Panoranime et Puffin Pictures Concept – 2D – Ado-adulte Lisa Marie Russo a commencé par développer seule Lollipop Tattoo via sa société britannique Fly Film, le pitchant notamment dans le cadre d’Annecy Goes to Cannes en 2022. Le projet peinant à réunir ses financements, en raison, entre autres, de la sortie de la Grande-Bretagne du volet Media du programme Europe Créative, Amel Lacombe, qui le suivait depuis longtemps en tant que distributrice, propose à la réalisatrice de coproduire le film via sa société de production nouvellement créée, Panoranime. Une rencontre avec Claire La Combe et Louis Suter, qui avaient fondé Puffin Pictures, amène ces derniers à rejoindre le projet. Les trois producteurs français demandent à Lisa Marie Russo de retravailler son scénario, intime mais très à-propos, en y introduisant un peu de distance, avec la complicité de la scénariste franco-américaine Lucile Masson, mais aussi de Violette Delvoye, qui est intervenue sur la conception graphique. La présentation au Cartoon a notamment pour but de convaincre le marché du potentiel international du projet, qui évoque les multiples impacts du cancer du sein sur le corps d’une femme mais aussi sur son mental et sa relation aux autres. La suite passera par le lancement d’un pilote d’ici à la fin de l’année. ❖ P. C.

* Participation majoritaire d’Hildegarde, propriétaire du Film français

Lollipop Tattoo de Lisa Marie Russo.

L’odyssée d’Hakim de Patrick Imbert.

Flick! de Nicolas Pegon.

Le bien chasser… de B. Belghiti, P. Razetto et M. Paccalet.

Kigali Night de Samuel Lajus.

Cornebidouille de Mathias Varin.

Cartoon Movie 2026 – L’animation européenne à son plus haut niveau

Date de publication : 06/03/2026 - 12:58

Du 3 au 5 mars, le rendez-vous bordelais a accueilli 831 participants en provenance de 42 pays. Une édition marquée par la présence d’une importante délégation canadienne mais aussi la grande qualité de nombreuses présentations.

Ce Cartoon Movie a permis une fois de plus de prendre le pouls de l’animation européenne indépendante. Lors de la conférence de presse bilan Annick Maes, directrice générale de Cartoon a rappelé que cette édition avait été marquée par un nombre record de candidatures, malgré la situation économique difficile de la filière. "Mais la créativité continue de fleurir et les producteurs ont démontré une résilience remarquable. Ces derniers jours nous ont donné un aperçu de ce que sera l'avenir du cinéma d’animation".

https://www.leﬁlmfrancais.com/cinema/175312/cartoon-movie-2026-n-lnanimation-europeenne-son-plus-haut-niveau

CINÉMA

08/03/2026, 15:21

Cartoon Movie 2026 – L’animation européenne à son plus haut niveau - Le ﬁlm français

Parmi les tendances thématiques, beaucoup de projets traitaient de guerre, d’exil et de migration mais avec la volonté de toucher un public le plus large possible. Par ailleurs beaucoup situaient leur action en dehors de l’Europe, avec des récits incluant des personnages ou des décors africains a l’image de Kokum, Kigali Night, Le cœur du Djembé ou encore Aya in the desert

Au total 831 participants, dont 44,6 % femmes, venus de 42 pays, avaient fait le déplacement, contre 838 l’an dernier. Parmi eux ﬁguraient 257 acheteurs, dont 20% de nouveaux entrants grâce à la délégation canadienne. Et 448 sociétés étaient présentes, dont 11% participaient pour la première fois. Autre tendance forte, 68 % des projets présentés cette année sont des coproductions, avec la présence de plus en plus de pays situés hors Europe. La France reste malgré tout très attractive en raison de ses nombreux guichets, beaucoup de producteurs français étant impliqués en tant que partenaire minoritaire dans de nombreux projets de ﬁlms. La présence de la forte délégation canadienne, dans le cadre de l’opération "Québec-Canada Land in Europe : A Space for Creation", pourrait encore accentuer cette tendance de collaborations extra européennes, d’autant qu’elle sera également organisée lors du prochain Cartoon Forum en septembre à Toulouse.

"Beaucoup de personnes ont choisi d'immigrer au Canada pour y construire leur vie et fonder leur famille. Je pense que cela a beaucoup à voir avec notre sensibilité aux différents styles cinématographiques" a expliqué lors de la conférence de presse Élaine Dumont, directrice générale de la Sodec. "Nous avons un besoin farouche d’être indépendants et de garantir notre souveraineté. C'est probablement la raison pour laquelle le Canada a conclu le plus grand nombre de traités avec des pays à travers le monde".

Les professionnels participant à cette 28e édition ont désigné par leurs votes les lauréats des trois catégories pour les Cartoon Movie Tributes. Les Films du Préau, société fondée en 2000 par Emmanuelle Chevalier et Marie-Agnès Bourillon, ont été élus distributeur européen de l’année. Le tribute du réalisateur de l’année a été remis à Reza Memari pour The Last Whale Singer, son deuxième long métrage après Le Voyage de Ricky. Ce film d’animation fantastique destiné à un public familial suit Vincent, le fils orphelin du dernier "chanteur de baleines", qui doit surmonter ses peurs et trouver sa propre voix afin de contribuer à sauver les océans. Présenté à Cartoon Movie à différentes étapes - du concept en 2018 au développement en 2020 puis à la production en 2025 - ce nouveau film de Reza Memari est une coproduction entre l’Allemagne, la République tchèque et le Canada, déjà vendue dans plus de 30 territoires à travers le monde.

https://www.leﬁlmfrancais.com/cinema/175312/cartoon-movie-2026-n-lnanimation-europeenne-son-plus-haut-niveau

- France -

08/03/2026, 15:21

Cartoon Movie 2026 – L’animation européenne à son plus haut niveau - Le ﬁlm français

Enﬁn Special Touch Studios, Creative Touch Studios (France), Paul Thiltges Distributions (Luxembourg), Yzanakio (Canada), Need Productions et Lunanime (Belgique) ont été désignés producteur européen de l’année pour Allah n'est pas obligé premier long métrage de Zaven Najjar, adapté du roman d’Ahmadou Kourouma, publié le 12 août 2000 aux éditions du Seuil, qui avait reçu le prix Renaudot la même année. Présenté en développement à Cartoon Movie en 2018, le ﬁlm a été dévoilé en première mondiale au Festival d’Annecy et est sorti dans les salles françaises le 4 mars

De son côté le Fonds Eurimages du Conseil de l'Europe avait choisi cette année de s’associer à neuf marchés de coproduction du monde entier, dont Cartoon Movie faisait à nouveau partie cette année, aﬁn de remettre le Prix Eurimages du développement de la coproduction. Doté en espèces d’une somme de 20 000 €, devant couvrir les frais de développement du projet, il vise à promouvoir le rôle du Fonds dans l'encouragement des coproductions internationales dès les premières étapes d'un projet.

Pour cette édition, 13 projets étaient en lice. Le prix a été décerné à Acorn’s Adventure de Filip Mašek, produit en république tchèque par Pure Shore en coproduction avec les allemands de Fabian&Fred.

De son côté l’association Les Femmes s’Animent a choisi de décerner un coup de cœur au projet Le cœur du Djembé de Ani Eliam, un projet ivoirien développé au sein de son Talent Lab Parcours de Femmes. Et elle a attribué son label à Night Tram de Michaela Pavlatova, pour "son exploration de la vieillesse et de l’invisibilité, portée par son sens de l’humour singulier".

Et comme chaque année, ont été établis différents classement, en fonction de l’attention portée aux projets présentés.

TOP DES PROJETS QUI ONT ATTIRÉ LE PLUS DACHETEURS : (Seuls sont pris en compte les projets en développement et en production)

1. Kindred Spirits - Cartoon Saloon (Irlande), Folivari (France) – 118 acheteurs

2. Dreamwalker - Vivi Film (Belgique), Parmi les lucioles ﬁlms (France), Lighthouse Studios (Irlande) – 94 acheteurs

3. Once Upon an Egg – Keplerﬁlm (Pays-Bas), A Private View (Belgique), Hausbot (République Tchèque) – 89 acheteurs

4. Akira's Flying Wheelchair - TeamTO Films (France) – 85 acheteurs

5. Le Coeur du Djembe - Cottonwood Media (France) – 84 acheteurs

6. Flick! – WIZZ (France), Fost (France) – 78 acheteurs

7. L’Odyssée d’Hakim – Folivari (France), Solab Films (France) – 78 acheteurs

8. Pangea - Miyu Productions (France) - 73 acheteurs)

https://www.leﬁlmfrancais.com/cinema/175312/cartoon-movie-2026-n-lnanimation-europeenne-son-plus-haut-niveau 3/4

- France -

08/03/2026, 15:21 Cartoon Movie 2026 – L’animation européenne à son plus haut niveau - Le ﬁlm français

9. Night Tram - Negativ (République Tchèque), Sacrebleu Productions (France), BFilm (Slovaquie), Art Shot (Lituanie) – 72 acheteurs

10. Starseed - Aparte Film (Roumanie), Special Touch Studios (France), Wrong Men (Belgique) Quetzalcoatl (Belgique), Yzanakio (Canada), Known Associates Group (Afrique du Sud) – 72 acheteurs

11. Blaise - KG Productions (France) – 70 acheteurs

12. Cosmo Princess - Sacrebleu Productions (France) – 69 acheteurs

13. Kokum - Paul Thiltges Distributions (Luxembourg), Special Touch Studios (France) – 69 acheteurs

TOP 10 DES PRÉSENCES AUX PROJETS EN CO-PRODUCTION EUROPÉENNE

(L'ordre reﬂète le nombre de participants pour les projets coproduits dans au moins deux pays européens – Seuls sont pris en compte les projets en développement et en production)

1. Kindred Spirits - Cartoon Saloon (Irlande), Folivari (France) – 342 participants

2. Dreamwalker - Vivi Film (Belgique), Parmi les lucioles ﬁlms (France), Lighthouse Studios (Irlande) – 208 participants

3. Le cœur du Djembe - Cottonwood Media (France), Booya Studio (Côte d’Ivoire), Umedia (Belgique) – 208 participants

4. Once Upon an Egg – Keplerﬁlm (Pays-Bas), A Private View (Belgique), Hausbot (République Tchèque) – 201 participants

5. Kokum - Paul Thiltges Distributions (Luxembourg), Special Touch Studios (France) – 195 participants

6. Night Tram - Negativ (République Tchèque), Sacrebleu Productions (France), BFilm (Slovaquie), Art Shot (Lituanie) – 191 participants

7. Saima: Scenes from a Midlife Crisis - Alexandra Film (Estonie), Adriatic Animation (Croatie), Avec ou sans Vous (France) – 181 participants

8. Starseed - Aparte Film (Roumanie), Special Touch Studios (France), Wrong Men (Belgique) Quetzalcoatl (Belgique), Yzanakio (Canada), Known Associates Group (Afrique du Sud) – 165 participants

9. Kigali Night - Parmi les lucioles ﬁlms (France), Eklektik Productions (Belgique), Melusine Productions (Luxembourg) – 152 participants

10. Monster Mia - arx anima animation Studio (Autriche), Peng! Boom! Tschak! Films (Allemagne), arx anima MD (Allemagne), Arxlight Pictures (Espagne) - 152 participants

11. Halloween vs. Day of the Dead - Studio 100 International (Allemagne), 3Doubles Producciones (Espagne) – 139 participants

RECEVEZ NOS ALERTES EMAIL GRATUITES

Patrice Carré

Tags : ANIMATION CARTOON MOVIE NOUVELLE AQUITAINE

https://www.leﬁlmfrancais.com/cinema/175312/cartoon-movie-2026-n-lnanimation-europeenne-son-plus-haut-niveau

Five Standout Feature Pitches From Cartoon Movie 2026

Kévin Giraud

EventsFeature Film

Dark Comedy, Dystopian Sci-Fi, And Stop-Motion Pigeons: Our Favorite Pitches

From Cartoon Movie 2026

By Kévin Giraud

| 03/06/2026 9:27 am |

Cartoon Movie has long been the leading European co-production event for animated features in Europe. During this week’s edition of the two-day gathering, 50 projects from 20 countries were presented by eager producers and directors in front of their peers, as well as investors, distributors, and international sales agents, with more than 250 buyers in attendance.

Moving from one room to another and discovering more than 10 potential features in less than a full day’s work can seem overwhelming to newcomers. But Cartoon Movie also acts as a 48-hour catalyst for the European animation industry and beyond, one of the sparks that helps ignite the animated worlds of tomorrow.

Since its creation in 1999, Cartoon has helped 513 feature films secure financing, with an overall budget of €3.42 billion ($3.7 billion).

From this year’s 50 projects, Cartoon Brew has already profiled a couple with individual features, but we wanted to go beyond the big names and fan favorite studios such as Cartoon Saloon’s upcoming Kindred Spirits and Sacrebleu’s latest space opera Cosmo Princess to highlight five lesser-known yet similarly eye-catching features currently in concept, development, or production. From cynical adult comedy to heartfelt family stories, these projects aim to captivate audiences in the years ahead.

Country: Romania, South Africa, France, Belgium & Canada

Producers: Aparte Film, Known Associates Group, Special Touch Studios, Wrong Men, Quetzalcoatl, Yzanakio

Length: 97 minutes

Technique: 3D computer animation

Status: In production

Starseed

Il y a 3 jours

Animation Événements +2

Cartoon Movie 2026 - L'animation européenne conﬁrme son dynamisme et sa diversité

AccueilActualitésCartoon Movie 2026 - L'anim...

Cartoon Movie 2026 - L'animation européenne conﬁrme son dynamisme et sa diversité

Il y a 3 jours

Cartoon Movie 2026 - L'animation européenne conﬁrme son dynamisme et sa diversité

Animation Événements +2

L’édition 2026 de Cartoon Movie a réuni 831 professionnels issus de 42 pays autour de 50 projets de longs métrages d’animation. L’événement conDrme son rôle de plateforme de coproduction et de Dnancement pour l’animation européenne.

Il y a 3 jours

Cartoon Movie 2026 - L'animation européenne conﬁrme son dynamisme et sa diversité

L’édition 2026 de Cartoon Movie a une nouvelle fois rassemblé l’écosystème européen de l’animation autour d’une sélection de projets de longs métrages en développement. Du 3 au 5 mars, 50 projets issus de 20 pays ont été présenté, conDrmant la diversité géographique et artistique du secteur et la place de l'événement comme lieu de rencontre pour les producteurs, distributeurs, investisseurs et acheteurs internationaux. L'occasion, selon Annick Maes, directrice générale de Cartoon, "de prendre le pouls de l'animation européenne, de la diversité de projets et de styles graphiques"

Sessions de pitch du mercredi 4 mars © Celia Lenoir

Au total, 831 participants représentant 448 sociétés et 42 pays ont pris part à cette édition. Parmi eux Dguraient 257 acheteurs, dont 20 % participaient pour la première fois à l’événement. La répartition des participants reVète également une évolution progressive des équilibres au sein de l’industrie : 44,6 % de femmes, 54,9 % d’hommes et 0,5 % de personnes non binaires.

Un secteur en accord avec son temps

La sélection 2026 a témoigné d’une animation européenne attentive aux réalités contemporaines, avec plusieurs projets abordant des thématiques sociales et politiques. Les questions de migration, de guerre et d’exil sont apparues de manière récurrente dans les récits présentés. Des Dlms comme Ejo, réalisé par Jacek Rokosz pour Animoon en Pologne, Kigali Night de Samuel Lajus produit par Parmi les Lucioles en France, ou encore Tomi & Erika, porté par Péter Palátsik et Matthias Bruhn pour Trickstudio Lutterbeck et Banana Tree Film en Allemagne, illustrent cette tendance à traiter des enjeux internationaux à travers le médium de l’animation.

La programmation a aussi reVété l'importance des dynamiques territoriales au sein de la production européenne. La région Nouvelle-Aquitaine comptait ainsi neuf projets dans la sélection : Blaise produit par KG Productions, Inspecteur Croquettes de La Station Animation, Firebird coproduit par Novanima Productions, Le Bien Chasser contre l’Apocalypse de Kawanimation, Jim Queen de Bobbypills, Night Tram coproduit par Sacrebleu Productions, Pangea de Miyu Productions, Saima: Scenes from a Midlife Crisis, coréalisé et coécrit par Chintis Lundgren et Draško Ivezić, ainsi que Smecheria ou les conOdences d’un tricheur, coproduit par Hutong Productions.

39 % des projets réalisés par des femmes

Cartoon Movie continue par ailleurs de mêler projets portés par des réalisateurs reconnus et œuvres développées par de nouveaux talents. Parmi les cinéastes conDrmés présents cette année Dguraient Tomm Moore avec Kindred Spirits pour Cartoon Saloon en Irlande, Anca Damian avec Starseed produit par Aparte Film en Roumanie, et Patrick Imbert avec L’Odyssée d’Hakim, projet développé par Folivari et Solab Films en France. La nouvelle génération était également

L’Odyssée d’Hakim, projet développé par Folivari et Solab Films en France. La nouvelle génération était également

Anca Damian animation européenne Cartoon Movie coproduction Les Femmes s’Animent longs métrages animation Michaela Pavlatova

Sessions de pitch du mercredi 4 mars © Celia Lenoir

Anca Damian animation européenne Cartoon Movie coproduction Les Femmes s’Animent longs métrages animation Michaela Pavlatova Nouvelle-Aquitaine Patrick Imbert Tomm Moore

Sessions de pitch du mercredi 4 mars © Celia Lenoir

Anca Damian animation européenne Cartoon Movie coproduction Les Femmes s’Animent longs métrages animation Michaela Pavlatova Nouvelle-Aquitaine Patrick Imbert Tomm Moore

Sessions de pitch du mercredi 4 mars © Celia Lenoir

Article rédigé par:

39 % des projets réalisés par des femmes

La sélection 2026 a conDrmé également la progression de la présence féminine dans l’animation européenne. Selon les données communiquées par Cartoon, 39 % des projets sont réalisés ou coréalisés par des femmes et 34 % sont produits par des productrices. Par ailleurs, 62 % des projets mettent en scène au moins un personnage féminin principal. Des Dlms tels que Igi de Natia Nikolashvili produit par 20 Steps Animation en Géorgie ou Onno & Ontje – Friends are the Best Gift réalisé par Eliza Plocieniak-Alvarez pour Blaue Pampelmuse en Allemagne illustrent cette évolution des représentations et des récits.

En parallèle de la sélection ojcielle, l’initiative Québec-Canada Land in Europe a permis de présenter six projets extraeuropéens, contribuant à renforcer les échanges entre les industries d’animation européenne et nord-américaine.

L’association Les Femmes s’Animent a par ailleurs attribué son label 2026 au projet Night Tram de Michaela Pavlatova L’organisation a également accordé une mention spéciale au projet africain Le Cœur du Djembe, développé dans le cadre du Talent Lab Parcours des Femmes, qui met en scène une héroïne confrontée à des enjeux de destin et de courage.

La 29e édition de Cartoon Movie aura lieu du 2 au 4 mars 2027. Le rendez-vous est pris pour l'année prochaine.

Joseph Le Fer

Partager sur

Copier le lien https://etlink.fr/b/1aJx

Fiches liées

Des sociétés (1) :

Des évènements (1) :

M'inscrire Plus tard

CinémaTélévisionOutilsDossiersPlus de contenus

AccueilAnimationCartoon Movie 2026 – Annick...

Il y a 14 heures

Cartoon Movie 2026 – Annick Maes, directrice générale de Cartoon : “De plus en plus de projets arrivent avec un coproducteur déjà engagé”

À l’approche du Cartoon Movie 2026, qui se tiendra à Bordeaux du 3 au 5 mars, Annick Maes, directrice générale de Cartoon, dévoile les grandes tendances de cette 28ᵉ édition

Annick Maes

Quelles tendances se dégagent dans les projets présentés au Cartoon Movie 2026 ?

Cette 28ᵉ édition est placée sous le signe de la créativité. 150 projets nous ont été soumis cette année, dont certains étaient des suites ou même des trilogies. Un nombre extraordinaire au regard d’une période compliquée pour le secteur. Le comité de sélection a choisi de privilégier la nouveauté, ce qui nous a permis de retenir 12 projets en concept et 30 en développement. Nous avons également fait le choix de projeter Jim Queen de Bobbypills en avant-première aWn de garantir un programme diversiWé, représentatif de l’animation en Europe. À ce sujet, nous constatons une augmentation de l’animation adulte, surtout en long métrage. Les distributeurs et agents de vente sont plus ouverts à ces projets que pour les séries. Autre fait notable : une forte présence des pays d’Europe centrale. Sur les 50 projets retenus, 11 viennent de cette région, comme The Wild and the Tame (Hongrie). Parmi les autres pays représentés, la Norvège continue de montrer sa force en coproduction, surtout pour les longs métrages. L’implication des éditeurs de livres reste importante : ils interviennent très tôt dans le processus pour identiWer les projets susceptibles d’être adaptés en BD ou en romans graphiques. Cette année, neuf projets sont d’ailleurs issus de l’adaptation de livres.

Combien de participants attendez-vous ?

Aujourd’hui, nous avons environ 800 participants inscrits, ce qui est légèrement inférieur à l’an passé, mais il nous reste encore une semaine avant le début de l’événement. Le nombre d’acheteurs reste équivalent à celui de l’année dernière, avec près de 23 % de nouveaux acheteurs.

Avec un budget global de 275,2 millions d’euros et un coût moyen par Elm de 5,5 millions d’euros, la coproduction reste-t-elle un levier majeur ?

Le coût moyen est d’ailleurs en légère baisse, d’environ 100 000 euros par rapport à 2025, tout comme le budget total des projets, avec 41 millions d’euros de moins. Cette évolution s’explique en partie par la présence de formats plus courts,

Annick Maes, la directrice générale de Cartoon. © DR.

Ecran Total - 23/02/2026

Sur les 50 projets retenus, 11 viennent de cette région, comme The Wild and the Tame (Hongrie). Parmi les autres pays représentés, la Norvège continue de montrer sa force en coproduction, surtout pour les longs métrages. L’implication des éditeurs de livres reste importante : ils interviennent très tôt dans le processus pour identiWer les projets susceptibles d’être adaptés en BD ou en romans graphiques. Cette année, neuf projets sont d’ailleurs issus de l’adaptation de livres.

2/2

Article rédigé par:

Combien de participants attendez-vous ?

Avec un budget global de 275,2 millions d’euros et un coût moyen par Elm de 5,5 millions d’euros, la coproduction reste-t-elle un levier majeur ?

Dans le contexte économique actuel, la coproduction prend une importance encore plus grande. De plus en plus de projets arrivent au Cartoon Movie avec au moins un coproducteur déjà engagé. Depuis la sélection des projets début décembre, plusieurs Wlms ont même signé de nouveaux partenaires. Par exemple, le projet polonais Ejo, coproduit avec Special Touch, a récemment intégré un coproducteur au Rwanda. Cette dynamique concerne surtout les longs métrages, davantage que les séries. Parmi les œuvres nommées aux Cartoon Tributes cette année, certaines témoignent d’un niveau de coopération impressionnant : Le Secret des mésanges, par exemple, réunit sept coproducteurs issus de six pays différents.

Le Canada sera mis en avant cette année avec “Québec-Canada Land in Europe : A Space for Creation”. Quels sont les objectifs visés par cette initiative ?

Il s’agit d’une demande de la part du Canada, formulée il y a un an durant la Berlinale. Nous devions proWter de cette opportunité, qui peut offrir de vraies possibilités à nos producteurs européens. D’autant plus que, depuis un ou deux ans, j’avais déjà constaté que le Canada apparaissait de plus en plus parmi les coproducteurs, tant au Cartoon Forum qu’au Cartoon Movie. Six projets canadiens seront ainsi présentés : quatre à l’état de concept et deux en développement. Tous sont à la recherche d’un coproducteur européen. J’avais également posé comme condition la présence d’une délégation d’acheteurs, car il est important qu’ils découvrent et s’intéressent aux projets européens. Nous aurons ainsi 13 acheteurs canadiens sur place. Nous pouvons dire que c’est l’année canadienne chez Cartoon, puisque cette collaboration se poursuivra également au Cartoon Forum.

Partager sur

Copier le lien https://etlink.fr/b/1 S1

Fiches liées

Des productions (1) :

Joseph Le Fer

CinémaTélévisionOutilsDossiersPlus de contenus AccueilActualitésNeuf

Animation Événements +2

AccueilActualitésNeuf pays européens représe...

Il y a 21 heures

Neuf pays européens représentés aux Cartoon Movie Tributes 2026

Animation Événements +2

Des producteurs, distributeurs et réalisateurs de neuf pays européens sont nommés aux Cartoon Movie Tributes 2026. Les lauréats seront désignés lors de Cartoon Movie, du 3 au 5 mars à Bordeaux.

Il y a 21 heures

Allah n'est pas obligé Arco

Neuf pays européens représentés aux Cartoon Movie Tributes 2026

Le Secret des Mésanges, une coproduction franco-belge réalisée par Antoine Lanciaux, avait été présentée à Cartoon Movie en 2019.

Les Cartoon Movie Tributes 2026 distingueront des producteurs, distributeurs et réalisateurs issus de neuf pays européens, à l’occasion de Cartoon Movie, rendez-vous professionnel dédié au pitch et à la coproduction de longs métrages d’animation, organisé du 3 au 5 mars à Bordeaux. Les lauréats seront élus par les professionnels accrédités à l’événement.

Le Secret des Mésanges, une coproduction franco-belge réalisée par Antoine Lanciaux, avait été présentée à Cartoon Movie en 2019.

Dans la catégorie Producteur européen de l’année, dix-neuf entreprises sont nommées en tant que coproducteurs de quatre longs métrages présentés à Cartoon Movie à différents stades de développement :

Folimage / Les Armateurs (France) / Lunanime (Belgique) / Auvergne-Rhône-Alpes Cinéma / JPL Films (France) / Dragons Films (Belgique) / Pictanovo / TNZPV Productions (France) pour Le Secret des Mésanges

Gringo Films (Allemagne) / Fabrique d’Images (Luxembourg) / Senator Film Produktion / Traumhaus Studio (Allemagne) pour La Fabrique des monstres (Stitch Head)

MAUR ^lm (République tchèque) / Vivement Lundi ! (France) / Artichoke (Slovaquie) / ZVVIKS (Slovénie) pour Les Contes du pommier (Tales from the magic garden)

Gringo Films (Allemagne) / Fabrique d’Images (Luxembourg) / Senator Film Produktion / Traumhaus Studio (Allemagne) pour La Fabrique des monstres (Stitch Head)

Special Touch Studios / Creative Touch Studios (France) / Paul Thiltges Distributions (Luxembourg) / Yzanakio (Canada) / Need Productions / Lunanime (Belgique) pour Allah n'est pas obligé

Trois sociétés concourent pour le prix de Distributeur européen de l’année :

Special Touch Studios / Creative Touch Studios (France) / Paul Thiltges Distributions (Luxembourg) / Yzanakio (Canada) / Need Productions / Lunanime (Belgique) pour Allah n'est pas obligé

Trois sociétés concourent pour le prix de Distributeur européen de l’année :

MAUR ^lm (République tchèque) / Vivement Lundi ! (France) / Artichoke (Slovaquie) / ZVVIKS (Slovénie) pour Les Contes du pommier (Tales from the magic garden)

Flins y Pinículas (Espagne)

Les Films du Préau (France)

Special Touch Studios / Creative Touch Studios (France) / Paul Thiltges Distributions (Luxembourg) / Yzanakio (Canada) / Need Productions / Lunanime (Belgique) pour Allah n'est pas obligé

Kino Mediteran (Croatie)

Les Films du Préau (France)

Trois sociétés concourent pour le prix de Distributeur européen de l’année :

Kino Mediteran (Croatie)

En^n, la catégorie Réalisateur européen de l’année met en avant des cinéastes dont les projets ont circulé à Cartoon Movie à différentes étapes :

Flins y Pinículas (Espagne)

En^n, la catégorie Réalisateur européen de l’année met en avant des cinéastes dont les projets ont circulé à Cartoon Movie à différentes étapes :

Les Films du Préau (France)

• Irene Iborra Rizo pour Olivia (Olivia and the invisible earthquake)

Kino Mediteran (Croatie)

• Maïlys Vallade & Liane-Cho Han pour Amélie et la métaphysique des tubes

• Irene Iborra Rizo pour Olivia (Olivia and the invisible earthquake)

• Maïlys Vallade & Liane-Cho Han pour Amélie et la métaphysique des tubes

• Reza Memari pour The Last Whale Singer

En^n, la catégorie Réalisateur européen de l’année met en avant des cinéastes dont les projets ont circulé à Cartoon Movie à différentes étapes :

• Reza Memari pour The Last Whale Singer

• Ugo Bienvenu pour Arco

• Irene Iborra Rizo pour Olivia (Olivia and the invisible earthquake)

• Maïlys Vallade & Liane-Cho Han pour Amélie et la métaphysique des tubes

• Reza Memari pour The Last Whale Singer

En 2025, le prix de Distributeur européen de l’année avait été attribué à Kinology (France), celui de Réalisateur européen de l’année à María Trénor (Espagne) et celui de Producteur européen de l’année à Dream Well Studio (Lettonie), Sacrebleu

Allah n'est pas obligé Arco Cartoon Movie Cartoon Movie Tributes 2026 Le Secret des Mésanges Reza Memari Stitch Head Tales from the Magic Garden Ugo Bienvenu

Cartoon Movie

Cartoon Movie Tributes 2026

Le Secret des Mésanges Reza Memari Stitch Head

Tales from the Magic Garden Ugo Bienvenu

Article rédigé par:

MAUR ^lm (République tchèque) / Vivement Lundi ! (France) / Artichoke (Slovaquie) / ZVVIKS (Slovénie) pour Les Contes du pommier (Tales from the magic garden)

Total - 11/02/2026

Special Touch Studios / Creative Touch Studios (France) / Paul Thiltges Distributions (Luxembourg) / Yzanakio (Canada) / Need Productions / Lunanime (Belgique) pour Allah n'est pas obligé

Trois sociétés concourent pour le prix de Distributeur européen de l’année :

Flins y Pinículas (Espagne)

Les Films du Préau (France)

Kino Mediteran (Croatie)

En^n, la catégorie Réalisateur européen de l’année met en avant des cinéastes dont les projets ont circulé à Cartoon Movie à différentes étapes :

• Irene Iborra Rizo pour Olivia (Olivia and the invisible earthquake)

• Maïlys Vallade & Liane-Cho Han pour Amélie et la métaphysique des tubes

• Reza Memari pour The Last Whale Singer

• Ugo Bienvenu pour Arco

Partager sur

Le Fer

Copier le lien https://etlink.fr/b/1 4m

Fiches liées

Des productions (8) :

Des sociétés (13) :

Joseph

annick.maes@cartoonmedia.eu

Il y a 19 heures

CinémaTélévisionOutilsDossiersPlus de contenus

Cartoon Movie a sélectionné les projets de son édition 2026

Les 50 projets de longs métrages d’animation européens seront présentés à Bordeaux durant trois jours au début du mois de mars prochain.

L’événement de coproduction et de “pitch” dédié aux longs métrages d’animation européens organisé par l’association Car toon, Car toon Movie, se tiendra à Bordeaux du 3 au 5 mars 2026. Un nombre record de 150 projets soumis a été enregistré cette année. Le comité de sélection en a retenu 50 provenant de 21 pays.

Les projets sélectionnés pour Car toon Movie 2026 focalisent leurs histoires sur les problématiques du quotidien. À cette fin, 38% des projets mettent en avant la diversité et l’inclusion dans leurs histoires. Les talents féminins bien représentés : 37% des projets sont menés par au moins une réalisatrice et plus de la moitié (52%) ont au moins une productrice. Près de la moitié (48%) des projets sélectionnés ont un personnage principal féminin. Les contenus pour jeunes adultes et adultes sont en hausse et représentent 38% (30% en 2025) des projets sélectionnés. Pour 58% les projets sélectionnés ciblent les enfants et les familles, confirmant l’impor tance de ce segment.

https://ecran-total.fr/2025/12/16/cartoon-movie-a-selectionne-les-projets-de-son-edition-2026/?utm_source=brevo&utm_campaign=ET4852&utm_medium=email 1/4

CINÉMAPLATEFORMESANIMATIONDOCUMENTAIRETECHNIQUEINSTITUTIONNEL

4questionsà… Annick Maes,

directricegénéraledeCartoon.

Quelles tendances se dégagent dans les projets présentés au Cartoon Movie 2026 ?

Cette 28 ème édition est placée sous le signe de la créativité. 150 projets nous ont été soumis cette année, dont certains étaient des suites ou même des trilogies. Le comité de sélection a choisi de privilégier la nouveauté, ce qui nous a permis de retenir 12 projets en concept et 30 en développement. Nous constatons une augmentation de l’animation adulte, surtout en long métrage. Les distributeurs et agents de vente sont plus ouverts à ces projets que pour les séries. Autre fait notable : une forte présence des pays d’Europe centrale. Sur les 50 projets retenus, 11 viennent de cette région. Parmi les autres pays représentés, la Norvège continue de montrer sa force en coproduction, surtout pour les longs métrages. L’implication des

éditeurs de livres reste importante : ils interviennent très tôt dans le processus pour identifier les projets susceptibles d’être adaptés en BD ou en romans graphiques.

Combien de participants attendez-vous ?

Aujourd’hui, nous comptons environ 800 participants inscrits, ce qui est légèrement inférieur à l’an passé, mais il nous reste encore une semaine avant le début de l’événement. Le nombre d’acheteurs reste équivalent à celui de l’année dernière, avec près de 23 % de nouveaux acheteurs.

Avec un budget global de 275,2M€ et un coût moyen par film de 5,5M€, la coproduction reste-t-elle un levier majeur ?

Le coût moyen est d’ailleurs en légère baisse, d’environ 100 000 € par rapport à 2025, tout comme le

budget total des projets, avec 41 M€ de moins. Cette évolution s’explique en partie par la présence de formats plus courts, notamment en préscolaire, qui influencent directement les montants globaux. Dans le contexte économique actuel, la coproduction prend une importance encore plus grande. De plus en plus de projets arrivent au Cartoon Movie avec au moins un coproducteur déjà engagé. Depuis la sélection des projets début décembre, plusieurs films ont même signé de nouveaux partenaires. Cette dynamique concerne surtout les longs métrages, davantage que les séries.

Le Canada sera mis en avant cette année avec “QuébecCanada Land in Europe : A Space for Creation”. Quels sont les objectifs visés par cette initiative ? Il s’agit d’une demande de la part du Canada, formulée il y a un an durant la Berlinale. Nous devions profiter de cette opportunité, qui peut offrir de vraies possibilités à nos producteurs européens. Six projets canadiens seront ainsi pré-

Une sélection reflet de la vitalité de l’animation européenne

u La28èmeéditiondeCartoonMovieàBordeauxréunira cinquanteprojetsdelongsmétragesd’animationissusde vingt-et-unpays.parJosephLeFer

La 28 ème édition de Cartoon Movie se tiendra à Bordeaux du 3 au 5 mars 2026, offrant une plateforme de financement et de visibilité pour 50 projets de longs métrages d’animation sélectionnés parmi 150 candidatures, soit une augmentation de 22 % par rapport à l’édition précédente. Ces projets seront présentés à des coproducteurs, distributeurs, agents de vente, responsables de plateformes de streaming, éditeurs et investisseurs, ainsi qu’à d’autres acteurs de l’industrie cinématographique. La sélection reflète la vitalité de l’animation européenne, avec des projets provenant de 21 pays. La France arrive en tête avec 15 films, suivie de l’Allemagne (6) et de l’Espagne (5). Les pays d’Europe centrale et orientale (République tchèque, Croatie, Estonie, Géorgie, Hongrie, Pologne et Roumanie) totalisent 11 projets, tandis que les pays nordiques (Danemark, Norvège, Suède) sont représentés par 4 projets. La Belgique, l’Italie,

l’Irlande et les Pays-Bas comptent chacun 2 projets, et l’Autriche, la Grèce, le Luxembourg et l’Ukraine complètent la sélection avec un projet chacun.

Avec un budget global de 275,2M€, le coût moyen par film s’élève à 5,5 M€. La coproduction reste un levier majeur : 29 projets (58 %) associent des pays membres du programme Europe Créative MEDIA à des pays extérieurs comme le Canada, le Japon, le Nigéria ou le Royaume-Uni.

7projetsenphasede production

La sélection comprend 30 projets en développement (60 %), 12 en phase de concept (24 %) et 7 en production (14 %). L’avant-première de Jim Queen (Bobbypills), de Marco Nguyen et Nicolas Athané, sera présentée lors de l’événement. Le film, distribué par The Jokers, sortira en salles le 17 juin 2026.

L’égalité femmes-hommes progresse dans l’animation euro -

sentés : quatre à l’état de concept et deux en développement. Tous sont à la recherche d’un coproducteur européen. J’avais également posé comme condition la présence d’une délégation de 13 acheteurs canadiens, car il est important qu’ils découvrent et s’intéressent aux projets européens. Cette collaboration se poursuivra également au Cartoon Forum. n ProposrecueillisparJ.L.F.

decette28èmeédition.

péenne: 37 % des projets comptent au moins une réalisatrice, 52 % sont portés par une productrice principale, et près de la moitié des films mettent en scène un personnage principal féminin. La diversité et l’inclusion sont également présentes dans 38 % des projets. En matière de public, 52 % des projets ciblent les familles et les enfants, tandis que 38 % s’adressent aux jeunes adultes et aux adultes, en progression par rapport à 2025. Deux films visent le public préscolaire. Neuf projets sont adaptés de livres ou de romans graphiques et huit bénéficient d’un soutien régional en Nouvelle-Aquitaine. Huit projets avaient déjà été présentés à Cartoon ou Cartoon Springboard. Depuis sa première édition en 1999, 504 films ont été soutenus financièrement grâce à Cartoon Movie, pour un budget total de 3,37 Md€. n

p PrésentéauCartoonMovie2023,lelongmétrageJimQueen(Bobbypills)sera présentéenavant-premièrelors

Distributeur européen de l’année

Flins y Pinículas (Espagne).

Les Films du Préau (France).

Kino Mediteran (Croatie).

Réalisateur européen de l’année

Irene Iborra Rizo pour Olivia et le tremblement de terre invisible

Mailys Vallade et Liane-Cho Han pour Amélie et la métaphysique des tubes

Reza Memari pour The Last Whale Singer

Ugo Bienvenu pour Arco

RECEVEZ NOS ALERTES EMAIL GRATUITES

Patrice Carré © crédit photo : Cartoon

Tags : ANIMATION

d’Animation de Rennes déroule

au 12 avril 2026. Plus de 130 titres ont été sélectionnés et répartis dans six catégories : courts métrages professionnels, courts métrages étudiants, clips, séries, ﬁlms d’ateliers et ﬁlms autoproduits.

Un actionnaire de poids entre au capital de Miyu

Le Cartoon Movie annonce les nommés au prix Eurimages au développement de la coproduction

CINÉMA Ce prix est destiné à promouvoir le rôle du fonds dans l'encouragement des coproductions internationales dès les premières étapes d'un projet.

PLF 2026 : Le gouvernement dépose plusieurs amendements relatifs au cinéma et à l'audiovisuel

CINÉMA Plusieurs amendements déposés par l’exécutif remettent en cause des mesures adoptées par le Sénat sur les crédits d’impôt en faveur de la production audiovisuelle et cinématographique, à l’approche du nouvel examen du budget 2026 en séance publique.

L'animation française brille (encore) aux Annie Awards

CINÉMA Cette prise de participation, qui s’inscrit dans une dynamique déjà à l’œuvre, marque une étape importante dans le développement de Miyu et conﬁrme sa place en tant qu’acteur de référence de l’animation en France et à l’international.

CINÉMA La cérémonie des prix américains récompensant le meilleur de l'animation se tiendra le 21 février. Une fois de plus, la production française sera largement représentée. Décret SMAD : Les modifications en vigueur depuis le 1er janvier

DIGITAL Les modiﬁcations du décret SMAD aménageant l'obligation de diversité, souhaitées par la ministre de la Culture Rachida Dati, ont été publiées au Journal ofﬁciel ce 30 décembre. Le groupe Toho annonce l’acquisition de Anime Ltd. Citia lance un fonds de dotation pour la Cité internationale du Annecy esquisse les contours de sa prochaine édition

08/03/2026, 15:22

Cartoon Movie 2026 - Les lauréats des Tributes dévoilés

Date de publication : 05/03/2026 - 14:35

Les professionnels participant à cette 28e édition ont désigné par leurs votes les lauréats des trois catégories, producteur, distributeur et réalisateur de l’année. Le Prix Eurimages du développement de la coproduction a également été remis. Dix-neuf entreprises et organisations européennes étaient en lice dans la catégorie producteur européen de l’année, en tant que coproducteurs de quatre longs métrages, tous présentés à Cartoon Movie à différents stades d’avancement : Le Secret des Mésanges, réalisé par Antoine Lanciaux, Stitch Head, coréalisé par Steve Hudson et Toby Genkel, Tales from the Magic Garden réalisé collectivement par David Šukup, Patrik Pašš, Leon Vidmar et Jean-Claude Rozec et enﬁn Allah n'est pas obligé de Zaven Najjar.

https://www.leﬁlmfrancais.com/cinema/175296/cartoon-movie-2026-les-laureats-des-tributes-devoiles 1/3

CINÉMA

08/03/2026, 15:22

08/03/2026, 15:22 Cartoon Movie 2026 - Les lauréats des Tributes dévoilés - Le ﬁlm français

08/03/2026, 15:22

Cartoon Movie 2026 - Les lauréats des Tributes dévoilés - Le ﬁlm français

Trois sociétés étaient en compétition pour le prix du Distributeur européen de l’année : Flins y Pinículas (Espagne), Les Films du Préau (France) et Kino Mediteran (Croatie). Enﬁn quatre cinéastes avaient été nommés en tant que réalisateur européen de l’année : Irene Iborra Rizo pour Olivia et le tremblement de terre invisible, Mailys Vallade et Liane-Cho Han pour Amélie et la métaphysique des tubes, Reza Memari pour The Last Whale Singer et Ugo Bienvenu pour Arco

Lauréats des Cartoon Movie Tributes 2026

Distributeur européen de l’année

Les Films du Préau (France)

Distributeur européen de l’année

Les Films du Préau (France)

Distributeur européen de l’année

Les Films du Préau (France)

Réalisateur européen de l’année

Les Films du Préau (France)

Réalisateur européen de l’année

Reza Memari pour The Last Whale Singer

Réalisateur européen de l’année

Reza Memari pour The Last Whale Singer

Producteur européen de l’année

Special Touch Studios / Creative Touch Studios (France) / Paul Thiltges Distributions (Luxembourg) / Yzanakio (Canada) / Need Productions / Lunanime (Belgique) pour Allah n'est pas obligé

De son côté le Fonds Eurimages du Conseil de l'Europe avait choisi de s’associer à neuf marchés de coproduction du monde entier, dont Cartoon Movie faisait à nouveau partie cette année, aﬁn de remettre le Prix Eurimages du développement de la coproduction. Doté en espèces d’une somme de 20 000 €, devant couvrir les frais de développement du projet il vise à promouvoir le rôle du Fonds dans l'encouragement des coproductions internationales dès les premières étapes d'un projet.

Doté en espèces d’une somme de 20 000 €, devant couvrir les frais de développement du projet il vise à promouvoir le rôle du Fonds dans l'encouragement des coproductions internationales dès les premières étapes d'un projet.

13 projets étaient en lice cette année. Le prix a été décerné à Acorn’s Adventure de Filip Mašek, produit en république tchèque par Pure Shore en coproduction avec les allemands de Fabian&Fred.

RECEVEZ NOS ALERTES EMAIL GRATUITES

Patrice Carré

Patrice

Carré

RECEVEZ NOS ALERTES EMAIL GRATUITES

Patrice

RECEVEZ

RECEVEZ NOS ALERTES EMAIL GRATUITES

Patrice Carré

Carré © crédit photo : Patrice Carré

Patrice Carré

https://www.leﬁlmfrancais.com/cinema/175296/cartoon-movie-2026-les-laureats-des-tributes-devoiles 2/3

- France -

CCaarrttoooonn MMoovviiee 22002266 –– UUnn ddiissttrriibbuutteeuurr ppoouurr

""LL’’OOddyyssssééee dd’’HHaakkiimm""

Date de publication : 05/03/2026 - 14:07

Le nouveau ﬁlm de Patrick Imbert, coproduit par Folivari et Solab Films, qui sera une adaptation de la bande dessinée de Fabien Toulmé, a été présenté pour la première fois au Cartoon Movie.

Un peu moins de cinq ans après la belle carrière en salles du Sommet des dieux, Patrick Imbert a présenté à Bordeaux son nouvel opus L’odyssée d’Hakim. Tout est parti d’une bande dessinée de Fabien Toulmé, sortie chez Delcourt, dont Chloé Ceotto-Servel (Solab Films) a immédiatement voulu acheter les droits. Elle a ensuite proposé à Patrick Imbert, qui était très intéressé, de faire l’adaptation. "Il était naturel d'aller voir Folivari, parce que Patrick a fait ses ﬁlms avec Damien Brunner et a ses habitudes de fabrication dans leur studio. Nous nous sommes donc associés pour être coproducteurs sur le projet" raconte Chloé Ceotto-Servel. "Nous allons mettre à l'écran

- France -

CINÉMA

la force de la bande dessinée de Fabien Toumet" poursuit Damien Brunner. "Cette capacité à ﬁlmer l'invisible, l'attente, la peur, la violence des rapports humains, la résilience, mais aussi l'humanité qui surgit du chaos ou même de tous les chaos. Nous voulons que ce ﬁlm soit le récit de cette reconquête".

La partie graphique a nécessité un long développement avant d’aboutir aux images qui ont été dévoilées pendant le Cartoon, dans l’idée de mettre en avant la direction choisie. Patrick Imbert s’est entouré pour ce faire de collaborateurs proches de son univers, notamment Louise Seynhaeve. Le scénario se présente comme un condensé de la trilogie tout en épousant au mieux la trajectoire d’Hakim. La particularité du projet passe par sa façon d’aborder avec un regard très différent ce parcours de migration, grâce à un personnage central qui se réinvente à chaque étape. Il propose aussi un questionnement profond sur la nature de l’exil lequel résulte rarement d’une décision choisie.

Sur la scène du Palais des Congrès de Bordeaux Patrick Imbert a présenté L’Odyssée d’Hakim comme une histoire "qui dépasse les frontières, les langues et les cultures. Alors évidemment, le film a une portée politique. Il se passe des choses graves dans le monde, ce n'est pas fini et je crois qu’il est important d'en parler. Mais je veux le faire à ma manière, c'est-à-dire sans grands discours, mais avec la fiction, en essayant de toucher les gens sans morale ni prétention, avec humanité et bienveillance. Je souhaite convaincre par l'émotion".

A l’issue de la présentation Damien Brunner a annoncé qu’Ad Vitam rejoignait le film en tant que distributeur. "C'est un projet qui a rencontré assez rapidement un grand enthousiasme chez nous parce que nous y avons identifié beaucoup des éléments que nous essayons de rechercher dans les films que nous soutenons" a précisé Malo Jacquemin, en charge des acquisitions chez Ad Vitam. "Je pense en premier à un message social, politique évident du fait de l'histoire, mais aussi à cette dimension internationale qui est quelque chose que nous recherchons sans cesse. Cela passe par la transposition graphique mais aussi la renommée de Patrick Imbert. Nous avons la conviction qu’il saura donner un souffle cinématographique à cette adaptation".

Patrice Carré

CCaarrttoooonn MMoovviiee 22002266 -- JJuusstt AA MMoommeenntt,, VViivveemmeenntt

LLuunnddii !! eett NNeeeedd PPrroodduuccttiioonnss aannnnoonncceenntt uunnee aaddaappttaattiioonn

Date de publication : 03/03/2026 - 14:00

Adapté du roman graphique lituanien Haïkus de Sibérie, un long métrage d’animation est en cours de développement par une équipe de production lituanienne, française et belge. Un projet rejoint par l’artiste belgo-polonaise

Sylwia Szkiladz, shortlistée aux Oscars avec Autokar. A l’occasion du Cartoon Movie qui ouvre ses portes ce mardi 3 mars à Bordeaux, Just A Moment, Vivement Lundi ! et Need Productions annoncent l’adaptation au cinéma de la bande dessinée lituanienne Sibiro Haiku de Jurga Vilė et Lina Itagaki. Publiée en 2017, elle raconte l'histoire vraie d'Algis, un enfant lituanien déporté avec une partie de sa famille dans un camp de

CINÉMA

travail en Sibérie en 1941. Il y découvre la vie au quotidien, la cruauté des gardiens et la force des sentiments qui le lient à sa famille et à son amie Véronika. Le quotidien du garçon est rythmé par les chants de la Chorale des Pépins de pommes, les percussions des prisonniers japonais, les haïkus de sa tante Pétronelle, la recherche de nourriture, les lettres envoyées à son père Romas et les facéties de Martynas, son jars apprivoisé. Un récit d’initiation fort, poétique et émouvant. Le livre a depuis été traduit en 15 langues et publié dans le monde entier, du Royaume-Uni au Japon. En France, il est disponible chez Sarbacane sous le titre Haïkus de Sibérie

Dagnė Vildžiūnaitė, productrice pour la société de production lituanienne Just a Moment, a décidé d’adapter le ﬁlm en collaboration avec le producteur français Jean-François Le Corre (Vivement Lundi !), avec comme objectif commun de créer une histoire qui trouve un écho auprès des enfants et des familles du monde entier. "Cela fait partie de ces ﬁlms comme Interdit aux chiens aux Italiens qui permettent de raconter un fragment de la grande histoire européenne et sont susceptibles d’irriguer différents pays" commente Jean-François Le Corre.

Les producteurs ont conﬁé l’adaptation à la scénariste française Christelle Berthevas, qui travaille aux côtés de l'autrice du livre, Jurga Vilė, et à la graphiste belgo-polonaise Sylwia Szkiladz qui sera également la réalisatrice du ﬁlm. Elle a précédemment signé, Autokar, primé à la Berlinale 2025, shortlisté aux Oscars et nommé aux René du cinéma belge, autre histoire à hauteur d’enfant. Sylwia Szkiladz a rejoint le projet en novembre dernier, en même temps que la société belge Need Productions (Anne-Laure Guégan et Géraldine Sprimon).

L'écriture du scénario et la conception graphique sont en cours et les producteurs espèrent présenter le projet aux investisseurs lors du Mifa d’Annecy 2026. Le développement a été ﬁnancé par le Centre du cinéma lituanien, Europe Créative et Bretagne Cinéma. En janvier, le Centre du cinéma lituanien a apporté un soutien important à la production, sécurisant son lancement.

Le budget du ﬁlm est évalué à 3,5 M€ dont 30% sont sécurisés. Les producteurs de Vivement Lundi ! seront présents au Cartoon Movie du 3 au 5 mars. Ils sont ﬁnalistes pour le Cartoon Movie Tribute du meilleur producteur de l’année qui sera décerné le 5 mars.

Patrice Carré

FranceRECEVEZ NOS ALERTES EMAIL GRATUITES

• No comments

• Save article

Please Sign in to your account to use this feature

Screen selects 10 projects spanning a mix of territories, genres and target audiences being showcased at the Cartoon Movie coproduction and pitching forum.

Before They Were Gods (In concept)

Dir: Måns Mårlind

Swedish director and series creator Måns Mårlind, internationally known for Underworld: Awakening and as a driving force behind Nordic noir hit The Bridge, moves into animation with a coming-of-age tale that imagines Nick Cave and Joakim Thåström before they became rock icons. The film wil explore friendship, love and artistic awakening and chart their formative bond — philosophy, pop culture and teenage rebellion included. Sweden’s Mylla Films produces with Brokendoll, Qvisten Animation, Parce Que Films and the UK’s Elastic Film.

Dreamers - The Hunt for Shadowclaw (In development)

Dir: Christopher Jenkins

The director of 2024 Sundance title 10 Lives returns with a family feature centred on a cast of animals with different disabilities. The story follows an unlikely trio: Lenny, a K9-on-wheels in training; Fred, a beatboxing Indian Runner duck on the autism spectrum; and Bearnice, a joyful black bear with Down syndrome who loves to sing and dance. Together they race to rescue a runaway panther in the heart of New York. The film is being produced by Germany’s Parapictures and Epsilon Film with Canada’s Falcon Features and Kickstart Entertainment.

Hakim’s Odyssey (In development)

Dir: Patrick Imbert

Two-time César winner for The Summit Of The Gods and The Big Bad Fox And Other Tales, the director unveils his second solo feature, a 2D adventure aimed at adults. The film follows a Syrian man forced into exile who builds a fragile life in Turkey with fellow refugee Najmeh and their son. When she reaches France on a visa, father and child endure mounting hardship, culminating in a perilous Mediterranean crossing. Paris-based Folivari produces with Solab Pictures.

Halloween Vs. Day Of The Dead (In development)

Dir: Celso García

- United Kingdom -

Hakim’s Odyssey (In development)

Dir: Patrick Imbert

Halloween Vs. Day Of The Dead (In development)

Dir: Celso García

A 3D family feature set between Halloween Ville and neighbouring Day of the Dead Town. Grieving his grandfather, young Pumpkid crosses a forbidden bridge for one last reunion and meets Bony Lu, a Catrina girl embodying Mexico’s Day of the Dead tradition. When holiday candies vanish, threatening both celebrations, the pair set out to solve the mystery. Directed by Mexico’s Celso García, whose credits includeThe Thin Yellow Line, the film is led by Germany’s Studio 100 International with Spain’s 3Doubles Producciones.

Kindred Spirits (In development)

Dir: Tomm Moore

Two powerhouses of Europe’s animation, Ireland’s four-time Oscar-nominated Cartoon Saloon (Wolfwalkers, The Secret Of Kells) and French Folivari (Ernest & Celestine: A Trip to Gibberitia) team to develop this familyfocused project. Set in 1847 New York, the story follows an Irish refugee girl and a displaced Choctaw boy who form an unlikely bond. Watched over by Mara’s restless brother from the spirit world, they set off on a magical quest for belonging, family and a place to call home.

Night Tram (In development)

Dir: Michaela Pavlátová

Oscar-nominated filmmaker Pavlátová, whose credits include My Sunny Maad, tells the story of Božena, the best tram driver of her city, despite her age. But when she loses her nerve driving a modern tram, she searches for a new direction in life — all while her body increasingly transforms into a fragile bug. The project is being produced by the Czech Republic’s Negativ, France’s Sacrebleu, Slovakia’s BFilm and Lithuania’s ArtShot.

Once Upon An Egg (In development)

Dir: Nina Gant

Oscar-shortlisted for Wander To Wonder, Gant moves into features with this stop-motion fable about two grey city pigeons who lose their nest and only egg. Their struggle for survival leads to an unlikely new family after they take care of an orphaned egg they discover. The producers are the Netherlands’ Keplerfilm in co-production with Belgium’s A Private View and the Czech Republic’s Hauboot.

Sam And Julia (In concept)

Dir: (not yet attached)

Dutch 3D family feature Sam And Julia is an adaptation of Karina Schaapman’s miniature world The Mouse Mansion about friendship and belonging. The story follows newcomer Julia, who joins forces with solitary Sam to clear her name after a wave of toy thefts. Produced by Netherlands’ Submarine Animation, whose credits includde They Shot The Piano Player, alongside Germany’s The M.A.R.K.13 Group, Switzerland’s Superswiss Red and France’s Cielo Films.

Starseed (In production)

Dir: Anca Damian

A long-gestating project from acclaimed Romanian director Anca Damian, renowned for Crulic – The Path To Beyond, Starseed has finally entered production, with Mediawan on board as international sales agent. Produced by Damian’s Aparte Film, the 3D feature is co-produced with Special Touch Studios (France), Yzanakio (Canada), Wrong Men (Belgium) and Known Associates Group (South Africa). Set in a drought-stricken Zimbabwean township, the film follows fearless albino girl Loveness and her friends as they navigate a droughtstricken landscape, trying to free a trapped wáter goddess.

The Wild And The Tame (In development)

Dir: Tibor Bánóczki, Sarolta Szabó

This is the Hungarian directorial duo’s sophomore effort after their dystopian eco-fantasy White Plastic Sky. A mystical film with bold artwork, The Wild And The Tame is about a Budapest painter returning home for her mother’s funeral. There she teams with a disgraced, one-armed priest to paint villagers’ nightmares onto a church, unleashing revenge, faith and reckoning. The film is produced by the directors’ label Domestic Infelicity.

- United Kingdom -

“Whereas at other festivals the intention is usually about celebrating the past or recent work,

“As a medium-sized event, Cartoon Movie offers something increasingly rare in today’s industry, a genuine human touch,” Maes suggests. “ This is part of our DNA. The approachable scale

Cartoon Movie is very much future-focused,” says Moore, founder of Ireland’s

Cartoon Saloon outﬁt.

with to this day, plus all the major broadcasters and distributors we work with still. We can trace many of them back to the ﬁrst meeting at Cartoon Movie.”

- 03/03/2026

Pitching unfolds over two days in two theatres, with sessions organised by project stage. Inconcept sessions last approximately one hour and typically group around six projects. Development, production and sneak preview sessions run roughly 20 minutes each and feature just one project each.

- United Kingdom-

“Cartoon Movie is a short, intense format designed for concrete results,” says Annick Maes of the animation showcase

BY EMILIO MAYORGA | 3 MARCH 2026

SOURCE: COURTESY OF CARTOON MOVIE

‘PIRATE MO AND THE LEGEND OF THE RED RUBY’

Cartoon Movie, the annual co-production and pitching forum for Europe’s feature animation sector, runs March 3–5 in Bordeaux. Its 28th edition showcases 50 projects from 21 countries, selected from a record 150 submissions, up 22% on 2025.

European animation heavyweights such as Ron Dyens, one of the producers of Oscar-winning Flow, two-time César winner Patrick Imbert (The Summit Of The Gods) and Tomm Moore, director of the multi-awarded The Secret Of Kells, will be joined by emerging talents presenting ﬁrst or second

SOURCE: COURTESY OF CARTOON MOVIE ‘TUKUY’

• Tomm Moore’s ‘Kindred Spirits’ among Cartoon Movie 2026 line-up

- United Kingdom-

6/3/26,17:17

‘Acorn’sAdventure’leadswinnersatCartoonMovie|News|Screen

‘Acorn’sAdventure’leadswinnersatCartoonMovie

BY EMILIOMAYORGA |6MARCH2026

SOURCE:CARTOONMOVIE

FilipMašek’s Acorn’sAdventure wontheEurimagesCo-ProductionDevelopmentaward,witha€20,000 cashprize,atEuropeananimationpitchingforumCartoonMovie.TheBordeauxeventranMarch3-5.

Mašek,aVFXsupervisorandcinematographerwhoseworkspansanimation,digitalpost-production andvideogames,makeshisfeaturedirectingdebutwiththisstoryaboutQuido—aboyfashioned fromacornsandtwigsbyachild.Broughttolife,Quidosetsoffonadaringrescueadventurethat graduallyleadshimtouncoverthepurposeofhisownexistence.

- United Kingdom -

ItisproducedbyCzechia’sPureShoreinco-productionwithGermany’sFabian&Fred.

6/3/26,17:17

TributeAwards

‘Acorn’sAdventure’leadswinnersatCartoonMovie|News|Screen

ThedirectoroftheyearprizewenttoRezaMemarifor TheLastWhaleSinger.Theanimatedfamily fantasymarksMemari’ssecondfeaturefollowing AStork’sJourney,whichheco-directedwithToby GenkelandwhichpremieredintheBerlinale’sGenerationKplusin2017.

TheLastWhaleSinger centresonVincent,theorphanedsonoftheocean’slastWhaleSinger,whomust overcomehisfearsandﬁndhisownvoicetohelpsavetheseas.Theprojectwasﬁrstpresentedat CartoonMovieatconceptstagein2018,returningindevelopmentin2020andagaininproductionin 2025.

TheGermany–CzechRepublic–Canadaco-productionhassecuredsalesinmorethan30territories. InternationalsalesarehandledbyMunich-basedGlobalScreen.

Paris-basedLesFilmsduPréauwasnameddistributoroftheyear.Foundedin2000byEmmanuelle ChevalierandMarie-AgnèsBourillon,theindependentoutﬁtspecialisesinﬁlmsforyoungaudiences andhasbuiltacatalogueofmorethan200titles.ItsreleasesincludeKristinaDufková’sbody-swap comedy LivingLarge andMaxLangandJakobSchuh’sOscar-nominated TheGruffalo

Theproduceroftheyeartributewenttotheproductionteambehind AllahIsNotObliged; Special TouchStudiosandCreativeTouchStudios(France),PaulThiltgesDistributions(Luxembourg),Yzanakio (Canada),andBelgium’sNeedProductionsandLunanime.Soldbymk2,theprojectisanadult animated wardramabasedonthenovelbyAhmadouKouroumaaboutBirahima,astreetwisechild soldiernavigatingtheconﬂictsofWestAfricawithbitinghumourandunﬁlteredhonesty.

TheCartoonTributes,votedbyindustryprofessionalsattendingtheevent,recognisecompaniesand individualswhohavemadeasigniﬁcantimpactonEuropeananimationoverthepastyear.

Attheclosingpressconference,CartoongeneralmanagerAnnickMaeshighlightedtherecordnumber ofsubmissionsreceivedthisyeardespitethechallengingeconomicclimate.Shealsopointedtothe highnumberofprojectsengagingwithmeaningfulthemes.“Globalrealitiessuchaswar,exileand migration.Itwasinterestingtoseethattheseprojectswereaddressedtoawiderangeofaudiences, fromyoungadultstofamilies,”Maesnoted.

Maesalsounderlinedtheincreasingnumberofco-productions,evenamongIn-Conceptprojects (thoseattheearlieststagesofdevelopment).

6/3/26,17:17

31ofthe50projectspresentedatCartoonMoviefeaturedatleastonemainfemalecharacter.34%of theline-upwasproducedbyfemaleproducers,and27%weredirectedbywomen,accordingtoMaes.

‘Acorn’sAdventure’leadswinnersatCartoonMovie|News|Screen

Maesalsoheraldedan“upcominggeneration”oftalentfromCentralandEasternEurope,citing projectssuchasMichaelaPavlátová’s NightTram,HungarianduoTiborBánáffyandZsóﬁaTábor’s The WildAndTheTame,andEurimagesco-developmentawardwinnerFilipMašek.

https://www.screendaily.com/news/acorns-adventure-leads-winners-at-cartoon-movie/5214578.article 2/3

- United Kingdom-

Cartoon Movie Awards: ‘Allah Is Not Obliged’ Wins Producer of the Year

Kevin Giraud

1. Home

2. Film

Cartoon Movie Awards: ‘Allah Is Not Obliged’ Wins Producer of the Year

3. Global

Kevin Giraud 1. Home

Europe’s Animation Industry Honors ‘Last Whale Singer,’ Les Films du Préau, ‘Allah Is Not Obliged’ and ‘Acorn’s Adventure’ at Cartoon Movie 2026

Film 3. Global

Europe’s Animation Industry Honors ‘Last Whale Singer,’ Les Films du Préau, ‘Allah Is Not Obliged’ and ‘Acorn’s Adventure’ at Cartoon Movie 2026

European animation celebrated its latest achievements at pitching and co-production forum for European animated features which concludes today in Bordeaux. Voted by industry professionals attending this 28th edition of the event, the Cartoon Tribute Awards again recognized the companies and individuals whose work has made a significant impact on the European animation industry over the past year.

- USA -

This year, the Producer of the Yearprize was jointly awarded to the team behind “Allah Is Not Obliged”, a co-production between Special Touch Studios (France), Creative Touch Studios (France), Paul Thiltges Distributions (Luxembourg), Yzanakio (Canada), Need Productions (Belgium) and Lunanime (Belgium). Marking the directorial debut of Zaven Najjar, art director

European animation celebrated its latest achievements at Cartoon Movie, the must-attend pitching and co-production forum for European animated features which concludes today in Bordeaux. Voted by industry professionals attending this 28th edition of the event, the Cartoon Tribute Awards again recognized the companies and individuals whose work has made a significant impact on the European animation industry over the past year.

The Distributor of the Year award went to Paris-based Les Films du Préau, an independent film distribution company focused on high-quality films for young audiences.

Founded in 2000 by Emmanuelle Chevalier and Marie-Agnès Bourillon, the company boasts a diverse catalogue of more than 200 titles and has distributed films such as “The Gruffalo” and most of the subsequent Magic Light Pictures specials, along with arthouse animation projects from all over the world, including “The Boy and the World,” “Choum’s Odyssey“ and “Living Large.” As of today, Les Films du Préau’s main upcoming animated title is French-Belgian coproduction “Petite Casbah,” set to release Oct. 14 in France.

Parallel to the Tributes, Cartoon Movie hosted the Eurimages Co-production Development Award (CPDA) once again this year, a cash prize of €20,000 ($23,200) created to promote the Fund’s role in encouraging international co-productions from the initial stages of a project. This year, a jury of professionals honored the Czech-German coproduction “Acorn’s Adventure” by Pure Shore (Czech Republic) and Fabian&Fred (Germany), a project it “really appreciated for its original storytelling, inspired by the director’s experience working with children and their curiosity for the natural world.”

The jury also underlined the joyful humor and fantasy of this project as well as its innovative animation production technique which brings their unique hand-made characters to life. The project, already pitched at MIFA last year and at the EFM Animation Days a few weeks ago, is already gathering attention from international sales and European partners ahead of its Cartoon Movie this afternoon.

The Director of the Year award went to Reza Memari for “The Last Whale Singer.” His second feature after “Richard the Stork,” which he co-directed with Toby Genkel, “The Last Whale Singer” is an animated musical fantasy for family audiences, made with cutting-edge technology through a unique German-Czech-Canadian co-production scheme.

The film follows Vincent, the orphaned son of the last Whale Singer, who must overcome his fears and discover his own voice to help save the oceans. Presented at Cartoon Movie at different stages from concept (2018) to development (2020) and production (2025), Memari’s new work has already been sold to more than 30 international territories and made a strong debut in Czech Republic when it came out on Feb. 19. Plans for a sequel are already underway, along with further collaborations including global ocean trusts, bridging the gap between meaningful topics and down-to-earth eco-conscious actions.

The Cartoon Tribute award ceremony took place Thursday at the Palais des Congrès in Bordeaux, where 50 new animated projects from 21 countries were presented over two days,

Kevin Giraud

LevelK Boards ‘Betty Balloon,’ From Puk Grasten, a Cartoon Movie Title

LevelK Boards ‘Betty Balloon,’ a Cosy Fun Adventure, Ahead of Cartoon Movie

Unveil (EXCLUSIVE)

Kevin Giraud

'Betty Balloon' follows a modern family who just happen to be… balloons. When a cactus family moves in next door, it's Betty, aged 4, and her brother who lead the way in connecting with the new neighbours

LevelK Boards ‘Betty Balloon,’ a Cosy Fun Adventure, Ahead of Cartoon Movie

Unveil (EXCLUSIVE)

'Betty Balloon' follows a modern family who just happen to be… balloons. moves in next door, it's Betty, aged 4, and her brother who lead the way in connecting with the new neighbours

Balloon' (Courtesy of LevelK)

An early lift-off has already been secured for Puk Grasten’s “Betty Balloon,” as the Copenhagenbased international sales and aggregation house LevelK has secured worldwide rights to upcoming pre-school animated feature and TV series.

The agreement, brokered between LevelK CEO Tine Klint and the film’s main producer Regner Grasten, was reached just ahead of the project’s work-in-progress presentation at Cartoon Movie in Bordeaux, LevelK told Variety.

'Betty Balloon' (Courtesy of LevelK)

A theatrical release of the animated feature is scheduled for October in Denmark, with Danish public broadcaster TV2 set to premiere the series.

A Danish co-production between Regner Grasten Filmproduktion and A. Film Production, “Betty Balloon” follows a modern family who just happen to be… balloons.

'Betty

Grasten, was reached just ahead of the project’s work-in-progress presentation at Cartoon Movie in Bordeaux, LevelK told Variety.

A theatrical release of the animated feature is scheduled for October in Denmark, with Danish public broadcaster TV2 set to premiere the series.

A Danish co-production between Regner Grasten Filmproduktion and A. Film Production, “Betty Balloon” follows a modern family who just happen to be… balloons.

At the centre of the story is Betty, a creative and imaginative four-year-old. Life’s turned upside down when a cactus family moves in next door. The Balloon family (Mom, Dad, and Betty’s super tweenie big brother Bobby) must learn to connect with their new neighbours. But in “Betty Balloon”, it’s the kids who lead the way, as Betty quickly becomes best friends with four-year-old Kaj Cactus, proving that curiosity and openness can bridge even the prickliest divides. In this colorful universe, it’s the kids who show the grown-ups how to connect.

“In ‘Betty Balloon,’ the unknown is not dangerous,” explained director Puk Grasten, who also wrote the story and adapted it for the big screen. “It is an invitation to open up. The film [as well as the series] celebrates openness, imagination and emotional honesty,” as well as creativity and curiosity in a soft 2D computer animation style that will definitely appeal to the pre-school audience.

A European Film College/EICAR/NYU Tisch alum, Grasten received the Danish Arts Foundation’s Award for Outstanding Cinematic Work and the Carl Th. Dreyer Award for Visual Storytelling for her debut feature “37.” “Betty Balloon” is her third feature film, and her first venture into animation.

A female-driven fun, cosy adventure, “Betty Balloon” is also highly relevant today, inviting children and parents to openness and acceptance through the unlikely friendship between a balloon and a cactus. Values that both pre-schoolers and adults can relate to, as producer Regner Grasten underlines. “This dynamic stands out from more traditional family set-ups seen in shows like ‘Peppa Pig’ and ‘Bluey,’ offering an alternative vision of community and empathy.”

“Teaching through entertainment is indeed important”, added LevelK CEO Tine Klint, “and as Betty Balloon and Kaj Cactus have to navigate the challenges of living next to each other, becoming friends, and simply being who they are. Their creative minds make the journey fun.”

That’s an approach that fits perfectly with LevelK values and ambitions. A few weeks ago in Berlin, the company presented “Everyone’s Sorry Nowadays” (Generation Kplus), “Dust” (main competition) as well as such titles as “Chasing Millions” and the animated feature “Mumbo Jumbo”, an A. Film Production project.

Regner Grasten Filmproduktion, one of Denmark’s largest production companies, boasts a catalogue of 45 films totalling more than 14 million cinema admissions to date. The company also produced the hit TV Christmas series “The Crumbs’ Christmas” (Krummernes Jul, 1996) and “The Mortensen Brothers’ Christmas” (Brødrene Mortensens Jul, 1998) for TV2 Denmark, and several of the company’s productions have been sold worldwide.

Besides the feature and the TV series, development is also underway on “Betty Balloon” books and merchandising lines, strengthening this innovative and heartfelt IP in the making.

DatabaseMarketIntelligenceNewsReviewsInterviewsFestivalReportsServicesMore

Europa Distribution to present case studies on recent European animation ﬁlms’ releases at Cartoon Movie

CARTOON 2026 Cartoon Movie

CARTOON 2026 Cartoon Movie ANiMPACT Standards presented at Cartoon Movie

projects

https://cineuropa.org/en/newsdetail/487717/

Cartoon Movie unveils a line-up of 50 animated feature projects

Davide Abbatescianni

19/01/2026 - Pan-European by design, the Bordeaux-based gathering will also open a dedicated window onto Canadian and Québecois animation through a special co-production focus

Jim Queen

Marco Nguyen and Nicolas Athané

The 28th edition of Cartoon Movie, one of Europe’s key co-production and pitching events for animated feature films, will present 50 projects selected from a record 150 submissions, marking a 22% increase on last year. The forum will take place in Bordeaux from 3 to 5 March, bringing together producers, sales agents, distributors, streaming platforms, publishers and investors from across the international animation industry.

The selected slate spans 21 European countries and reflects the current vitality of European animation, combining emerging voices and established filmmakers, auteur-driven works and audience-oriented projects, as well as productions from independent studios and internationally recognised companies. The projects explore a wide array of genres - from adventure, comedy and drama to sci-fi and documentary - and unfold across both realistic settings and fantastical universes.

Cartoon Movie unveils a line-up of 50 animated feature projects

1 van 7

https://cineuropa.org/en/newsdetail/487717/

France leads the selection with 15 projects, followed by Germany (6) and Spain (5). Central and

Eastern Europe accounts for 11 titles, while the Nordic countries - Denmark, Norway and Swedenare represented by four projects. Belgium, Italy, Ireland and the Netherlands each contribute two projects, with Austria, Greece, Luxembourg and Ukraine completing the line-up.

21/01/2026, 14:25

Gender balance and representation is continuing to gain ground: 37% of the projects involve at least one woman director, 52% are headed up by a female producer, and nearly half feature a woman in the lead role. Moreover, 38% of the slate foregrounds diversity and inclusion, signalling a growing awareness around representation in European animation storytelling.

With a combined budget of €275.2 million, the average cost per project stands at €5.5 million. Coproduction remains central to financing strategies, with 29 projects (58%) involving partners from both Creative Europe MEDIA countries and territories outside of the programme, including Canada, Japan, Mexico, Nigeria, South Africa, Switzerland and the UK. From a technical perspective, 2D animation dominates the selection (54%), followed by 3D projects (30%).

- Europe -

In terms of stage of production, 30 projects are in development, 12 are in the concept phase, and seven are in production, with a sneak preview of Jim Queen by Marco Nguyen and Nicolas Athané (staged by Bobbypills and Umedia) jostling on the agenda. Established directors presenting new works include Tomm Moore, Anca Damian and Patrick Imbert, while

Cartoon Movie unveils a line-up of 50 animated feature

projects, with Austria, Greece, Luxembourg and Ukraine completing the line-up.

Beyond the pitching sessions, Cartoon Movie will host a new edition of Cartoon Talks, focusing on cross-industry synergies with gaming and publishing. Sustainability will be a key theme, with keynote presentations including the Green Distribution Guide by Europa Distribution head Christine Eloy and the Green Animation Guide presented by Ecoprod. A panel dedicated to XR/ VR will also feature in the programme.

The event will further spotlight international co-production through the launch of Québec–Canada Land in Europe, an initiative developed with SODEC and Telefilm Canada, presenting six Canadian projects seeking European partners.

Since its creation in 1999, Cartoon Movie has supported 504 films with a total budget of €3.37 billion. The event is organised by CARTOON, under the direction of Annick Maes, with the support of Creative Europe - MEDIA and numerous national and regional partners.

This year’s full line-up is as follows:

Projects in Concept

Carmen and the Wooden Spoon - Carlos Gomez-Mira Sagrado

Production: Thinkwild Studios

Cornebidouille - Mathias Varin

Production: Les Armateurs (France), Folimage (France)

Firebird - Matej Podskalsky

Cartoon Movie unveils a line-up of 50 animated feature projects

Production: 13Ka (Czech Republic), Novanima Productions (France)

https://cineuropa.org/en/newsdetail/487717/

Happy Hunting vs the Apocalypse – Boris Belghiti, Maxime Paccalet, Pierre Razetto

2 van 7

21/01/2026, 14:25

Production: Kawanimation (France)

Lollipop Tattoo – Lisa Marie Russo

Production: Panoramine (France), Puffin Pictures (France), Fly Film (UK)

Onno & Ontje – Friends Are the Best Gift – Eliza Plocieniak-Alvarez

Production: Blaue Pampelmuse (Germany)

Riamise – Francesco Forti, Hirokazu Kojima

Production: IBRIDO Studio (Italy), Something Big (France), Studio 4°C (Japan)

Sam and Julia – Alexandre Révérend, Alice Révérend

Production: Submarine Animation (Netherlands), The M.A.R.K.13™ – Group (Germany), Superswiss Red (Switzerland), Cielo Films (France)

Sander’s Midsummer – Hanne Berkaak

Production: Mikrofilm (Norway), Den siste skilling (Norway), Knudsen Pictures (Germany)

Smecheria or the Confidences of a Cheat – Antoine Fontaine

Production: Walking the Dog (Belgium), Hutong Productions (France), Aparte Film (Romania)

Tukuy – Aline Romero

Production: Submarine Animation (Netherlands), The M.A.R.K.13™ – Group (Germany), Superswiss Red (Switzerland), Cielo Films (France)

- 19/01/2026

Sander’s Midsummer – Hanne Berkaak

Production: Mikrofilm (Norway), Den siste skilling (Norway), Knudsen Pictures (Germany)

Smecheria or the Confidences of a Cheat – Antoine Fontaine

Cartoon Movie unveils a line-up of 50 animated feature projects

Production: Walking the Dog (Belgium), Hutong Productions (France), Aparte Film (Romania)

https://cineuropa.org/en/newsdetail/487717/

3 van 7

Tukuy – Aline Romero

Happy Hunting vs the Apocalypse – Boris Belghiti, Maxime Paccalet, Pierre Razetto

Production: Huraa AIE (Spain), Doce Entertainment / Mr. Miyagi Films (Spain)

Production: Kawanimation (France)

Until Death Unites Us – Nawojka Wierzbowska

Lollipop Tattoo – Lisa Marie Russo

Production: GS Animation / Grupa Smacznego (Poland)

Production: Panoramine (France), Puffin Pictures (France), Fly Film (UK)

Projects in Development

Onno & Ontje – Friends Are the Best Gift – Eliza Plocieniak-Alvarez

13th Floor - Soraya Antelo Morales

Production: Blaue Pampelmuse (Germany)

Production: TREBOAMEDIA (Spain)

Riamise – Francesco Forti, Hirokazu Kojima

Acorn’s Adventure - Filip Mašek

Production: IBRIDO Studio (Italy), Something Big (France), Studio 4°C (Japan)

Producers: Pure Shore (Czech Republic), Fabian&Fred (Germany)

Sam and Julia – Alexandre Révérend, Alice Révérend

Akira’s Flying Wheelchair – Marco Balsamo

Production: TeamTO (France)

Production: Submarine Animation (Netherlands), The M.A.R.K.13™ – Group (Germany), Superswiss Red (Switzerland), Cielo Films (France)

Aya in the Desert - Julia Horrillo

Sander’s Midsummer – Hanne Berkaak

Production: Alhena Production (Spain)

Production: Mikrofilm (Norway), Den siste skilling (Norway), Knudsen Pictures (Germany)

Smecheria or the Confidences of a Cheat – Antoine Fontaine

21/01/2026, 14:25

Production: Walking the Dog (Belgium), Hutong Productions (France), Aparte Film (Romania)

Tukuy – Aline Romero

Production: Huraa AIE (Spain), Doce Entertainment / Mr. Miyagi Films (Spain)

Until Death Unites Us – Nawojka Wierzbowska

Production: GS Animation / Grupa Smacznego (Poland)

Projects in Development

13th Floor - Soraya Antelo Morales

Production: TREBOAMEDIA (Spain)

Acorn’s Adventure - Filip Mašek

Producers: Pure Shore (Czech Republic), Fabian&Fred (Germany)

Akira’s Flying Wheelchair – Marco Balsamo

Production: TeamTO (France)

Aya in the Desert - Julia Horrillo

Cartoon Movie unveils a line-up of 50 animated feature projects

Production: Alhena Production (Spain)

Before They Were Gods - Måns Mårlind

https://cineuropa.org/en/newsdetail/487717/

Production: Mylla Films (Sweden), Brokendoll (Sweden) Qvisten Animation (Norway), Parce Que Films (Canada), Elastic Film (UK)

Europe -

Billie Beat - Nina Wels, Timo Berg

Production: Little Dream Entertainment (Germany)

14:25

Before They Were Gods - Måns Mårlind

Production: Mylla Films (Sweden), Brokendoll (Sweden) Qvisten Animation (Norway), Parce Que Films (Canada), Elastic Film (UK)

Billie Beat - Nina Wels, Timo Berg

Production: Little Dream Entertainment (Germany)

Caruso – A Love Opera – Christian De Vita

Production: Studio Campedelli (Italy)

Cosmo Princess - Quentin Rigaux

Production: Sacrebleu Productions (France)

DREAMERS - The Hunt for Shadowclaw – Christopher Jenkins

Production: Parapictures Film Production (Germany), Falcon Features (Canada), Kickstart Entertainment (Canada), Epsilon Film (Germany)

Dreamwalker – Rudi Mertens

Production: Vivi Film (Belgium), Parmi les lucioles films (France), Lighthouse Studios (Ireland)

Ejo - Jacek Rokosz

Production: Animoon (Poland), Special Touch Studios (France), Basement Animation Company (Nigeria)

Family Squad - Kostiantyn Fedorov

Production: Animagrad (Ukraine), Telescope Animation Studios (Germany), PFX (Czech Republic), Fiilin Good Films (Finland)

Flick! – Nicolas Pegon

Production: WIZZ (France), FOST (France)

Gingerbread Town - Will Ashurst, Kjersti G. Steinsbø

Production: Den siste skilling (Norway), Knudsen Pictures (Germany), Artichoke (Slovakia), Ink & Light (Ireland)

Hakim’s Odyssey – Patrick Imbert

Production: Folivari (France), Solab Films (France)

Cartoon Movie unveils a line-up of 50 animated feature projects https://cineuropa.org/en/newsdetail/487717/

Halloween vs. Day of the Dead – Celso García Cartoon

Production: Studio 100 International (Germany), 3Doubles Producciones (Spain)

4 van 7

Kigali Night – Samuel Lajus

Production: Parmi les lucioles films (France), Eklektik Productions (Belgium), Melusine Studio (Luxembourg)

Kindred Spirits – Tomm Moore

Production: Cartoon Saloon (Ireland), Folivari (France)

Kokum – Hassan Yola

Production: Paul Thiltges Distributions (Luxembourg), Special Touch Studios (France)

Night Tram – Michaela Pavlátová

21/01/2026, 14:25

Production: Negativ (Czech Republic), Sacrebleu Productions (France), BFilm (Slovakia), ArtShot (Lithuania)

Kindred Spirits – Tomm Moore

Production: Cartoon Saloon (Ireland), Folivari (France)

Kokum – Hassan Yola

Production: Paul Thiltges Distributions (Luxembourg), Special Touch Studios (France)

Night Tram – Michaela Pavlátová

Production: Negativ (Czech Republic), Sacrebleu Productions (France), BFilm (Slovakia), ArtShot (Lithuania)

Nina and the Goddess of Thunder – Kamil Polak

Production: New Europe Film Sales (Poland), Fabrique d'Images (Luxembourg), Fantabulous (France), Human/PFX (Poland)

Nine Lives Left – Zacharias Mavroeidis

Production: Wild At Heart (Greece)

Once Upon an Egg – Nina Gantz

Production: Keplerfilm (Netherlands)

Pangea – Simon Rouby

Production: Miyu Productions (France)

Pedigree – Greig Cameron, Samantha Cutler

Production: Triggerfish (Ireland)

Saima: Scenes from a Midlife Crisis – Chintis Lundgren, Draško Ivezić

Production: Alexandra Film (Estonia), Adriatic Animation (Croatia), Avec ou sans Vous (France)

Silence Sometimes – Álvaro Robles

Production: Filmakers Monkeys (Spain), Ánima Estudios (Mexico)

The Heart of the Djembe – Mathieu Vavril

Production: Cottonwood Media (France), Booya Studio (Ivory Coast), Umedia (Belgium)

Cartoon Movie unveils a line-up of 50 animated feature projects

The Wild and the Tame – Tibor Bánóczki, Sarolta Szabó

Production: Domestic Infelicity (Hungary)

5 van 7

https://cineuropa.org/en/newsdetail/487717/

21/01/2026, 14:25

Tomi & Erika – Péter Palátsik, Matthias Bruhn

Production: Trickstudio Lutterbeck (Germany), Banana Tree Film (Germany)

Projects in Production

Betty Baloon – Puk Grasten

Regner Grasten Filmproduktion (Denmark), A. Film Production (Denmark)

Blaise - Dimitri Planchon, Jean-Paul Guigue

Production: KG Gravas (France)

Detective Kibbles - Benoît Delépine, Antoine Robert, Frédéric Felder

Production: La Station Animation (France)

IGI – Natia Nikolashvili

Production: 20 Steps Animation (Georgia), Heretic (Greece)

Monster Mia – Verena Fels

- Europe -

Production: arx anima animation studio (Austria), Peng-Boom-Tschak Films (Germany), arx anima MD (Germany), Arxlight Pictures (Spain)

Production: KG Gravas (France)

Detective Kibbles - Benoît Delépine, Antoine Robert, Frédéric Felder

Production: La Station Animation (France)

IGI – Natia Nikolashvili

Production: 20 Steps Animation (Georgia), Heretic (Greece)

Monster Mia – Verena Fels

Production: arx anima animation studio (Austria), Peng-Boom-Tschak Films (Germany), arx anima MD (Germany), Arxlight Pictures (Spain)

Pirate Mo and the Legend of the Red Ruby – Florian Westermann

Production: Ulysses Filmproduktion (Germany), Letterbox Filmproduktion (Germany), arx anima Animation Studio (Austria), Arxlight Pictures (Spain)

Starseed – Anca Damian

Production: Aparte Film (Romania), Special Touch Studios (France), Yzanakio (Canada), Wrongmen (Belgium), Known Associates Group (South Africa)

In Sneak Preview

Jim Queen – Marco Nguyen, Nicolas Athané

Production: Bobbypills (France), Umedia (Belgium)

Québec-Canada Land in Europe Projects

Jane, the Fox and Me – Director TBC

Production: Embuscade Films (Canada)

Marguerite and the Duke – Director TBC

Cartoon Movie unveils a line-up of 50 animated feature projects

Production: 10ᵗʰ Ave Productions (Canada)

Puddle Jumpers – Director TBC

6 van 7

Production: Flying Kraken Creative Studios (Canada)

Shanghai Ballade – Director TBC

Production: Lofty Sky Pictures (Canada)

The Mountain of Dreams – Director TBC

Production: Carpediem Film & TV (Canada)

The President’s Daughter – Director TBC

Production: Quarterlife Crisis Productions (Canada)

https://cineuropa.org/en/newsdetail/487717/

21/01/2026, 14:25

REPORT : Cartoon Movie 2026

Davide Abbatescianni

09/03/2026 - Quelques détails sur six projets intrigants qui ont été présentés cette année au forum Cartoon Movie, organisé à Bordeaux du 3 au 5 mars

Cet article est disponible en anglais.

The 28th edition of Bordeaux’s Cartoon Movie, the pitching and co-production event dedicated to European animated features, unspooled from 3-5 March. Here, we present details of six interesting projects that were introduced at this year’s gathering.

Riamise by Francesco Forti

Riamise – Francesco Forti (Italy/France/Japan)

Forti’s debut feature is a 2D animated action-adventure thriller produced by Italy’s IBRIDO Studio with France’s Something Big and Japan’s Studio 4°C. Set in a drought-ravaged city where water has vanished and survival depends on mysterious “blue crystals”, the story follows Jona and Kala, two teenagers who uncover the truth behind the system controlling their society and set out to change its fate. The €3.2 million project, currently at the first-draft script stage and in early visual development, is targeting a 2029 delivery while seeking co-producers, buyers and investors. The filmmakers say the movie aims “to inspire young people to believe in their ideas” while tackling themes of crime and ecology through a dynamic visual style blending European street-art influences with Japanese animation.

Betty Balloon – Puk Grasten (Denmark)

This upcoming pre-school animated feature is being produced by Regner Grasten Filmproduktion with A. Film Production as co-producer, whilst Copenhagen-based LevelK has boarded the project for world sales. Currently in production and slated for a Danish theatrical release in October 2026, the pic centres on Betty, an imaginative four-year-old balloon whose family must adjust when a cactus family moves in next door, prompting an unlikely friendship between Betty and Caj Cactus. As LevelK CEO Tine Klint notes, the story shows how “their creative minds make the journey fun”, while producer Regner Grasten says the relationship symbolises “openness and acceptance”. The project is backed by the Danish Film Institute, TV2 Denmark, VestDansk Filmpulje and the Nordisk Film & TV Fond, with a TV series, books and merchandising also in development.

- Europe -

Presented as a sneak preview and warmly welcomed by the industry audience in attendance, this

Betty Balloon by Puk Grasten (© Regner Grasten Filmproduktion)

Jim Queen by Marco Nguyen and Nicolas Athané

Jim Queen - Marco Nguyen, Nicolas Athané (France/Belgium)

Jim Queen by Marco Nguyen and Nicolas Athané

Jim Queen - Marco Nguyen, Nicolas Athané (France/Belgium)

Presented as a sneak preview and warmly welcomed by the industry audience in attendance, this 2D and 3D animated feature penned by the directors with Simon Balteaux and Brice Chevillard is being staged by Bobbypills (France) with Umedia (Belgium) as co-producer. Targeting young adults and adult audiences, the 90-minute movie unfolds in a Parisian gay community shaken by “Heterosis”, a mysterious virus that turns gay men straight. In detail, the plot zooms in on Jim, the six-packed leader of the Gym Queens, who suddenly becomes an outcast and teams up with newly out Lucien to search for a cure before the epidemic erases their community. International sales are being handled by Global Constellation.

Blaise by Dimitri Planchon and Jean-Paul Guigue (© KG Productions)

Blaise - Dimitri Planchon, Jean-Paul Guigue (France)

This animated feature is adapted from Planchon’s own comic-book series, published by Glénat. Produced by Alexandre Gavras for KG Productions, the film is currently in post-production and has been picked up by Best Friend Forever for international sales, whilst The Jokers Films will release it in France. The story centres on the dysfunctional Sauvage family and their introverted teenage son, Blaise, whose life is thrown into turmoil when he falls for a girl named Josephine. The voice cast includes Léa Drucker, alongside Jacques Gamblin, Timéo and Nina BlancFrancard. According to Best Friend Forever, the film plays like “the epitome of the idiot plot applied to family comedy”, blending awkward teenage nostalgia with offbeat humour. The clips shown at Cartoon Movie prompted great laughter and depicted a wide array of crazy characters in humorous situations, enriched by a pinch of satire and cringe comedy.

- Europe -

Kindred Spirits by Tomm Moore

Kindred Spirits - Tomm Moore (Ireland/France)

The pic is helmed by Tomm Moore (best known for the animated hits Song of the Sea [+lire aussi : critique bande-annonce interview : Tomm Moore fiche film] and Wolfwalkers [+lire aussi : critique bande-annonce fiche film]), and written by Shelley Dennis and Will Collins. Produced by Cartoon Saloon (Ireland) and co-produced by Folivari (France), the 90-minute family adventure is currently in development, and seeking distributors, pre-sales and equity partners. Set in 1847, the story follows Irish refugee child Mara and Choctaw youth Tushka, who embark on a perilous journey across the USA while watched over by the ghost of Mara’s brother Dan. Exploring the historic bond between the Irish and Choctaw nations, the filmmakers aim to create “an emotional, uplifting journey” as well as “a celebration of that friendship and kinship”, blending historical drama with folklore and spiritual elements. Production is tentatively slated to begin in 2027.

USA while watched over by the ghost of Mara’s brother Dan. Exploring the historic bond between the Irish and Choctaw nations, the filmmakers aim to create “an emotional, uplifting journey” as well as “a celebration of that friendship and kinship”, blending historical drama with folklore and spiritual elements. Production is tentatively slated to begin in 2027.

Caruso - Christian De Vita (Italy)

The 2D animated feature is being staged by Studio Campedelli, with Anne-Sophie Vanhollebeke attached as producer. Currently in development, the roughly 100-minute film offers a stylised portrait of legendary opera tenor Enrico Caruso (1873-1921), structured around 17 musical tracks drawn from the singer’s first recordings, recently remastered. Each sequence is interpreted by a different award-winning Italian animation artist, creating what the filmmakers describe as “an amazing orchestra of award-winning artists”, including concept artist Thomas Campi, composer Carlo Siliotto and actor Tony Servillo, who provides Caruso’s voice. The €4.8 million project has secured about 60% of its financing in Italy and Denmark, and is currently seeking the remaining 30% from international partners.

Caruso by Christian De Vita (© Studio Campedelli/CDV)

CARTOON 2026 Cartoon Movie

REPORT: Québec and Canada Spotlight @ Cartoon Movie 2026

by DAVIDE ABBATESCIANNI

CARTOON 2026 Cartoon Movie REPORT: Québec and Canada Spotlight @ Cartoon Movie 2026

05/03/2026 - We take a closer look at the six projects pitched at the Bordeaux-based gathering as part of this year’s country-in-focus initiative

Day 2 of Cartoon Movie (Bordeaux, 3-5 March) put Québec and Canada squarely in the spotlight with the launch of the “Québec-Canada Land in Europe: A Space for Creation” initiative, framed as a new co-production bridge at a time of market pressure on both sides of the Atlantic. A dedicated session showcased six animated features at concept-todevelopment stage, pitched to European partners to foster financing, sales and distribution conversations. In this article, we zoom in on each project.

A moment during the pitch for Shanghai Ballade (© Cartoon)

Jane, the Fox and Me – TBC (Canada/Québec)

written

Producer Nicolas Dufour-Laperriere, of Embuscade Films, presented this feature-length adaptation of Fanny Britt and Isabelle Arsenault’s graphic novel as a sensitive coming-of-age story about bullying, literature and friendship, set between 1980s Montréal and a Victorian Jane Eyre imaginary. The project was positioned as a youth film designed to trust in younger audiences’ intelligence, using contrast-rich visuals inspired by Arsenault and potentially a hybrid technique. Embuscade Films said the screenplay was being written by Britt herself, while discussions were ongoing around the director and artistic direction. With early graphic research and animation tests starting, the team floated a preliminary budget of around €6 million and outlined 2026-2027 as a period for tests and financing, ahead of production later in the

floated a around financing, Cookies settings decade. A two-minute Q&A followed the pitch. The team billed the effort as “an ode to imagination, literature and friendship”.

Marguerite and the Duke – TBC (Canada/Québec)

10ᵗʰ Ave Productions introduced Marguerite and the Duke as a modern fairy tale built around generational conflict and an update of old traditions for contemporary life. The story follows Margaret, who rejects her inheritance and leaves her castle to travel with her boyfriend, only to discover that her dragon has secretly followed her — creating escalating chaos when it goes missing and proves ill-suited to life without “braised ham”. In parallel with the road-movie antics, the Duke is torn between a ghostly ancestor’s rigid counsel and Dorothy, a pragmatic governess urging adaptation to the 21st century, which nudges him into increasingly odd decisions as he tries to rebuild the bond with his daughter. The project was pitched as an 80-minute 3D family feature in development, framed to appeal to broad audiences through humour, warmth and a contemporary take on reconciliation.

Puddle Jumpers – Rose-Ann Tisserand, Greg Huculak (Canada)

Vancouver-based Flying Kraken described Puddle Jumpers as an 80-minute coming-of-age fantasy action-adventure for teens and tweens, rooted in a teenage girl’s inner life and the pressure of growing up amid constant comparison. Executive producer/co-creator Rose-Ann Tisserand and creative director Greg Huculak outlined how 14-year-old Bryn’s graphic novel characters spill into the real world after a mysterious puddle brings them to life, turning wish fulfilment into a crisis when Bryn’s self-doubt manifests as a demon-like force. The filmmakers framed the project as a story about “redemption, resilience, sacrifice and empowerment”, with a tone balancing darkness and trust in young audiences. With the work still at

A moment during the pitch for Shanghai Ballade (© Cartoon)

Ave Productions introduced Marguerite and the Duke as a modern fairy tale built around generational conflict and an update of old traditions for contemporary life. The story follows Margaret, who rejects her inheritance and leaves her castle to travel with her boyfriend, only to discover that her dragon has secretly followed her — creating escalating chaos when it goes missing and proves ill-suited to life without “braised ham”. In parallel with the road-movie antics, the Duke is torn between a ghostly ancestor’s rigid counsel and Dorothy, a pragmatic governess urging adaptation to the 21st century, which nudges him into increasingly odd decisions as he tries to rebuild the bond with his daughter. The project was pitched as an 80-minute 3D family feature in development, framed to appeal to broad audiences through humour, warmth and a contemporary take on reconciliation.

Puddle Jumpers – Rose-Ann Tisserand, Greg Huculak (Canada) Vancouver-based Flying Kraken described Puddle Jumpers as an 80-minute coming-of-age fantasy action-adventure for teens and tweens, rooted in a teenage girl’s inner life and the pressure of growing up amid constant comparison. Executive producer/co-creator Rose-Ann Tisserand and creative director Greg Huculak outlined how 14-year-old Bryn’s graphic novel characters spill into the real world after a mysterious puddle brings them to life, turning wish fulfilment into a crisis when Bryn’s self-doubt manifests as a demon-like force. The filmmakers framed the project as a story about “redemption, resilience, sacrifice and empowerment”, with a tone balancing darkness and trust in young audiences. With the work still at concept stage, the team said it was seeking writers, development finance, distributors, sales agents and co-production partners, while also eyeing publishing potential and even a potential trilogy pathway. A tentative budget of around €7 million was mentioned as an early benchmark.

Shanghai Ballade – Jason Loftus, Masha Loftus (Canada)

The directorial duo pitched Shanghai Ballade as a festival-driven historical drama for culturally engaged adult audiences, using shifting animation styles to mirror the aesthetic ruptures of China’s Cultural Revolution. Drawing on their experience from Eternal Spring, the duo argued that animation was essential because political pressure in that era operated through art itself, forcing creators to abandon classical forms for propaganda aesthetics. The film, now in development, follows pianist Gu Zhen from wartime Shanghai into the conservatory, love and artistic rivalry, and ultimately a world where classical music becomes dangerous – with three visual “worlds” (Art Deco Shanghai, brushstroke memory/tradition, and a bold propaganda look) overtaking one another as ideology tightens. The project was presented as a European-Canadian co-production proposition, with meaningful creative work to share across animation, post and music, and an intention to voice in Mandarin while mixing 2D and 3D (made in Blender). The team said Canadian support was in place (via Telefilm Canada and Ontario Creates), and they were seeking a European minority partner for roughly €800,000-€1 million, alongside a sales agent.

The Mountain of Dreams – Nicola Lemay (Canada/Québec)

Carpe Diem Film & TV framed The Mountain of Dreams as an ecological, humorous fantasy in 3D, aimed at children. It is centred on 12-year-old Lili, who retreats into drawing after her father’s death. When a drilling company threatens to expropriate the mountain community, Lili tumbles into an underground sand world where survival depends on extracting a black substance that fuels a system trapping rain clouds and keeping people dependent. The pitch emphasised a trio dynamic (Lili, a charming-but-cowardly sand prince, and a comedic ally) expanding into a resistance story about solidarity, courage and trust, culminating in the destruction of the machine controlling the storm clouds. Carpe Diem said designs were in progress and it hoped to produce a pilot in the coming months, with financing across 2026-2027 and a production start targeted for the end of 2027. The team cited a €9.5 million budget and said it was seeking co-producers for 30%-35% plus pre-sales; Pink Parrot was named as the international sales agent.

The President’s Daughter – Ian Keteku (Canada) Quarterlife Crisis Productions introduced this hand-drawn feature as the true story of Samia Nkrumah, the daughter of Ghana’s first president, Kwame Nkrumah, against the geopolitical turbulence of independence-era West Africa. Producer Trevor Stewart (with a background across major US animation titles) and writer-helmer Ian Keteku (a Ghanaian-Canadian filmmaker and former poetry slam champion) framed the narrative as a “princess tale” flipped into a fall-from-grace journey: a child raised in a presidential palace is thrust into upheaval as coups, Cold War interference and exile fracture her family. Keteku said meeting the real Samia (now in her mid-60s) shaped the emotional core, centred on a daughter’s longing for connection with a father consumed by nation-building. The pitch highlighted early concept art by Ghanaian and GhanaianNorth American artists, and an ambition to define what a Ghanaian-inspired animation aesthetic could look like through tactile 2D traditions with a contemporary sensibility. The team positioned the budget as under €10 million (closer to €7 million), and said it was seeking co-production partners, distributors and investors, citing politically resonant hand-drawn references such as Persepolis and The Breadwinner . “We’re going to pass a plate around […] so we can pay for more concept art,” the team joked. [+] [+]

Cartoon Movie awards Tributes to Allah Is Not Obliged producers, as well as Les Films du Préau and director Reza Memari

Davide Abbatescianni

06/03/2026 - The Eurimages Co-Production Development Award has gone to Acorn’s Adventure, a Czech-German co-production helmed by Filip Mašek

l-r: Adrien Chef, Anne-Laure Guégan, Annemie Degryse and Sébastien Onomo (winners of Producers of the Year for Allah Is Not Obliged); Les Films du Préau’s Emmanuelle Chevalier (winner of Distributor of the Year); and Reza Memari (winner of Director of the Year for The Last Whale Singer) (© Cartoon)

The European animation industry has once again gathered to celebrate its achievements at Cartoon Movie (3-5 March), the biggest pitching and co-production event dedicated to animated films, which wrapped yesterday in Bordeaux. Decided on through votes cast by the industry professionals attending the 28th edition, the Cartoon Tributes honour companies and individuals whose contributions have significantly enriched the sector over the last year.

The Producer of the Year Award went to Special Touch Studios (France), Paul Thiltges Distributions (Luxembourg), Lunanime and Need Productions (Belgium), and Yzanakio (Canada) for their co-production work on Allah Is Not Obliged [+see also: film review trailer film profile], the feature debut by Zaven Najjar. Adapted from Ahmadou Kourouma’s celebrated novel, the animated film follows a Guinean orphan forced to become a child soldier amid the conflicts of West Africa. The project was first presented in development at Cartoon Movie in 2018, later had its world premiere at Annecy and opened in French cinemas on 4 March.

interview: Kristina Dufková film profile], The Gruffalo, The Gruffalo’s Child [+see also: trailer

The Distributor of the Year accolade went to Paris-based Les Films du Préau, an independent distribution company specialising in quality films for young audiences. Founded in 2000 by Emmanuelle Chevalier and Marie-Agnès Bourillon, the company has built up a catalogue of more than 200 titles, including Living Large [+see also: film review trailer interview: Kristina Dufková film profile], The Gruffalo, The Gruffalo’s Child [+see also: trailer film profile] and Petite Casbah, consolidating its reputation as one of France’s key distributors in the children’s and family segment.

Meanwhile, the Director of the Year honour was bestowed upon Reza Memari for The Last Whale Singer, his second feature, following Richard the Stork [+see also: trailer film profile] (see the interview). Targeting family audiences, the animated fantasy flick follows Vincent, the orphaned son of the last Whale Singer, who must overcome his fears and discover his own voice in order to help save the oceans. The project has maintained a long-standing connection with Cartoon Movie, having been presented at different stages – from concept in 2018 to development in 2020 and production in 2025 – and was staged as a co-production between Germany, the Czech Republic and Canada. The pic has already been sold in over 30 territories.

In addition to the Tributes, the Eurimages Co-Production Development Award was presented to Acorn’s Adventure, directed by Filip Mašek and produced by Pure Shore (Czech Republic) in co-production with Fabian&Fred (Germany). According to the jury, the project stood out for the originality of its storytelling, inspired by the director’s experience working with children and their curiosity about the natural world. The jury also praised the project’s joyful humour, its imaginative tone and its innovative animation technique, which brings handcrafted characters to life on screen.

The awards ceremony took place at the Palais des Congrès, during the lunch break. Over the past few days, Cartoon Movie has showcased dozens of new animation projects from across Europe and beyond, reaffirming its role as a key platform for the development and financing of animated features.

Here is the full list of this year’s award winners:

Producers of the Year

Special Touch Studios (France), Paul Thiltges Distributions (Luxembourg), Lunanime, Need Productions (Belgium), Yzanakio (Canada) – Allah Is Not Obliged [+see also: film review trailer film profile]

Distributor of the Year

Les Films du Préau (France)

Director of the Year

Reza Memari – The Last Whale Singer (Germany/Czech Republic/Canada)

Eurimages Co-Production Development Award

Acorn’s Adventure – Pure Shore (Czech Republic), Fabian&Fred (Germany)

Director: Filip Mašek

CARTOON 2026 Cartoon Movie

Europa Distribution presents four case studies at Cartoon Movie

by VALENTINA SERRA - EUROPA DISTRIBUTION

09/04/2026 - The network analysed the releases of Arco, Animal Tales of Christmas Magic, Hola Frida and Tafiti –Across the Desert in various markets

A moment from the panel

This March, Europa Distribution reaffirmed its collaboration with Cartoon Movie, a partnership that has been ongoing for over fifteen years. They hosted the recurring case study workshop on animation distribution at the 28th edition of the European animation co-production and pitching event, which took place in Bordeaux between 3 and 6 March 2026. During the workshop, close to 35 film distributors from all over the world attended a closed session in which five industry professionals shared case studies on recent animated film releases. The session was designed to facilitate the exchange of insights and practical strategies, particularly regarding audience engagement, marketing approaches, and new promotional methods for positioning European animated films within markets that are increasingly competitive, especially on this segment.

Vanessa Ciszewski, founder of Luftkind Filmverleih in Germany, opened the session by discussing the release of Animal Tales of Christmas Magic, an animated project that the distribution company also co-produced.

example,

directly appealing Cookies settings

festive and animal-centred storytelling approach. The film is co-directed by six emerging female filmmakers from around the world and consists of five visually distinct chapters connected through a shared narrative theme. To emphasize this peculiar structure, the marketing team created individual visual identities for each story, highlighting the diversity of the narrative segments. They also created a modular, question-based campaign designed to engage different audience groups. The communication strategy revolved around five reasons to watch the film, extending the modular campaign alongside trailers, behind-the-scenes content, special preview screenings, and merchandising.

Since Luftkind Filmverleih was a relatively new company at the time of the co-production, they had to invest heavily on promotion and marketing from the very beginning. For example, in Germany the title was directly changed to Weihnachten der Tiere, which loosely translates to Animal’s Christmas, to sound more appealing to the German audience and reflect the

The digital campaign was particularly strong and included collaborations with “mom influencers”, proving once again the importance to target parents as well as children. The key question guiding the strategy was: “How do we appeal to little kids and convince families to take them to the cinema?”. The campaign was successful: positioning the film as “the perfect film for a first cinema visit”, combined with the Christmas theme, proved highly effective.

The second presentation of the day was given by Adeline Margueron, responsible for distribution at Le Parc Distribution, part of the cultural centre “Les Grignoux” in Belgium. The case study focused on the release of Hola Frida, a film by Karine Vézina and André Kadi, released in the French speaking part of Belgium on 2 July, 2025. Since the production was in French, the Belgian distributor relied heavily on promotional materials provided by the French company Haut et Court, which had distributed the movie in France earlier that year. Despite the fact that they used existing materials, the Belgian distributor efficiently adapted the communication strategy to their own territory, while maintaining visual coherence with the film’s original campaign.

communication strategy revolved around five reasons to watch the film, extending the modular campaign alongside trailers, behind-the-scenes content, special preview screenings, and merchandising.

The campaign included partnerships with Auvio Kids TV and Le Ligueur Magazine, but one of the most distinctive elements of the marketing strategy was engaging disability communities directly. Le Parc Distribution developed a partnership with EOP!, the association that organizes the Extraordinary Film Festival, making accessibility a central topic for the release.

The Distributor also provided Hearing Impaired and Visual Impaired versions of the film and organized several HI-VI screenings in different theatres. The film benefited from participation in the educational programme Écran Large sur Tableau Noir, which connects cinema distribution with schools and cinemas. Within this framework, school matinées were described as the “secret ingredient” of the release strategy by Margueron.

Next, Richard Reiter, film distributor at Filmladen Filmverleih in Austria, shared the release strategy for Tafiti – Across the Desert by Nina Wels. The film was released on 4 September, 2025, coinciding with the first week of school in Austria after the summer break, as its summer theme well suited the period.

The release strategy relied on traditional prints and advertising, ensuring strong visibility for the film both in cinemas and in public spaces. A particularly original element of the campaign was a major partnership with the sunscreen brand Solero, which enabled a large cross-promotional campaign while sharing costs and giving the film extra visibility. Through this collaboration, advertisements were placed in outdoor swimming pools, as well as in pharmacies and stores, during all summer. Another original element of the distribution strategy included the organization of numerous special events designed to engage specific communities. One notable example was a screening initiative aimed at the Ukrainian community living in Vienna, as the distributor decided to propose a Ukrainian-language version of the film. Reiter concluded that the release was successful in terms of numbers.

Tafiti – Across the Desert was also distributed by MCF MegaCom Film and the founder of the distribution company, Igor Stanković, shared insights into the release strategy of the film in the Adriatic region, a particularly complex territory to work in, as the release involved five different countries and languages. The film was released in Serbia, Montenegro, Croatia, Bosnia and Herzegovina and North Macedonia with wide release, positioning it as a must-see for family audiences.

The marketing for the film combined online, radio, outdoor and PR channels, creating a multi-platform presence across the region. The company approached the film as if it was a major studio release, investing heavily in the promotional campaign, particularly in high-quality dubbing. They hired Boda Ninković, a well-known actor in the region, to voice one of the characters, using the celebrity’s name as a promotional tool. The goal was to position the film in the market with the same visibility and prestige typically associated with large international animated productions. As Stankovic noted, “if you are not oriented toward children, who are you oriented toward? They are the future of cinema.”

In terms of results, the film achieved solid admissions. However, the distributor also stressed that the investment required for this type of release is considerable, particularly producing five different dubbed versions to cover the linguistic diversity of the region.

The last speaker of the workshop was Michal Dvořák from Zero Gravity who also presented their release strategy for Arco, acquired by the Czech distribution company shortly after Cannes. The distributor saw mainstream potential in the film and expected significant media coverage.

Stanković also presented the release strategy for the Oscar-nominated film Arco by Ugo Bienvenu, which had just been released at the time of the presentation, although it had been acquired two years earlier, based on its script. The release strategy for Arco was built around a festival-first positioning, establishing the film as a premium cultural title before expanding into a wide regional release. Festival screenings played a key role in shaping perception, aligning the film with curated programming, educated audiences, and strong media visibility. As a matter of fact, Arco was selected as the opening title of the 21st KidsFest, Serbia’s premier children’s film festival. Moreover, the film also screened at the Festival of Tolerance, a prominent cultural platform held in Zadar.

The marketing campaign relied heavily on social media, although results varied depending on the platform. For example, on Facebook the campaign encountered a wave of homophobic comments triggered by the presence of rainbow imagery in the film’s visual identity. For this reason, the marketing focused on three main thematic areas: friendship, family and spectacle/adventure. In contrast, TikTok and Instagram proved to be much more effective, reaching younger viewers and generating more positive engagement with the campaign.

Apart for children and their families, Zero Gravity targeted anime communities and adults passionate about animation in general, mainly because of the Ghibli Studio influence on the filmmakers of Arco. The dubbed versions aimed at children ultimately performed better than the screenings targeting animation enthusiasts. Although the distributor had hoped for slightly higher numbers overall, the final outcome was still considered positive.

In conclusion, the case studies presented during the workshop highlighted the complexity and diversity of animation distribution strategies across different European territories. Despite differences in market size, language, and audience structure, several common patterns emerged, particularly the importance of clearly defining target audiences, building strong partnerships, and developing creative marketing strategies tailored to each film’s identity. The examples discussed demonstrated that successful distribution does not rely solely on large budgets, but also on strategic positioning, early marketing planning, community engagement, educational initiatives, and cross-promotional collaborations.

In addition to the workshop activities, members of Europa Distribution also took part in the pitching sessions and networking events organised during Cartoon Movie, using the opportunity to further consolidate their involvement in the animation sector.

ED will continue its role as network and think tank in upcoming key industry events later in the year, such as Focus Asia in Udine, New Nordic Films in Haugesund, Venice Production Bridge and the San Sebastián International Film Festival. More information can be found on Europa Distribution’s website

BasededonnéesAnalysedemarchéNewsCritiquesInterviewsDossiersfestivalsServicesPlus

CARTOON 2026 Cartoon Movie

Filip Mašek, Kristina Husová et Fabian Driehorst • Réalisateur et producteurs d'Acorn's Adventure

CARTOON 2026 Cartoon Movie

“La société attend souvent de nous qu'on se définisse très vite, à travers un métier, un talent ou un rôle précis, mais cette quête prend du temps”

par DAVIDE ABBATESCIANNI

Filip Mašek, Kristina Husová et Fabian Driehorst • Réalisateur et producteurs d'Acorn's Adventure

“La société attend souvent de nous qu'on se définisse très vite, à travers un métier, un talent ou un rôle précis, mais cette quête prend du temps”

17/03/2026 - L'équipe qui a remporté le Prix Eurimages au développement de la coproduction de Cartoon Movie nous parle de son nouveau projet, qui mêle humour, imagination et nature

par

Cet article est disponible en anglais.

Presented at this year’s Cartoon Movie (3-5 March), where it won the Eurimages Co-Production Development Award (see the news), Acorn’s Adventure is a Czech-German animated project that blends humour, imagination and Mother Nature in a story about identity and belonging. Cineuropa spoke with director Filip Mašek and producers Kristina Husová (Pure Shore) and Fabian Driehorst (Fabian&Fred) about the origins of the project, its distinctive visual approach and the European momentum it is currently gaining.

Cineuropa: Acorn’s Adventure revolves around a protagonist who doesn’t yet know his purpose. What inspired this premise, and how did the character of Quido come to life?

Presented at this year’s Cartoon Movie (3-5 March), where it won the Eurimages Co-Production Development Award (see the news), Acorn’s Adventure is a Czech-German animated project that blends humour, imagination and Mother Nature in a story about identity and belonging. Cineuropa spoke with director Filip Mašek and producers Kristina Husová Shore) and Fabian Driehorst (Fabian&Fred) about the origins of the project, its distinctive visual approach and the European momentum it is currently gaining.

Filip Mašek: I’ve always been fascinated by how uncomfortable the question “What do you do?” can feel when you’re still

Cineuropa: Acorn’s Adventure revolves around a protagonist who doesn’t yet know his purpose. What inspired this premise, and how did the character of Quido come to life?

Filip Mašek: I’ve always been fascinated by how uncomfortable the question “What do you do?” can feel when you’re still

section menu

in the process of discovering who you are. Society often expects us to define ourselves very quickly, by a job, a talent or a clear role. But for many people, across all generations, that search takes time. That idea became the starting point for Quido. He is a character created by a child from an acorn, but unlike everyone else in the village, he arrives without a clear purpose. In Resinland, every character normally has a defined role imagined by the children who created them. Quido is the first one who simply exists without one, which makes everyone around him uneasy.

Through his journey, the village gradually learns that it’s okay not to have everything figured out yet. In the end, Quido’s answer to the question “Who are you?” is very simple: “I’m happy to be here, and I think that’s enough.”

The film takes place in Resinland, a village shaped by children’s imagination. How did you approach building this world visually and narratively?

FM: The visual concept comes directly from how children play in nature. When kids are in the forest, they naturally start building little houses, characters and entire imaginary worlds from whatever they find – acorns, sticks, stones or pieces of bark.

- Europe -

In the film, we imagine that once the children leave the forest, everything they created comes to life. The village of Resinland then has to function exactly according to the children’s imagination. So, if a rock has a smiley face drawn on it, it

l-r: Filip Mašek, Kristina Husová and Fabian Driehorst

That idea became the starting point for Quido. He is a character created by a child from an acorn, but unlike everyone else in the village, he arrives without a clear purpose. In Resinland, every character normally has a defined role imagined by the children who created them. Quido is the first one who simply exists without one, which makes everyone around him uneasy.

The film takes place in Resinland, a village shaped by children’s imagination. How did you approach building this world visually and narratively?

Visually, I try not to over-design nature. The goal is to keep the materials as authentic as possible and embrace their imperfections. That rawness is important because it reflects the spontaneity of children’s creativity. This approach also connects to the core idea of the film: how children can create entire universes from the simplest things they find outside in nature.

The project combines 3D animation and motion capture. What led you to adopt this hybrid technique, and what does it bring to the storytelling?

FM: When children build something, it’s rarely perfect. Their creations are messy, spontaneous and full of unexpected details. I wanted the animation technique to preserve that spirit, rather than smooth it out. That’s why we combine 3D scanning with motion capture. With scanning, we can capture real objects from nature and use them directly as the foundation for characters and environments. Motion capture adds another layer of unpredictability to the animation.

It’s not always perfectly precise, but that’s part of the charm. Sometimes, unexpected “mistakes” happen – for example, when a certain motion from the hands affects the legs in an unusual way. Those little accidents often create movements that feel strange, but very funny and alive. In a way, the whole animation pipeline mirrors the way children play: it leaves space for experimentation, surprises and imagination.

The film is a Czech-German co-production. How did this come about?

Kristina Husová: The collaboration began when we met the team from Fabian&Fred at Animation Production Days in Stuttgart in 2024. At that time, it was one of the first industry platforms where we got to introduce the project internationally, and we were actively looking for a co-production partner.

We immediately connected over the project’s tone, and its focus on children’s imagination and nature. Since then, we’ve been developing the film together as a Czech-German co-pro. The collaboration has felt very organic from the beginning, allowing us to combine different creative perspectives and production experiences.

What kind of feedback did you receive while pitching the project at Cartoon Movie, and how did the industry react to the concept?

Fabian Driehorst: Presenting Acorn’s Adventure at Cartoon Movie was a valuable experience. The response from the audience and industry professionals was extremely encouraging. Many people reacted strongly to the central idea of a story inspired by children’s imagination and their relationship with nature, which seems to resonate across different countries and cultures.

Cartoon Movie also gave us the opportunity to meet with sales agents, distributors and fellow producers. These conversations were very helpful in understanding how the film might travel internationally and how different markets perceive the project.

Winning the Eurimages Co-Production Development Award is a major boost at this stage. How will this support impact the next steps of the project?

FD: Receiving the award is a significant milestone for the project. It’s a strong signal that the story resonates internationally and reinforces the direction we’ve chosen for the film’s next steps.

The project has been steadily building European momentum across key industry platforms, and this recognition arrives at a very important moment. Acorn’s Adventure recently received production support from the Czech Audiovisual Fund, and we are currently continuing the international financing process on the German side. The Eurimages Award will help us bridge this crucial stage between development and production, while also increasing the project’s visibility within the European animation industry.

Five Standout Feature Pitches From Cartoon Movie 2026

Kévin Giraud

Kévin Giraud

EventsFeature Film

Dark Comedy, Dystopian Sci-Fi, And Stop-Motion Pigeons: Our Favorite Pitches

From Cartoon Movie 2026

Dark Comedy, Dystopian Sci-Fi, And Stop-Motion Pigeons: Our Favorite Pitches

From Cartoon Movie 2026

By Kévin Giraud |

From Cartoon Movie 2026

03/06/2026 9:27 am |

By Kévin Giraud |

03/06/2026 9:27 am |

By Kévin Giraud | 03/06/2026 9:27 am |

Since its creation in 1999, Cartoon has helped 513 feature films secure financing, with an overall budget of €3.42 billion ($3.7 billion).

From cynical adult comedy to heartfelt family stories, these projects aim to captivate audiences in the years ahead.

Starseed

Country: Romania, South Africa, France, Belgium & Canada

Producers: Aparte Film, Known Associates Group, Special Touch Studios, Wrong Men, Quetzalcoatl, Yzanakio

Length: 97 minutes

Producers: Aparte Film, Known Associates Group, Special Touch Studios, Wrong Men, Quetzalcoatl, Yzanakio

Technique: 3D computer animation

Length: 97 minutes

Status: In production

Technique: 3D computer animation

Status: In production

- United States -

From acclaimed Romanian filmmaker Anca Damian comes a female-driven family adventure with the director’s distinctive touch. Written by Damian with award-winning Zimbabwean author NoViolet Bulawayo, Starseed opens in a township facing the drying up of its river. There, three

Loveness, a brave albino girl, seizes the opportunity to save the goddess of water, trapped in a knot in time.

Currently in production, Starseed is an ambitious 3D animated feature with a striking visual world. Underwater goddesses and eerie sorcerers populate unusual settings where children navigate using only their innocence and curiosity.

Produced with a €4.8 million budget, the team is still seeking gap financing, as highlighted by coproducer Sébastien Onomo (Special Touch Studios). To finalize the budget, they are looking for additional partners and aim to deliver the film in time for Cannes 2027.

Riamise

Country: Italy, France & Japan

Producers: Ibrido Studio, Something Big, Studio 4°C

Length: 87 minutes

Technique: 2D computer animation

Status: In concept

Indie anime powerhouse Studio 4°C is collaborating with Ibrido Studio, an Italian company making its feature debut with directors Francesco Forti and Hirokazu Kojima.

Forti, presenting alongside his French and Italian producers, introduced the audience to the dry streets of Riamise—a city without water, consumed by drought, crime, and giant reptiles, the last non-human creatures on Earth. Its people survive by earning blue crystals, the only source of sustenance.

While the rich thrive, two clans battle for control of the city. Order collapses when the police commissioner—Jona’s father—is murdered. Returning home, Jona searches for the truth behind his father’s death and the mystery of the crystals. Alongside Kala, a bold girl from the city’s dump, he may uncover a secret that could restore the water supply and change Riamise’s fate forever.

Nearly ten years after Mutafukaz, their first Japan–France collaboration, Studio 4°C returns to a European co-production, and the project already looks visually bold. Blending warm European color palettes with dynamic, anime-inspired camera movement, this teenage-driven adventure could appeal to audiences in both Europe and Japan.

At this early stage, the team is finalizing the first draft of the script and seeking co-producers, investors, and partners.

Once Upon an Egg

Country: Netherlands, Belgium, Czech Republic

Once Upon an Egg

Producers: Keplerfilm, A Private View, Hausboot

Country: Netherlands, Belgium, Czech Republic

Producers: Keplerfilm, A Private View, Hausboot

Length: 85 minutes

Producers: Keplerfilm, A Private View, Hausboot

Length: 85 minutes

Technique: Stop-motion

Status: In development

Cartoon Brew - 06/03/2026

Technique: Stop-motion

Status: In development

5/10 - United States -

From Wander to Wonder Academy Award-nominated director Nina Gantz comes an epic, comedic stop-motion musical about… pigeons.

- United States -

In Once Upon an Egg, we follow two ordinary gray city pigeons, Molly and Mick, who have struck it lucky with their nest on top of a fries stand in the heart of Amsterdam. One day, everything changes when a cleaning crew washes away their nest—along with their only egg.

From Wander to Wonder Academy Award-nominated director Nina Gantz comes an epic, comedic stop-motion musical about… pigeons.

Heartbroken, they set off in search of a new home and a renewed sense of purpose. Along the way they befriend a young ring-necked parakeet named Brutti and eventually discover an abandoned egg. While caring for the egg—and for each other—they learn that only by adapting to the changing city can they build a new life and family of their own.

A Dutch-Belgian-Czech production in the early stages of development, Once Upon an Egg promises to be visually appealing for stop-motion fans. Gantz plans to use recycled materials, discarded cloth, wool, and other textiles to craft the pigeons, demonstrating the concept with a sock-turned-pigeon during one of the event’s most entertaining pitches.

The project is backed by an experienced creative team including character designer Félicie Haymoz (Fantastic Mr. Fox, Isle of Dogs), storyboard artist Jay Clarke (Isle of Dogs, Wallace & Gromit), key animator Steve Warne (Pinocchio, Frankenweenie), puppet artists Mackinnon & Saunders (Corpse Bride, Pinocchio), composer Terrence Dunn (Wander to Wonder), and Dutch screenwriter Robert Alberdingk Thijm.

A love letter to pigeons—animals that were once close companions to humans before being dismissed as “sky rats.”

Flick!

Country: France

Producers: Wizz, FOST

Length: 80 minutes

Technique: 2d computer

Status: In development

Producers: Wizz, FOST

Length: 80 minutes

Cartoon Brew - 06/03/2026

Technique: 2d computer

Status: In development

- United States -

For their debut feature Flick!, Paris-based 2D/3D graphics studio Wizz teamed up with FOST, the studio behind The Summit of the Gods and Splinter Cell: Deathwatch. The pairing proves fitting for the unusual duo at the center of director Nicolas Pegon’s film.

Joy, born to an American father she never knew and a French mother, has spent her life trapped in a sleepy valley in the Vosges mountains, bored out of her mind. Didier, a fifty-year-old history teacher who shares a house with her, is neither particularly captivating nor captivated by life, often seeming to drift on another plane.

As Joy moves between the local bar and her apartment in a tedious routine, she stumbles upon the body of a dead cowboy. It soon becomes clear that, even if she had nothing to do with the crime, she could easily be accused. So she and Didier decide to hide the body.

That’s when the cowboy’s ghost begins appearing in real life.

Country: France, Belgium & Ivory Coast

That’s when the cowboy’s ghost begins appearing in real life.

Producers: Cottonwood Media, Booya Studio, Umedia

Length: 80 minutes

Technique: 2D computer animation

Status: In development

Set in a decaying industrial landscape, Flick! recalls the tone of Joel and Ethan Coen’s Fargo, blending quirky characters with a grounded, darkly cynical sense of humor. Featuring actors Mara Taquin and William Lebghil making their animated voice-acting debut, the project positions itself as a distinctive arthouse animated feature that could aim for major festivals such as Berlin,

With many female directors present this year and gender parity nearly achieved (44.6% female, 54.9% male, 0.5% non-binary), Cartoon Movie continues to highlight female-driven stories and coming-of-age narratives.

Presented by three women, The Heart of the Djembe is one such project.

Eight-year-old Imani lives with her grandmother in the village of Alkeboulane and dreams of playing the djembe, just like her late father and her brother, who continues his legacy. But in Alkeboulane, women are forbidden from touching the instrument, and doing so is believed to invoke a powerful curse.

When a relentless drought strikes, Imani embarks on a perilous journey into the wild to seek Denga, the god of abundance, and uncover the truth hidden deep within the forest.

In this tale of music, magic, and courage—where one girl’s rhythm could change the fate of her world—authors Ani Eliam and Assa Ouattara, along with director Mathieu Vavril, bring together lush forest settings, emotional moments of connection, and a strong sonic dimension that extends beyond the physical world.

With a budget of €5 million and a script expected before the summer, the producers are currently seeking investors and partners, with a planned release around 2029.

What Do You Think?

FEATURESTOPSTORIES

NordicAnimationStarsContinuetoShine DespiteCommonGlobalChallenges

FEATURESTOPSTORIES

NordicAnimationStarsContinuetoShine DespiteCommonGlobalChallenges

By PeterSchavemaker March5,2026

NordicAnimationStarsContinuetoShine DespiteCommonGlobalChallenges

By PeterSchavemaker March5,2026

Overthepastdecade,animationproducersbasedinNorway,Sweden,Finland,DenmarkandIcelandhave beenabletocontinuegrowingtheindustryintheNordicterritories.AsproducerTonjeSkarReiersen(Maybe Elephants,Titina),whoischairoftheboardofthe NordicAnimation group,whichwasformedin2018during theAnnecyInternationalAnimationFilmFestival,pointsout,“Wetookasortofbigstepforwardbecauseit usedtoaloosenetwork.Currently50companiesarepartoftheassociation.Animationisaverycollaborative artform.Ithinkit’ssortofasenseofagrowingcommunitybetweentheNordiccompaniesandproducers.We arerootingforeachother,backingeachotherandhappywhenotherssucceed.”

EN fromacrosstheregionpresentnewprojectsanddiscusskeytopicsshapingtheNordicanimationindustry. TheforumwasheldattheFredrikstadAnimationFestival(FAF)inNorway.

NordicAnimationhasawebsiteanddatabasewithinformationonhowtoco-producewithproducersand animationstudiosfromNorway(22members),Sweden(11),Finland(eight),Denmark(ifve),Iceland(three), andonestudiointheFaroeIslands.NordicAnimationorganizesyear-roundactivitiessuchasmasterclasses andwebinars,andin2025launcheditsifrstforum,NewNordicAnimation,wherestudiosandiflmmakers fromacrosstheregionpresentnewprojectsanddiscusskeytopicsshapingtheNordicanimationindustry. TheforumwasheldattheFredrikstadAnimationFestival(FAF)inNorway.

“ThegoalistobuildontheNewNordicAnimationforumasanannual event.FAFisanaturalplaceforus,asitsfocusisevenmoreonthe industry.OneofthetopicswashowtogetNordicbroadcastersonboardto co-investinNordicseries.Thatwouldbeagamechanger.DRhasinvested veryactivelyinDanishanimationinrecentyears,”Reiersensays.Sheadds thatNordicAnimationisveryawareofitsownidentity.“Webelieveitisalso oneofoursellingpoints,”saystheproducer,whoseupcomingprojects includethemuch-anticipatedanimatedfeatures, Dante and Pesta.

“ThegoalistobuildontheNewNordicAnimationforumasanannual event.FAFisanaturalplaceforus,asitsfocusisevenmoreonthe industry.OneofthetopicswashowtogetNordicbroadcastersonboardto co-investinNordicseries.Thatwouldbeagamechanger.DRhasinvested veryactivelyinDanishanimationinrecentyears,”Reiersensays.Sheadds thatNordicAnimationisveryawareofitsownidentity.“Webelieveitisalso oneofoursellingpoints,”saystheproducer, whoseupcomingprojects includethemuch-anticipatedanimatedfeatures, Dante and Pesta.

AsigniifcantnewfundingopportunityforNordicAnimation,especially strengtheningtheDanishanimationecosystemisthetaxincentiveof25% whichwaslaunchedinJanuary2026.Asthecountry’sculturalministerJakobEngel-Schmidtnoted,“Thiswill helpusbecomeaculturalpowerhouse.Wehavebeenwaitingalongtimeforthatincentive.Everybodyis superexcitedaboutit.”

“We’vealwayshadastronganimationindustry,”saysTonniZinck(DiscoWorms,MarcoMacao)whois currentlyco-directingtheNorwegianIP TheLegendofMagnustheGood,produced,directedandwrittenby FrankMosvold(KOOLProduction).“It’safantastictimetobeworkingonNordicanimationwhichisbooming,” notesMosvold.“Thereissomuchgoingonrightnowandit’saverycollaborativefeeltothewholething. Nordicsharevalueslikeequalityand inclusion,makesstoriesfromthechildren’spointofviewandtakingthe livesandemotionsofchildrenveryseriously.”

“TheLegendofMagnustheGood isbasicallymyverypersonalstory,” Mosvoldexplains.“IgrewupinaveryconservativemaritimefamilywhereI wasexpectedtogointotheshippingbusiness.”Mosvoldworkedforfour yearsasashipbrokerbutthenherealizedthatwasn’treallyhislife.He movedtoHollywood,wenttoiflmschoolandcameoutofthecloset.

“Thisisbasicallywhatthejourneyofthemaincharacteris.Magnus,theson ofthebiggestking(KingOlafII)inNorwegianhistory,ifndingoutwhoheis andtryingtobreakwiththetraditionandwhatthesocietywantshimtodo.

Tonje Skar Reiersen

The Legend of Magnus the Good

somethingnew,”Zinckadds.

layertotheNordicvalues.ThisstoryaboutVikingsanddragqueenstalkingaboutloveandacceptanceis somethingnew,”Zinckadds.

TheCG-animatediflmhasaballparkbudgetof€6to€7million(about$6.9millionto$8.1million).“Ourgoalis togointopre-productioninAugustandweareplanningonusingtheDanishtaxincentive,”saysMosvold.

Thisyear,fourNordicAnimationfeatureprojectswereselectedtoparticipateat CartoonMovie inFrance. Adult/YA-animationfeature BeforeTheyWereGods isproducedbyStockholm-basedMyllaFilm,andrevolves aroundtheimaginaryteenageyearsofmusiciconsNickCaveandSwedishrockstarJoakimThåström(bothof whomwerebornin1957).Theprojectisa2Danimatedfeatureiflmthatemphasizesuniversalthemessuchas friendship,philosophyandthepowerofdreams.ThestorycreatedbyMånsMårlind(TheBridge,Midnight Sun)issetina1971-erasuburbofStockholm.TheyoungThåströmisaharshexistentialistandunabashedly political,whileCaveisastrugglingagnosticandaromanticdreamer.Theiflm’sotherco-producersare Brokendoll(Sweden),QvistenAnimation(Norway),ParceQueFilms(Canada)andElasticFilm(United Kingdom).

Thisyear,fourNordicAnimationfeatureprojectswereselectedtoparticipateat CartoonMovie inFrance. Adult/YA-animationfeature BeforeTheyWereGods isproducedbyStockholm-basedMyllaFilm,andrevolves aroundtheimaginaryteenageyearsofmusiciconsNickCaveandSwedishrockstarJoakimThåström(bothof whomwerebornin1957).Theprojectisa2Danimatedfeatureiflmthatemphasizesuniversalthemessuchas friendship,philosophyandthepowerofdreams. ThestorycreatedbyMånsMårlind(TheBridge,Midnight Sun)issetina1971-erasuburbofStockholm.TheyoungThåströmisaharshexistentialistandunabashedly political,whileCaveisastrugglingagnosticandaromanticdreamer.Theiflm’sotherco-producersare Brokendoll(Sweden),QvistenAnimation(Norway),ParceQueFilms(Canada)andElasticFilm(United Kingdom).

AsproducerPatrikAndersson(Midsommar,Euphoria) explains,“Theyare extremelysimilarasstagepersonasandbothveryrelevantinSwedenThe visualstyleisinspiredbySwedishcomic-bookaestheticsfromthe1970s. Weimmediatelyunderstoodabouttheoriginality,itspotentialandthe quiteastonishinglylook.ItalsobringthespeciifcSwedishelementsinthe story.WewantedtodothisfromaSwedishperspective,ratherthandoing itafullinternationaliflm.”

Anderssonpointsoutthatthecharactersfeelveryfreeintheircontextand theirsociety.“Thesecharactersarerelfectingupontheirexistenceandthe waytheycanbecreative,”hesays.“Thisisdeifnitelysomethingvery Swedish.Wealsoavoidedmakingtheiflmpretentiousandaccessibletoonlyafew.Wedecidedtomakeour artistsyoungteenagers,bringingthemdowntoourmortallevelfortheaudiencestorelateto.Itisintellectual inthefactthatit’sdealingwithphilosophicalthemesinawaythatateenagecrowdwouldunderstandit.In reality,they’reabout14or15yearsold,butwe’retryingtonotagethemspeciifcally.”

Anderssonpointsoutthatthecharactersfeelveryfreeintheircontextand theirsociety.“These charactersarerelfectingupontheirexistenceandthe waytheycanbecreative,”hesays.“Thisisdeifnitelysomethingvery Swedish.Wealsoavoidedmakingtheiflmpretentiousandaccessibletoonlyafew.Wedecidedtomakeour artistsyoungteenagers,bringingthemdowntoourmortallevelfortheaudiencestorelateto.Itisintellectual inthefactthatit’sdealingwithphilosophicalthemesinawaythatateenagecrowdwouldunderstandit.In reality,they’reabout14or15yearsold,butwe’retryingtonotagethemspeciifcally.”

CaveandThåströmwillrecordtheirvoicesforthemovieinLondon(ElasticFilm)inthespringof2026.“They havenotyetmet,butendorsedtheprojectfully.CaveandThåströmarebothveryawareofeachotherof courseandrespecteachother’swork,”saystheproducer.“Wehopetodelivertheiflmin2027.”

Patrik Andersson

Before They Were Gods

Patrik Andersson

Before They Were Gods

Patrik Andersson

Before They Were Gods

havenotyetmet,butendorsedtheprojectfully.CaveandThåströmarebothveryawareofeachotherof courseandrespecteachother’swork,”saystheproducer.“Wehopetodelivertheiflmin2027.”

Copenhagen-basedlive-actiondirectorandiflmmakerRegnerGrastenandhisdaughterPukarebehindthe new2Dfeature BettyBalloon.Thestory,whichcentersonaballoonfamilyandtheirfour-yearoldBetty,and herfriendshipwiththeirnewneighborstheCactusfamily,wasinspiredbyhowgrandpaRegnerandhis daughterPukwouldcommunicatewiththesmallchildreninthefamily.

“Children’sseriesareaboutanimalsandsmallchildren,butveryseldom aboutfamily,”saysPukGrasten.“That’sveryimportantinDenmark, becauseyouhaveabigstorycultureinthecountryaboutparentsandtheir children.So,wethought,‘Whydon’twemakeourownanimationfamilies?’ That’showtheBalloonfamilyandCactusfamilywereborn,witheachtwo children—ateenandapreschooler.”

GrastenFilmwasfoundedin1985andhasproducednumerouslive-action movieswithatypicalDanishsignatureandvalues.“Differenceisjustthe strengthinDenmark,andnowyoucanalsoseethatin BettyBalloon.We wereinspiredbythe Peanuts cartoonsandalltheclassicDisneymoviesin ouruseofcolorinthebackgrounds,”saysRegner.

AccordingtotheGrastens, BettyBalloon isa100%Danishproject,whichalsoinvolvesleadinganimation schoolTheAnimationWorkshop(TAW)inViborg,Denmark. BettyBalloon willbereleasedinDanishtheaters onOctober1andDanishTV2willbroadcastthefeatureiflmonChristmas.“TV2alsoco-fundedtheproject,” saysRegnerGrasten,whoplanstocontinuemakingmoviesforpreschoolaudiences,attheveryimpressive rateofoneperyear.

- United States -

Puk Grasten

Betty Balloon

Puk Grasten

Betty Balloon

Puk Grasten

Betty Balloon

Puk Grasten

Betty Balloon

Sander’s Midsummer

TheothertwoNordicfeaturesspotlightedatCartoonMoviethisyearare Sander’sMidsummer,directedby HanneBerkaakandproducedbyMikroiflm(Norway),DenSisteSkilling(Norway)andKnudsenPictures (Germany),and GingerbreadTown,directedbyWillAshurstandKjerstiG.Steinsbø,andproducedbyDen SisteSkilling,KnudsenPictures,Artichoke(Solvania),andInk&Light(Ireland).

Sander’sMidsummer centersonayoungboywhoistransportedtoalforalfantasyworldwhenhespendsthe summerholidayathisgrandmother’schaoticcountryhouse. GingerbreadTown isaplayfulfantasysetinthe world’slargestgingerbreadtownexhibitioninBergen,andfollowsthechaosunleashedwhenunknown perpetratorsdestroythehousesinthecharmingcandyvillage.

Sander’sMidsummer centersonayoungboywhoistransportedtoalforalfantasyworldwhenhespendsthe summerholidayathisgrandmother’schaoticcountryhouse. GingerbreadTown isaplayfulfantasysetinthe

Pikkuli and Starlight Reindeer

Thewinterof2026willbringtheFinnishreleaseof PikkuliandStarlightReindeer.ThenewChristmasthemedprojectcentersonthepopularPikkulicharacter,whoembarksonamagicaladventuretosave ChristmasbybringingbackthemythicalStarlightReindeer.CreatedbyTurku-basedMetsämarjaAittokoski, theiflmfeaturescharacterdesignsandmadeinfeltbyB-WaterStudiosinSantaCruzdeTenerife,Canary Islands.DeliverydatefortheinnovativefeatureisslatedforSeptemberof2026.

- United States -

Pikkuli and Starlight Reindeer

Sander’s Midsummer

Pikkuli and Starlight Reindeer

Sander’s Midsummer

“WecameupwiththisnewlookinJulyof2025becausetheotherPikkuli projectsweredonein2Dandhadadigitalcutoutstyle,”saysAittokoski. “WorkingwithBlender,B-WaterStudiossuggested2Dbackgroundswith3D characters,infelt.Itbringsagreathandmadefeeltotheproject.”

Accordingtothecreator,allNordiccountriesareonboardwiththefamily project.“TheybroadcasttheTVseries(13episodesofsevenminutes). FinnishpublicbroadcasterYLE—andSweden’sYLE—boughttherightsof the80-minutefeature.Todate,400,000booksandhundredthousandapps havebeensoldandtheTVseriesairsin40countries,”sheadds.

Dante

Thismonth,theMalmö-basediflmfestivalBUFFwillpremiere Dante,alarge-scaleScandinaviancoproduction.LindaHambäck,founderofLEEFilm,isproducinganddirectingthemovie(Swedishtitle Jag,Dante ochmiljonerna)inSweden.ProducedwithNørlum(Denmark)andMikroiflm(Norway), Dante qualiifesasa trueNordiciflm.

“Itisrarethatacoproductionofthismagnitudecanbedone,”Hambäck notes.“It’sfantastic.Geographicallyweareveryclosetoeachother. AnimationinDenmarkandNorwayisbooming.Weenvythem,becauseour animationindustryisverysmall,whichisreallystrange.Swedenisreally famousforAstridLindgrenandverygoodchildrenliteratureforchildren, butwehaveone,maximumthreeanimatediflmsproducedperyear DenmarkandNorwayproduceifveorsixperyear.”

Dante,whichfeaturesacut-outanimationstyle,hasabudgetofabout€3 million(~$3.5million).TheanimatediflmisbasedonFridaNilsson’sbestsellingbook.ItcentersonabankclerknamedHelgewhoselifeturns upsidedownwhenmoneyisstolenandheisblamedforthecrimes.That’swhenheformsafriendshipwitha ratnamedDantethathemeetsinthecity’slandifll.TheiflmisadetectivestoryinwhichHelgecanprovehis innocencebyifndingtherealculprit.

“Iboughtthebookrightsin2019,”saysHambäck,whopreviouslyadaptedNilsson’s TheApeStar andwrote themoviewithJessikaJankert.“Nilssonisverystraightforward,similartoRoaldDahl.Relfectingthevalues hereintheNordics,thestoryisopen-mindedandcantakeyoutoplacesbeyondyourwildestimagination.I wasinspiredbyHayaoMiyazakiasImadethemovie.Hehasbeenaninspirationforverymanyofus.”

- United States -

Metsämarja Aittokoski

Linda Hambäck

Dante

Metsämarja Aittokoski

Linda Hambäck

Dante

Metsämarja Aittokoski

Linda Hambäck

Dante

Metsämarja Aittokoski

Linda Hambäck

Metsämarja Aittokoski

Linda Hambäck

Dante

ProducerClausToksvigKjaerofViborg-basedNørlum(SongoftheSea, LongWayNorth)agreesonthebeneiftsofthepreviouslydiscussedDanish tax-incentive,whichearmarks(converted)€3.3milliontoanimation productions.“Wewereverythrilledwhenthatwasannounced.Welostalot ofanimationjobsovertheyearstocompaniesinothercountrieslike BelgiumandFrance.”NothavingaDanishtaxincentivealsoaffected Nørlumheavily.“Wehadtoletgoofprojects.Ithink,forNørlumalone,we probablysaidgoodbyetoatleast€10millionovertheyears.Wehadno incentivestogive.”

Toksvig,whoisalsoaco-produceron Dante,seespossibilitiesinbuildinga strongerNordicanimation.“It’salwaysnicetohavepartnersthatareneighbors,”hesays.“Wecanhavea strongervoicewithinNordicAnimation,alsotowardspoliticians.NordicAnimationisnotonlyentertainment, butalsohasadifferentrole.Itisshockingthatacooperationlike Dante doesn’thappenveryoften.Nowwe canandshoulddoitmorethanthehistoryshows,especiallybecauseScandinaviancountriesspeakthesame languageinaway.”

Learnmoreat nordicanimation.com

Claus Toksvig Kjaer

Cartoon Movie’s Eurimages Award Nominees Revealed

https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Cartoon Movie’s Eurimages Award Nominees Revealed

Mercedes Milligan

Mercedes Milligan

The Council of Europe’s Eurimages Fund has joined forces with nine co-production markets from all over the world — including Cartoon Movie (March 3-5 | Bordeaux, France) — to find worthy recipients of the Eurimages Co-production Development Award (CPDA). This cash prize of €20,000 has been created to promote the Fund’s role in encouraging international co-productions from the initial stages of a project.

This year, 13 nominated projects will be presented at the European animated feature film coproduction and pitching event Cartoon Movie The winning project should be conceived as an international co-production intended for cinema release. The award applicant must be an independent production company based in a Eurimages member State, having creative control of the project and with the majority participation in the development financing, and must have the intention of involving at least one other producer from a different Eurimages member State in the coproduction.

The award, which takes the form of a non-reimbursable subsidy, must be used to cover development expenses of the project.

Find more information on the Eurimages contenders here

Cartoon Movie’s Eurimages Award Nominees Revealed

The award, which takes the form of a non-reimbursable subsidy, must be used to cover development expenses of the project.

https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Nominated Projects at Cartoon Movie 2026

Find more information on the Eurimages contenders here

Acorn’s Adventure

Produced by Pure Shore (Czechia)

Co-produced by Fabian&Fred (Germany)

Directed by Filip Mašek

Acorn, a newcomer without a purpose, must rally to save his new home town built of imagination: Resinland. An animated adventure about being yourself… even if you don’t know what that is yet.

Acorn’s Adventure

Produced by Pure Shore (Czechia)

Co-produced by Fabian&Fred (Germany)

- 20/01/2026

Directed by Filip Mašek

Acorn, a newcomer without a purpose, must rally to save his new home town built of imagination: Resinland. An animated adventure about being yourself… even if you don’t know what that is yet.

Cartoon Movie’s Eurimages Award Nominees Revealed

Cartoon

2 van 11

Before They Were Gods

Produced by Mylla Films (Sweden)

https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

21/01/2026, 15:18

Co-produced by Brokendoll (Sweden) / Qvisten Animation (Norway) / Parce Que Films (Canada) / Elastic Film (U.K.)

Directed by Måns Mårlind

Nick Cave. Joakim Thåström. Today they are seen as rock gods, but in 1971 they were just teenagers. A film about friendship, love and creativity, but above all the limitless power of youth and how, through lust and curiosity together with our pals, we unconsciously forge our future selves.

3 van 11

Dreamers – The Hunt for Shadowclaw

Produced by parapictures film productions (Germany)

Co-produced by Falcon Features (Canada) / Kickstart Entertainment (Canada) / Epsilon Film (Germany)

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Directed by Christopher Jenkins

Lenny dreams of being an elite K9 police dog, but overconfidence costs him the trial. He overhears: a circus panther has escaped, New York is in grave danger! A perfect comeback.

21/01/2026, 15:18

Movie’s Eurimages Award Nominees Revealed

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Cartoon Movie’s Eurimages Award Nominees Revealed

https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Lenny dreams of being an elite K9 police dog, but overconfidence costs him the trial. He overhears: a circus panther has escaped, New York is in grave danger! A perfect comeback.

Dreamwalker

Produced by Vivi Film (Belgium)

Co-produced by Parmi les lucioles films (France) / Lighthouse Studios (Ireland)

Directed by Rudi Mertens

Lucy is a lively 11-year-old girl, but everything changes when she is diagnosed with a rare sleep disorder called narcolepsy. One day, a mysterious boy appears in her dreams.

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

4 van 11 21/01/2026, 15:18

Produced by Animoon (Poland)

Co-produced by Special Touch Studios (France) / Basement Animation Company (Nigeria)

Directed by Jacek Rokosz

Rwanda, Summer of 1994. Two kids of opposite tribes are forced to venture together into the post massacre land in search for food, a new home and their lost souls.

Ejo

Produced by Animoon (Poland)

Animation Magazine - 20/01/2026

Co-produced by Special Touch Studios (France) / Basement Animation Company (Nigeria)

Directed by Jacek Rokosz

Rwanda, Summer of 1994. Two kids of opposite tribes are forced to venture together into the post massacre land in search for food, a new home and their lost souls.

Family Squad

Produced by Animagrad (Ukraine)

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

5 van 11

Co-produced by Telescope Animation Studios (Germany) / PFX (Czechia) / Fiilin Good Films (Finland)

Directed by Kostiantyn Fedorov

Serhii, a 33-year-old typical loser, is hit by a truck due to the mistake of Mickey the cat — the angel of death. The divine forces are ready to give Serhii a second chance, but in order to return to life, he must find at least one person who really needs him.

21/01/2026, 15:18

Gingerbread Town

Produced by Den siste skilling (Norway)

Co-produced by Knudsen Pictures (Germany) / Artichoke (Slovakia) / Ink & Light (Ireland)

Directed by Will Ashurst & Kjersti G. Steinsbø

When night falls at the world’s largest gingerbread town in Bergen, Norway, the gingerbread people come alive. But shortly before the exhibition opens, unknown vandals begin destroying the candy buildings. It’s up to town fixer Cinnamona and Viking Harold Sweet-Axe to put things right!

Produced by Den siste skilling (Norway)

Co-produced by Knudsen Pictures (Germany) / Artichoke (Slovakia) / Ink & Light (Ireland)

Magazine - 20/01/2026

Directed by Will Ashurst & Kjersti G. Steinsbø

Cartoon Movie’s Eurimages Award Nominees Revealed

https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

6 van 11 21/01/2026, 15:18

Kigali Night

Produced by Parmi les lucioles films (France)

Co-produced by Eklektik Productions (Belgium) / Melusine Studio (Luxembourg)

Directed by Samuel Lajus

Samuel is 23 when he arrives in Rwanda as an audiovisual facilitator at the French Cultural Centre in Kigali. During the 18 months he spends there, warning signs about the regime’s atrocities accumulate, but Samuel doesn’t believe — or doesn’t want to believe them…

Cartoon Movie’s Eurimages Award Nominees Revealed

Kindred Spirits

Produced by Cartoon Saloon (Ireland)

7 van 11

Co-produced by Folivari (France)

Directed by Tomm Moore

https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

21/01/2026, 15:18

An Irish refugee child alone in New York of 1847. A Choctaw son far from the warmth of his family. When their paths align, Mara and Tushka will journey through epic adventures and magical encounters, watched over by the restless spirit of Mara’s brother, Dan.

United States -

Produced by Cartoon Saloon (Ireland)

Co-produced by Folivari (France)

Directed by Tomm Moore

- 20/01/2026

An Irish refugee child alone in New York of 1847. A Choctaw son far from the warmth of his family.

When their paths align, Mara and Tushka will journey through epic adventures and magical encounters, watched over by the restless spirit of Mara’s brother, Dan.

Kokum

Produced by Paul Thiltges Distributions (Luxembourg) / Special Touch Studios (France)

Directed by Hassan Yola

In an ancient forest, the young girl conducting the ritual of Balance is killed by mysterious masked attackers before her mother’s eyes. The bereft Makena acts out in her grief, determined to bring her child back, and the elders summon the tracker Kokum from his centuries-long sleep.

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

8 van 11

Cartoon Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Nina and the Goddess of Thunder

Produced by New Europe Film Sales (Poland)

21/01/2026, 15:18

Co-produced by Fabrique d’Images (Luxembourg) / Fantabulous (France) / Human/PFX (Poland)

Directed by Kamil Polak

In a 10th century Slavic village, the winter solstice holiday when the blacksmith god Swaróg forges a new Sun for the year does not come to pass. Eleven-year-old Nina team sup with Perunika, Swaróg’s youngest daughter, on a journey through the kingdoms of different Slavic gods to save the world.

van 11

8 van 11

Nina and the Goddess of Thunder

Co-produced by Fabrique d’Images (Luxembourg) / Fantabulous (France) / Human/PFX (Poland)

Directed by Kamil Polak

Animation Magazine - 20/01/2026

7/7

9 van 11

https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Saima: Scenes from a Midlife Crisis

Movie’s Eurimages Award Nominees Revealed https://www.animationmagazine.net/2026/01/cartoon-movies-eurimage...

Directed by Chintis Lundgren & Draško Ivezić

Produced by Alexandra Film (Estonia) / Adriatic Animation (Croatia) / Avec ou sans Vous (France)

Directed by Chintis Lundgren & Draško Ivezić

Saima is a 40-year-old distinguished judge. Everything around her is in order, until Ludvig, her partner of 10 years, confesses to an affair. In her fragile state, Saima receives a package with a family heirloom: a wooden frog which holds the key to saving her soul.

21/01/2026, 15:18

The

Heart of the Djembe

The Heart of the Djembe

Produced by Cottonwood Media (France)

Co-produced by Booya Studio (Ivory Coast) / Umedia (Belgium)

Produced by Cottonwood Media (France)

Co-produced by Booya Studio (Ivory Coast) / Umedia (Belgium)

Directed by Mathieu Vavril

Co-produced by Booya Studio (Ivory Coast) / Umedia (Belgium)

Directed by Mathieu Vavril

Eurimages is the cultural support fund of the Council of Europe. Established in 1989, it currently numbers 38 of the 46 member states of the Strasbourg-based organization, plus Canada. Eurimages promotes independent filmmaking by providing financial support to feature-length fiction, animation and documentary films. In doing so, it encourages co-operation between professionals established in different countries. Eurimages has a total annual budget of approximately €30 million.

Eight-year-old Imani is a spirited girl living with her grandmother in the village of Alkeboulane. Her dream is to play the djembe, just like her late father. But women are forbidden to touch the instrument by a powerful curse. When a drought strikes, Imani embarks on a perilous journey to find Denga, the god of abundance, save her village and break the curse of the djembe. Eurimages is the cultural support fund of the Council of Europe. Established in 1989, it currently numbers 38 of the 46 member states of the Strasbourg-based organization, plus Canada. Eurimages promotes independent filmmaking by providing financial support to feature-length fiction, animation and documentary films. In doing so, it encourages co-operation between professionals established in different countries. Eurimages has a total annual budget of approximately €30 million.

- United States -

Cartoon

Cartoon Movie’s Eurimages Award Nominees Revealed

AWARDSTOPSTORIES

CartoonMovieTributesNomineesAnnounced

AWARDSTOPSTORIES

CartoonMovieTributesNomineesAnnounced

AWARDSTOPSTORIES

By MercedesMilligan February12,2026

CartoonMovieTributesNomineesAnnounced

By MercedesMilligan February12,2026

CartoonMovieTributesNomineesAnnounced

AWARDSTOPSTORIES

By MercedesMilligan February12,2026

CartoonMovieTributesNomineesAnnounced

By MercedesMilligan February12,2026

By MercedesMilligan

February12,2026

Producers,distributorsanddirectorsfromnineEuropeancountrieshavebeennominatedforthe Cartoon MovieTributes,whichcelebratethemostoutstandingachievementsinEuropeananimationoverthe previousyear.ThewinnerswillbevotedbytheprofessionalsattendingCartoonMovie,thepitchingandcoproductioneventforanimatedfeatureiflmsthatwillholditsnexteditiononMarch3to5intheFrenchcityof Bordeaux,Nouvelle-Aquitaine.

NineteenEuropeancompaniesandorganizationssharethespotlightinthe ProduceroftheYear categoryas co-producersoffourfeatureiflmsthatwerepresentedatCartoonMovieindevelopmentstages.

Frenchcompanies Folimage and LesArmateurs,inco-productionwithBelgium’s Lunanime and Dragons Films,andFrance’s Auvergne-Rhône-AlpesCinéma, JPLFilms, Pictanovo and TNZPVProductions,are behind TheSongbirds’Secret byAntoineLanciaux,theifrstfeatureiflmtobemadeentirelywithpapercutoutsinacentury.AfterbeingpresentedindevelopmentatCartoonMovie2019andscreenedasasneak previewatthesameeventin2025,theiflmhasbeenselectedformorethan50internationalfestivals.

StitchHead isaco-productionledbyGermany’s GringoFilms,alongsideLuxembourg’s Fabriqued’Images andGermany’s SenatorFilmProduktion and TraumhausStudio.Co-directedbySteveHudsonandToby Genkel,theiflmisa3Danimatedmonsterfantasycomedyaimedatchildrenandfamilyaudiencesthatwas AWARDSTOPSTORIES

NineteenEuropeancompaniesandorganizationssharethespotlightinthe ProduceroftheYear categoryas co-producersoffourfeatureiflmsthatwerepresentedatCartoonMovieindevelopmentstages.

EN releasedinEuropeinOctober2025.ThisiflmwaspresentedinconceptatCartoonMovie2017andtwoyears laterreturnedtothiseventindevelopmentstage.

TalesfromtheMagicGarden isastop-motionanimatedpuppetfeaturecollectivelydirectedbyDavidSúkup, PatrikPašš,LeonVidmarandJean-ClaudeRozec.Addressinggriefandthehealingpowerofimagination,the iflmisaninternationalco-productioninvolving MAURiflm (CzechRepublic), VivementLundi! (France), Artichoke (Slovakia)and ZVVIKS (Slovenia).AtCartoonMovie,itwaspresentedindevelopmentin2019andas asneakpreviewin2025.

France’s SpecialTouchStudios and CreativeTouchStudios,Luxembourg’s PaulThiltgesDistributions, Canada’s Yzanakio,togetherwithBelgium’s NeedProductions and Lunanime,completethelistofnominees

YourCartoonMovieSampler

HerearesomeoftheinterestinganimatedEuropeanfeatureprojectsthatcaughtourattentionbeforethe event.PleasevisitourwebsiteforourfullreportfromBordeauxinMarch:

FESTIVALS&EVENTSTOPSTORIES

WhereInclusionandOriginality Matter:A CartoonMovieSampler

By RaminZahed February27,2026

Thisarticlewaswrittenforthe March’26issueofAnimationMagazine(No.357).

FESTIVALS&EVENTSTOPSTORIES

WhereInclusionandOriginality Matter:A CartoonMovieSampler

By RaminZahed

WhereInclusionandOriginality Matter:A CartoonMovieSampler

February27,2026

By RaminZahed

February27,2026

BeforeTheyWereGods

PerhapsnoothereventpredictsthefutureofEuropeananimatedcinemabetterthanCartoonMovie,which takesplaceeveryspringinBordeaux,France.Thisyear’sedition(March3-5)isnoexception:Showcasing50 wide-rangingfeaturesinvariousstagesofdevelopmentandproduction,theeventactsasafascinatingcrystal ball,offeringasamplingofwhattoexpectfromEurope’sanimationsectorintheyearstocome.

Thisarticlewaswrittenforthe March’26issueofAnimationMagazine(No.357).

Filethisoneunderthingsyoudidn’texpecttoseeinanimation—aEuropeanco-productionaboutthe teenageyearsofAustralianrockstarNickCaveandhisSwedishcounterpartJoakimErikssonThåström.That’s thepremisebehindthenewprojectfromdirector MånsMårlind (Swoon,ShedNoTears),whopromisesto takeviewersbackto1971,whenthemusicianswerejusttwoboys(Nick,theromanticdreamerandJoakim, thepolitical,existentialist)whoformedatightfriendshipandfellinlovewiththesamegirl.Producedby Milla Films (Sweden)andco-producedby Brokendoll (Sweden), QvistenAnimation (Norway), ParceQueFilms (Canada)and ElasticFilms (U.K.),the80-minuteiflmistargetingyoungadultandadultaudiences.We’llbe waitingpatiently.

PerhapsnoothereventpredictsthefutureofEuropeananimatedcinemabetterthanCartoonMovie,which takesplaceeveryspringinBordeaux,France.Thisyear’sedition(March3-5)isno exception:Showcasing50 wide-rangingfeaturesinvariousstagesofdevelopmentandproduction,theeventactsasafascinatingcrystal ball,offeringasamplingofwhattoexpectfromEurope’sanimationsectorintheyearstocome.

CartoonMovie's2026posterwasdesignedbyUkrainianillustratorMashaFoya.

BeforeTheyWereGods

Dreamwalker

Ayounggirlformsamagicalbondwithaboyshemeetsinherdreamsaftersheisdiagnosedwitharareform ofnarcolepsyinthisnewBelgian-French-Irishco-production.Thebeautifullydesigned2Dfeatureisdirectedby RudiMertens,aBelgiananimationveteranwhohasworkedasanimatorandstoryartistonfeaturessuchas TheSecretofKells and Titina andTVseriessuchas Chloe’sCloset and TalkingTomandFriends. Dreamwalker isproducedby VeerleAppelmans andtheteamatBelgium’sViviFilm(Autokar,Titina); JérômeDuc-Maugé (ParmilesluciolesFilmsinFrance);and ClaireFinn (LighthouseStudiosinIreland).

AyaintheDesert

CosmoPrincess

TheHeartoftheDjembe

ThereisnoshortageofbraveyoungheroinesinthemoviesbeingpitchedinBordeauxthisyear.Oneofthe morememorableyounggirlsistheprotagonistof CottonwoodMedia’snewfeature, TheHeartofthe Djembe,whichfollowseight-year-oldImaniinthevillageofAlkeboulane.Whenaterribledroughtstrikesher homeland,Imanigoesinsearchofreliefinthewildandseeksthehelpofthegodofabundance,whilekeeping herdreamofplayingthedjembedrumalive.Basedona2023shortby AniEliam,thiscolorfulpicisdirected by MathieuVavril (artdirectoronCottonwood’s AroundtheWorldin80Days).CottonwoodMediaveterans ZoéCarreraAllaix, DavidMichel and CécileLaurenson areproducingthemovie,withco-producersEliam (BooyaStudios)and CédricIland (Umedia).

It’salwaysexcitingwhenoneofourfavoriteEuropeanproducers, RonDyens (Flow,LongWayNorth),bringsa newprojecttoCartoonMovie. CosmoPrincess isanexcitingsci-ifadventurebythesuper-talentedwriterdirector QuentinRigaux (whodirectedvisuallypoppingmusicvideosforDuaLipaandTheWeekndandthe short GoldenHour).The90-minute,2Dspaceepiccentersontherelationshipbetweenalostastronautanda diiffcultiesinherlife,AyaimaginestheadventuresofthelegendaryBaouléQueenAkwaBoni,whosecourage mirrorsherown,andkeepsthememoriesofhermotheralive.The90-minute,2D-animatedprojecttargets youngadultsandadults,andiscurrentlyindevelopmentat AlhenaProductions —aBarcelona-basedoutift foundedbyCatalanproducer NorbertLlaràs (Timecrimes,TheBabars’Invasion).Theiflm,whichwas spotlightedatAnnecylastyear,couldjoinotherrecentanimatedfeaturessuchasTheBreadwinner and Flee thataddressimportant,challengingissuesofourtimes.

AgirlfromtheIvoryCoastdisguisesherselfasaboyandlfeesthewarinhercountrytoifndshelterinCádiz, Spain,inthispowerfulfeaturewrittenanddirectedbyanimationnewcomer JuliaHorrillo.Asshefaces diiffcultiesinherlife,AyaimaginestheadventuresofthelegendaryBaouléQueenAkwaBoni,whosecourage mirrorsherown,andkeepsthememoriesofhermotheralive.The90-minute,2D-animatedprojecttargets youngadultsandadults,andiscurrentlyindevelopmentat AlhenaProductions —aBarcelona-basedoutift foundedbyCatalanproducer NorbertLlaràs (Timecrimes,TheBabars’Invasion).Theiflm,whichwas spotlightedatAnnecylastyear,couldjoinotherrecentanimatedfeaturessuchasTheBreadwinner and Flee thataddressimportant,challengingissuesofourtimes. CosmoPrincess

United States -

sameworldas Manivald.ThemoviecentersonSaima,adistinguished40-year-oldjudgewhosepartnerLudvig cheatsonherduringaworktrip.ThingsgetworsewhenSaimareceivesawoodenfrogfromhermotherinthe mail.Theprojectisbeingproducedby MarianneOstrat (AlezandraFilm,Estonia),Ivezić (AdriaticAnimation, Croatia), ValentinMaupin (AvecousansVous,France)and AristoteDouradakis.Let’sjusthopewe’reall luckyenoughtowatchSaima’smidlifecrisisunfoldonthebigscreenintheverynearfuture.

KindredSpirits

Expectapackedhousewhenthree-timeOscar-nominateddirector TommMoore (TheSecretofKells,Songof theSea,Wolfwalkers)andhisteamfrombelovedKilkenny,Ireland-basedstudio CartoonSaloon presenttheir wonderfulnewmovieattheevent.Thischarmingprojectissetinlate-19th-centuryNewYorkCity,where Mara,ayoungIrishimmigrant,andTushka,aChoctawboyfarfromhisfamily,formamagicalbondand journeythroughepicadventures,allwhilebeingwatchedoverbythespiritofMara’slatebrother.Pennedby ShelleyDennis and WillCollins,themoviewillbeproducedby AilbheMcCabe (CartoonSaloon)and Thibaut Ruby (Folivari).Describedasaiflmabout“grace,compassionandhumanity,”thisisthekindofanimatedfare we’realltrulyhungryforthesedays.(ReadmoreinourinterviewwithMoorehere.)

Riamise

Japan’sacclaimed Studio4°C isjoiningforceswithItaly’s IbridoStudio andFrance’s SomethingBig foran excitingnew2D-animatedadventuredirectedby FrancescoForti and HirokazuKojima (characterdesigner on ChaO,animatoron Lazarus and ChildrenoftheSea).Thepicisproducedby FedericoTurani (Italy), FrédéricPuech (France)and EikoTanaka (Japan).Thegraphicallystylishmovieissetinacitywithoutwater, consumedbycrimeandoverrunbygiantreptiles.Thisisthedangerousworldwheretwohumanclansbattle forcontrolandwheresocialordercollapseswhenthepolicecommissionerismurdered.It’suptothe commissioner’ssonJonaandhisbravefriendKala,wholivesinthedumps,touncoverthemysteryofthe crystalsandcreateanewfuturefortheircity.Thesci-iffantasy’svisualpizzazzandthrillsandchillsshould keepaudiencesontheedgeoftheirseats.

Starseed

Writer-director AncaDamian isnostrangertotheworldofprestigeEuropeananimation.Hercritically acclaimedmoviessuchas Marona’sFantasticTale and TheIsland havebeenlaudedfortheiroriginalityand beautiful,thought-provokingvisuals.Herlatestfeatureiflm, Starseed,isanAfricanfuturisttime-benderabout Loveness,ayoungalbinogirlwithcosmicpowerswhoarrivesataZimbabweantownshiptosaveitfroma terribledrought.Atrueinternationalco-pro,theepicfantasyisproducedby AparteFilm (Romania)andcoproducedby SpecialTouchStudios (France), Yzanakio (Canada), Wrongmen (Belgium)and Known AssociatesGroup (SouthAfrica).Mediawanistheiflm’sglobalsalesagent.Onething’sforsure:WhereMs. Damianleadsus,we’llgladlyfollow.Jim Queen (Bobbypills)

JimQueen

OneofthefewprojectsscreeningatCartoonMoviewhichissettodeliverinearly2026isdirectors Marco Nguyen and NicolasAthané’swildandmatureanimatedfeature JimQueen.ProducedbyFrenchstudio Bobbypills,whichisbestknownforproducinganimationforHBO Max’sCreatureCommandos, Captain Laserhawk and MyAdventureswithSuperman,themovieisbilledasasatiricaljoyridethoughidentity,fame andqueerculture.Theiflm’sstorylinecentersonapopulargayinlfuencerinPariswhoselifeturnsupside downwhenabizarreviruscalledHeterosisturnsgaymenstraightinstantly.Togetherwiththeaidofascrawny twink,hehastotrackdownaroguedoctorrumoredtohaveacure!Producedby DavidAlrci and Arthur Delebays,theiflmpromisestobeasoutrageousasitsounds,andwecan’twaittoseebigots’tinybrains explodewhenthemoviehitstheatersworldwidethisyear.

United States -

Watch: New Trailers Unveiled at Cartoon Movie (UPDATED)

Animation Magazine

As the grand Cartoon Movie co-production and pitching market unfolds in Bordeaux, France this week, some of the 50 selected projects have shared their first-looks, animatics, teasers and trailers, offering an early glimpse at what may be the next big international animation sensations to hit theaters in coming years.

Watch these colorful compilations (preceded by footage from The Last Whale Singer) below!

In this collection:

Watch these colorful compilations (preceded by footage from The Last Whale Singer) below!

In this collection:

• Kindred Spirits | Tomm Moore | Cartoon Saloon, Folivari

• Halloween vs. Day of the Dead | Celso García | Studio 100 International, 3Doubles Producciones

• Kindred Spirits | Tomm Moore | Cartoon Saloon, Folivari

• The Heart of the Djembe | Mathieu Vavril | Cottonwood Media, Booya Studio, UMedia

• Flick! | Nicolas Pegon | Wizz, Fost

• Halloween vs. Day of the Dead | Celso García | Studio 100 International, 3Doubles Producciones

• The Heart of the Djembe | Mathieu Vavril | Cottonwood Media, Booya Studio, UMedia

• Flick! | Nicolas Pegon | Wizz, Fost

• Monster Mia | Verena Fels | Arx Anima Animation Studios, Peng! Boom! Tschak! –Films, Arx Anima MD, Arxlight Pictures

• Blaise | Dimitri Planchon & Jean-Paul Guigue | KG Productions

• Firebird | Matěj Podskalský & Anna Podskalská | 13KA, Novanima Productions

• Monster Mia | Verena Fels | Arx Anima Animation Studios, Peng! Boom! Tschak! –Films, Arx Anima MD, Arxlight Pictures

• Blaise | Dimitri Planchon & Jean-Paul Guigue | KG Productions

• Firebird | Matěj Podskalský & Anna Podskalská | 13KA, Novanima Productions

• Onno & Ontje – Friends Are the Best Gift | Eliza Plocieniak-Alvarez | Blaue Pampelmuse

• Happy Hunting vs. The Apocalypse | Boris Belghiti, Maxime Paccalet & Pierre Razetto | Kawanimation

• Tukuy | Aline Romero | Huraa Entertainment, Doce Entertainment, Mr. Miyagi Films

• Sam & Julia | Submarine Animation, The M.A.R.K.13 – Group, Superswiss Red, Cielo

• Happy Hunting vs. The Apocalypse | Boris Belghiti, Maxime Paccalet & Pierre Razetto | Kawanimation

Parce Que Films, Elastic Film

• Dreamwalker | Rudi Mertens | Vivi Film, Parmi les Lucioles

Animation Magazine - 05/03/2026

• 13th Floor | Soraya Antelo Morales | Treboamedia

• Jim Queen | Marco Nguyen & Nicolas Athané | Bobbypills, UMedia

In this collection:

• Igi | Natia Nikolashvili | 20 Steps Animation, Heretic

• Kokum | Hassan Yola | Paul Thitges Distributions, Special Touch Studios

• Billie Beat | Nina Wels & Timo Berg | Little Dream Entertainment

• Night Tram | Michaela Pavlátová | Negativ, Sacrebleu Productions, BFilm, Art Shot

In this collection:

• Cosmo Princess | Quentin Rigaux | Sacrebleu Productions

• The Wild and the Tame | Tibor Tibor Banoczki & Sarolta Szabó

• Nine Lives Left | Zacharias Mavroeidis | Wild at Heart

• Detective Kibbles | Benôit Delépine, Antoine Robert & Frédéric Animation

• Betty Balloon | Puk Grasten | Regner Grasten Filmproduktion,

• Ejo | Jacek Rokosz | Animoon, Special Touch Studios, Basement Iyugi

• Pedigree | Greig Cameron & Samantha Cutler | Triggerfish

In this collection:

• Silence Sometimes | Álvaro Robles | Filmakers Monkeys, Ánima

• Cosmo Princess | Quentin Rigaux | Sacrebleu Productions The Wild and the Tame | Tibor Tibor Banoczki & Sarolta Szabó | Domestic Infelicty

In this collection:

• Aya in the Desert | Julia Horrillo Pla | Alhena Production

• Akira’s Flying Wheelchair | Marco Balsamo | TeamTO Films

• Tomi & Erika | Péter Palátsik & Matthias Bruhn | Trickstudio Lutterbeck, Banana Tree Film

Jane, the Fox and Me | Embuscade Films

Video Player

In addition, four of the projects from this year’s special Canadian Spotlight trailers available:

The President’s Daughter | Quarterlife Crisis Productions

Video Player

Shanghai Ballade | Lofty Sky Pictures

Video Player

The Mountain of Dreams | CarpeDiem Film & TV

Video Player

- United States -

Jane, the Fox and Me | Embuscade Films

TeamTO Launches Anime-Inspired Production Division TeamTOKO

Mercedes Milligan

After more than two decades as a leading force in European animation, TeamTO today announced the launch of TeamTOKO Animation, a dedicated anime-inspired production division focused on original animated series and feature films, alongside select high-end service work. The studio also unveiled a refreshed brand identity.

Together, these initiatives mark a significant new chapter for TeamTO, reflecting its creative evolution following a year of post-acquisition stabilization under RIVA Studios and signaling its expanding global ambitions.

TeamTOKO is a creator-led production division dedicated to original 2D and 3D projects rooted in anime-inspired storytelling, developed through close collaboration between European and Japanese talent. The division operates as an integrated yet distinct creative unit within TeamTO, expanding the studio’s creative scope while its established slate of premium 3D CGI projects continues in parallel.

“Anime was our gateway into animation. It’s where our love for the medium truly began. It revealed to us the emotional depth and boundless imagination that animation can hold,” said Tara Sibel, Co-Founder of RIVA Studios. “As TeamTO enters this next chapter, embracing that influence feels both natural and deeply personal. With TeamTOKO, we are honoring TeamTO’s legacy while opening the door to bold new storytelling — carrying it forward with renewed imagination, ambition, and heart.”

TeamTO first hinted at this creative direction at the 2025 Annecy International Animation Film Festival with the announcement of Shadow Soccer (26 x 22’), a shōnen series directed by French filmmaker Slimane Aniss. That momentum continued with the selection of the original animated feature film Akira’s Flying Wheelchair (90’) at the 2026 edition of Cartoon Movie in Bordeaux, developed in collaboration with French, Italian and Japanese talent.

Written, directed and produced by RIVA Studios Co-Founder Marco Balsamo, Akira’s Flying Wheelchair centers on a former child track prodigy who is paralyzed in a fateful accident. When a wacky but brilliant inventor shows up and builds him a flying wheelchair, the duo embark on an unexpected, life-affirming adventure when they crash land in a mystical forest which holds a tragic sequence.

“TeamTOKO marks the beginning of a new era for the studio, rooted in our lifelong love of anime as both a visual language and a storytelling tradition,” said Olivier Plazas, Art Director of TeamTO. “By embedding this expertise at the heart of the studio, we can push stylization, composition, and emotion in bolder, more cinematic ways, while maintaining the level of craftsmanship that defines TeamTO.”

Alongside the launch of TeamTOKO, TeamTO has introduced a refreshed visual identity anchored by the tobiuo, the Japanese word for flying fish, and the inspiration behind the “TO” in TeamTO. A symbol of movement, transition, and creative freedom, the flying fish reflects the studio’s ability to move fluidly between cultures and storytelling traditions, honoring its longstanding admiration for Japanese animation while remaining firmly rooted in its European

TeamTOKO debuts with its own complementary logo and visual identity, signaling a focused creative direction defined by cross-cultural exchange, authorship, and artistic ambition.

For more information, visit TeamTO.com.

‘Betty Balloon’ Takes Off with Sales Agency LevelK

Mercedes Milligan

Copenhagen-based international sales and aggregation house LevelK has secured worldwide rights to Puk Grasten’s (The Quiet Ones) upcoming preschool animated feature and TV series Betty Balloon. The agreement — finalized between LevelK CEO Tine Klint and the film’s main producer Regner Grasten (The Crumbs’ Christmas) — was reached just ahead of the project’s work-in-progress presentation at Cartoon Movie in Bordeaux.

A theatrical release of the animated feature is scheduled for October 2026 in Denmark, with Danish pubcaster TV2 set to premiere the series.

Currently in production, Betty Balloon follows a modern family who just happen to be … balloons. At the center of the story is Betty, a creative and imaginative four-year old. Life’s turned upside down when a cactus family moves in next door. The Balloon family must learn to connect with their new neighbors, but it’s the kids who lead the way: Betty quickly becomes friends with four-year-old Caj Cactus, proving that curiosity and openness can bridge even the prickliest divides. In the Betty Balloon universe, it’s the kids who show the grown-ups how to connect.

“Teaching through entertainment is important, and Betty Balloon and Cai Cactus have to navigate the challenges of living next to each other, becoming friends, and simply being who they are,” said Klint. “Their creative minds make the journey fun.”

“The unlikely friendship between a balloon and a cactus symbolizes openness and acceptance,” producer Regner Grasten explained. “[These are] values that both preschoolers and adults can relate to. This dynamic stands out from more traditional family set-ups seen in shows like Peppa Pig and Bluey, offering an alternative vision of community and empathy.”

Director Puk Grasten added, “In Betty Balloon, the unknown is not dangerous. It is an invitation to open up. The film celebrates openness, imagination, and emotional honesty.”

Betty Balloon is produced by Regner Grasten for Regner Grasten Filmproduktion, in coproduction with Karsten Kiilerich for A. Film Production, and is supported by the Danish Film Institute, TV2 Denmark, VestDansk Filmpulje and Nordisk TV og Film Fond.

Besides the feature and the TV series, development is also underway on Betty Balloon books and merchandising lines.

regnergrastenfilm.dk | levelk.dk

Cartoon Movie 2026 Committee Selects 50 Animated Feature Projects

Cartoon Movie 2026 Committee Selects

By Mercedes Milligan December 15, 2025

50 Animated Feature Projects

Cartoon Movie 2026 Committee Selects

By Mercedes Milligan December 15, 2025

50 Animated Feature Projects

From a record-breaking 150 submissions, the Selection Committee of Cartoon Movie 2026 has picked 50 projects to participate. The next edition of the co-production and pitching event dedicated to European animated feature ﬁlms will be held in Bordeaux, France from March 3-5, 2026.

By Mercedes Milligan

December 15, 2025

Facebook Twitter Linkedin

Cartoon Movie 2026 targets

From a record-breaking 150 submissions, the Selection Committee of Cartoon Movie 2026 projects to participate. The next edition of the co-production and pitching event dedicated to European animated feature ﬁlms will be held in Bordeaux, France from March 3-5, 2026.

Cartoon Movie 2026 targets

The selected projects represent 21 countries involved as the main nation of production. Including the projects Kokum and Saima: Scenes from a Midlife Crisis which have two and three main producer-countries, respectively, the class of 2026 is once again dominated by France with 15 projects, followed by Germany (six) and Spain (ﬁve).The CEE & UA region holds strong following its big splash last year, with 11 projects hailing from Croatia, Czechia, Estonia, Georgia, Hungary, Poland and Romania. This year’s showcase will also feature four projects from Nordic Countries (Denmark, Norway & Sweden).

The selected projects represent 21 countries involved as the main nation of production. Including the

Jim Queen [Bobbypills / Umedia]

The majority of selected projects (30) are listed under In Development status, with 12 In Concept, seven In Production and one completed Sneak Preview (the French/Belgian queer action-comedy Jim Queen, aimed at adults/young adults). Indeed, adult and YA-targeted projects are still on the rise, nearly caught up to the number of Family audience titles (21) with 19 more mature offerings. The selection also includes five films for children, three for preschool and two titles aimed specifically at teens.

Adult/YA projects now represent 38% of the lineup, compared to 30% last year, while all children’s and family projects are 58% of the program combined.

Detective Kibbles [La Station Animation]

Regionally, France’s Nouvelle-Aquitaine is represented by eight projects:

Five are supported by the Nouvelle-Aquitaine Region and by ALCA: Blaise (KG Productions), Detective Kibbles (La Station Animation), JimQueen (Bobbypills), Pangea (Miyu Productions) & Smecheria or the Conﬁdences of a Cheat (Walking the Dog [Belgium], in co-production with Hutong Productions and Aparte Film [Romania]). Pangea & Detective Kibbles will likely be produced in Angoulême studios.

HappyHuntingvstheApocalypse is produced by the Bordeaux-based studio Kawanimation.

Novanima Productions, based in Nouvelle-Aquitaine, is the co-producer of the Czech project Firebird (13ka).

The regional co-writers and co-directors Chintis Lundgren & Draško Ivezić are involved in Saima: Scenes From a Midlife Crisis.

JimQueen (Bobbypills) is supported by the Charente departement.

Catégories : Long-métrages

Tags : cartoon movie

Catégories : Long-métrages

Tags : cartoon movie

LONG-MÉTRAGES LONG-MÉTRAGES

LONG-MÉTRAGES

Cartoon Movie 2026 : petit

tour d'horizon

Cartoon Movie 2026 : petit tour d'horizon

Comme chaque année, je jette un rapide coup d'oeil sur les projets de long métrages d'animation européens sélectionnés pour le festival pro du Cartoon Movie (rarement évoqués, d'une part car les médias parlent déjà à peine d'animation quand ça sort, et aussi sans doute car ces films n'existeront peut-être jamais). Et même si je sais que je suis très suivi (notamment côté pro(ducteur)s qui ratissent mes veilles), je fais ce genre de pré-curation de manière toujours aussi personnelle, à vue de nez/affinités, sans critères marchés ;-]

Les projets retenus pour l'édition 2026 viennent donc d'être annoncés, et je suis déjà content de repérer une co-production Italie/Japon/France avec le Studio 4°C, un projet de Quentin Rigaux que j'avais fait décoller, le nouveau film de Tomm Moore & Cartoon Saloon, ou encore le nouveau projet de Patrick Imbert (son précédent étant donc sans doute désormais dans les cartons).

En fin de news je pointe aussi d'autres projets sur lesquels je garderai un oeil.

- "Riamise", projet produit par Ibrido (Italie), Studio 4°C (Japon) et Something Big (France). Réalisé par Francesco Forti, avec en co-réalisateur Hirokazu Kojima (character-designer de ChaO, que j'avais aussi remis en avant cette année pour son méconnu "Shoka").

https://www.catsuka.com/breves/2025-12-16/cartoon-movie-2026-petit-tour-d-horizon

19/12/2025, 16:08 Cartoon Movie 2026 : petit tour d'horizon - News | Catsuka

https://www.catsuka.com/breves/2025-12-16/cartoon-movie-2026-petit-tour-d-horizon

2/22 - "Cosmo Princess", projet de Quentin Rigaux que j'avais propagé au printemps dernier. Désormais soutenu et produit par Sacrebleu (France).

19/12/2025, 16:08

- 16/12/2025

Movie 2026 : petit tour d'horizon - News | Catsuka

- "Cosmo Princess", projet de Quentin Rigaux que j'avais propagé au printemps dernier. Désormais soutenu et produit par Sacrebleu (France).

"Kindred Spirits", le prochain

19/12/2025, 16:08

https://www.catsuka.com/breves/2025-12-16/cartoon-movie-2026-petit-tour-d-horizon

film

Tomm Moore & Cartoon Saloon (Brendan et

Secret de Kells, Le Chant de la mer, Wolfwalkers...).

Cartoon Movie 2026 : petit tour d'horizon - News | Catsuka

19/12/2025, 16:08

Movie 2026 : petit tour d'horizon - News | Catsuka

- "Flick!", un projet produit par (et je suis donc heureux qu'un des membres de CRCR développe enfin un film ;-).

https://www.catsuka.com/breves/2025-12-16/cartoon-movie-2026-petit-tour-d-horizon

- "Hakim's Odyssey", le nouveau projet de long métrage d'animation de Patrick Imbert ("Le Sommet des dieux"), basé là encore sur une BD (du même nom) et le témoignage d'un réfugié syrien qui a fui la guerre pour rejoindre la France. Produit par Solab Films & Folivari (France).

19/12/2025, 16:08

Movie 2026 : petit tour d'horizon - News | Catsuka

https://www.catsuka.com/breves/2025-12-16/cartoon-movie-2026-petit-tour-d-horizon

Cartoon

Je garde donc aussi sur mon radar "Happy Hunting vs the Apocalyspe" (aka le film de la série "Le Bien Chasser" par le studio Kawanimation, pour les plus attentifs ;-), "Starseed" (le nouveau film d'Anca Damian), "Pangea" (le nouveau film de Simon Rouby qui avait signé "Adama"), "Sander’s Midsummer" (par Hanne Berkaak), "Saima: Scenes from a Midlife Crisis" (par le duo Chintis Lundgren & Draško Ivezić), "Kokum" (par Hassan Yola, ancien des Gobelins), "Akira’s Flying Wheelchair" (parce que TeamTO a failli sombrer quand même), "Blaise" (film dérivé de la série du même nom de Dimitri Planchon & Jean-Paul Guigue), "Cornebidouille" (parce qu'il y a Benoit Chieux au dev visuel), "Smecheria or the Confidences of a Cheat" (parce qu'il y a Joost Jansen au dev visuel), "Ejo" (parce qu'il y a Fabrice Nzinzi au dev visuel), "Detective Kibbles" (parce que Benoît Delépine aime le dessin ;-) ...

Et puis il y a comme toujours aussi les projets dont les visuels m'intriguent, comme "Igi", "Before They Were Gods" ou "Family Squad".

Toutes les fiches projets sont donc visibles ici.

L'édition 2026 du festival pro du Cartoon Movie se tiendra du 3 au 5 mars 2026 à Bordeaux (France).

From Catsuka on Twitter and beyond.

https://www.catsuka.com/breves/2025-12-16/cartoon-movie-2026-petit-tour-d-horizon

Cartoon Movie 2026 Projects

Reveal

Shifting

EVENTSFEATURE FILMMARKETS

Audiences And Creative Priorities In European Animation

By JAMIE LANG

| 12/16/2025 6:53 am | Be the First to Comment!

Cartoon Movie 2026 Projects Reveal Shifting Audiences And Creative Priorities In European Animation

Stay informed with free updates: Sign up to get our news digest — delivered directly to your inbox twice a week.

Email Address Subscribe

By JAMIE LANG

| 12/16/2025 6:53 am | Be the First to Comment!

From a record-breaking 150 submissions, Cartoon Movie 2026 has unveiled a selection of 50 animated feature projects from 21 countries that will participate in next year’s Bordeaux-based event, which will run March 3-5.

Stay informed with free updates: Sign up to get our news digest — delivered directly to your inbox twice a week.

Email Address Subscribe

Cartoon Movie has long stood as one of the most influential co-production and pitching forums for European animation. Each year, the event reflects both the diversity and vitality of the sector, with strong representation from Central and Eastern Europe, the Nordic countries, and a particularly robust showing from the Nouvelle-Aquitaine region, which accounts for eight projects across production, co-production, writing, and directing.

Next year’s slate showcases the capabilities of European studios of all sizes and the tremendous talent working across the continent, from emerging voices to established players. Projects in all stages of development, from early concepts to films nearing completion, have been selected to show off what they’ve got cooking. Titles that make use of AI are admitted, but the ways in which the technology is used must be disclosed as part of their pitch.

Next year’s slate showcases the capabilities of European studios of all sizes and the

The 2026 lineup also reveals clear editorial and industrial trends shaping today’s animated feature landscape. Cartoon Movie has long been one of the best prognosticators of where the industry is heading.

Many of the selected projects focus on stories drawn from everyday life, with 38% actively championing diversity and inclusion as a core narrative driver. Female talent is increasingly prominent: 37% of the projects are directed by at least one woman, 52% are led by a female producer, and nearly half feature a female main character.

Titles aimed at young adult and adult audiences continue to grow in popularity and number, now representing 38% of the selection, up from 30% in the previous edition. Children and family films remain the industry’s main driver, however, accounting for 58% of projects.

Notably, the selection also includes projects whose creators previously made a splash at Cartoon Springboard in Madrid, a pitching event for early-stage projects. The linear progression from one Cartoon-backed event to the next is another ringing endorsement for a pipeline that plays a crucial role in the lifecycle of European animated projects.

Founded in 1999, Cartoon Movie has built its reputation on a highly efficient, distinctly human-centered format that fosters cooperation among producers, investors, distributors, and sales agents from across Europe.

Projects can be presented at four different stages — concept, development, production, or sneak preview — allowing the industry ecosystem to engage early in a film’s journey and increasing the likelihood of a successful release.

CartoonMovieTributes2026:Allthe EuropeanNomineesRevealed

Producers,distributorsanddirectorsfromnineEuropeancountrieshave beennominatedfortheCartoonMovieTributes,whichcelebratethemost outstandingachievementsinEuropeananimationoverthepreviousyear.

by LucaTricerri —18February2026in Highlights, News

The winners will be voted by the professionals attending Cartoon Movie, the pitching and coproduction event for animated feature iflms that will hold its next edition on March 3 to 5 in the French city of Bordeaux, Nouvelle-Aquitaine.

Nineteen European companies and organisations share the spotlight in the Producer of the Year category as co-producers of four feature iflms that were presented at Cartoon Movie in development stages.

development stages.

French companies Folimage and Les Armateurs, in co-production with Belgium’s Lunanime and Dragons Films, and France’s Auvergne-Rhône-Alpes Cinéma, JPL Films, Pictanovo and TNZPV Productions, are behind “The Songbirds’ Secret” by Antoine Lanciaux, the ifrst feature iflm to be made entirely with paper cut-outs in a century. After being presented in development at Cartoon Movie 2019 and screened as a sneak preview at the same event in 2025, the iflm has been selected for more than 50 international festivals.

“Stitch Head” is a co-production led by Germany’s Gringo Films, alongside Luxembourg’s Fabrique d’images and Germany’s Senator Film Produktion and Traumhaus Studio. Co-directed by Steve Hudson and Toby Genkel, the iflm is a 3D animated monster fantasy comedy aimed at children and family audiences that was released in Europe in October 2025. It was presented in concept at Cartoon Movie 2017 and returned to the event in development stage two years later.

“Tales from the Magic Garden” is a stop-motion animated puppet feature collectively directed by David Súkup, Patrik Pašš, Leon Vidmar and Jean-Claude Rozec. Addressing grief and the healing power of imagination, the iflm is an international co-production involving MAUR iflm (Czech Republic), Vivement Lundi ! (France), Artichoke (Slovakia) and ZVVIKS (Slovenia). At

The European Animation Journal18/02/2026

Fabrique d’images and Germany’s Senator Film Produktion and Traumhaus Studio. Co-directed by Steve Hudson and Toby Genkel, the iflm is a 3D animated monster fantasy comedy aimed at children and family audiences that was released in Europe in October 2025. It was presented in concept at Cartoon Movie 2017 and returned to the event in development stage two years later.

Stitch Head” is a co-production led by Germany’s Gringo Films, alongside Luxembourg’s Fabrique d’images and Germany’s Senator Film Produktion and Traumhaus Studio. Co-directed by Steve Hudson and Toby Genkel, the iflm is a 3D animated monster fantasy comedy aimed at children and family audiences that was released in Europe in October 2025. It was presented in concept at Cartoon Movie 2017 and returned to the event in development stage two years later.

France’s Special Touch Studios and Creative Touch Studios, Luxembourg’s Paul Thiltges Distributions, Canada’s Yzanakio, together with Belgium’s Need Productions and Lunanime, complete the list of nominees in this category with “Allah Is Not Obliged”, Zaven Najjar’s feature debut. Starring a Guinean orphan forced to become a child soldier, the iflm was presented in development at Cartoon Movie 2018, had its world premiere at the Annecy Film Festival, and set for a theatrical release in France on March 4 this year.

France’s Special Touch Studios and Creative Touch Studios, Luxembourg’s Paul Thiltges Distributions, Canada’s Yzanakio, together with Belgium’s Need Productions and Lunanime, complete the list of nominees in this category with “Allah Is Not Obliged”, Zaven Najjar’s feature debut. Starring a Guinean orphan forced to become a child soldier, the iflm was presented in development at Cartoon Movie 2018, had its world premiere at the Annecy Film Festival, and is set for a theatrical release in France on March 4 this year.

Meanwhile, companies from Croatia, France and Spain contend for the Distributor of the Year award. Drawing on its vast experience as a theatrical exhibitor, Croatia’s Kino Mediteran made the leap into distribution in 2014. Focusing on European independent iflms, its catalogue includes titles such as “Fox and Hare Save the Forest”, “Taifti – Across the Desert” and “Diplodocus”, and the company has a network of cinemas throughout more than 20 Croatian coastal towns.

both geographically and format-wise, the company has distributed titles such as “Living Large”, Gruffalo” and “Petite Casbah”, among others.

Created by Emmanuelle Chevalier and Marie-Agnès Bourillon in 2000, Paris-based Les Films du Préau is engaged in the distribution of iflms for young audiences. With a diverse catalogue,

both geographically and format-wise, the company has distributed titles such as “Living Large”, “The Gruffalo” and “Petite Casbah”, among others.

Created by Emmanuelle Chevalier and Marie-Agnès Bourillon in 2000, Paris-based Les Films du Préau is engaged in the distribution of iflms for young audiences. With a diverse catalogue, both geographically and format-wise, the company has distributed titles such as “Living Large”, “The Gruffalo” and “Petite Casbah”, among others.

Founded in June 2000, Madrid-based Flins & Pinículas is dedicated to distributing high-quality iflms for family audiences in Spain. With titles such as “The Amazing Maurice”, “Niko: Beyond the Northern Lights” and “Zak & Wowo”, animation plays a central role in its catalogue.

The ifve directors selected for the Directors of the Year category have won international recognition at iflm festivals and awards ceremonies with projects that were presented at Cartoon Movie during their development stages.

Irene Iborra Rizo has become the ifrst woman to direct a stop-motion feature iflm in Spain with her feature debut “Olivia and the Invisible Earthquake”. A co-production between Spain, Belgium and France, this social drama aimed at family audiences had its world premiere at the Annecy Festival and has been nominated for both the European Film Awards and the Goya 2026. The iflm follows a 12-year-old girl who sees her world turning upside down when her family is evicted from their home.

Irene Iborra Rizo has become the ifrst woman to direct a stop-motion feature iflm in Spain with her feature debut “Olivia and the Invisible Earthquake”. A co-production between Spain, Belgium and France, this social drama aimed at family audiences had its world premiere at the Annecy Festival and has been nominated for both the European Film Awards and the Goya Awards 2026. The iflm follows a 12-year-old girl who sees her world turning upside down when her family is evicted from their home.

French directors Maïlys Vallade and Liane-Cho Han make their feature debut with “Little Amelie”, an adaptation of Amélie Nothomb’s bestseller “The Character of Rain”. This poetic and deeply moving coming-of-age story has been selected for nearly 40 international festivals — including Annecy, where it won the Audience Award 2025 — and has been nominated for major awards, including the 98th Academy Awards, the César Awards and the European Film Awards.

Reza Memari’s “The Last Whale Singer” is the German-Iranian director’s second feature iflm following “Richard the Stork”. An animated fantasy for family audiences, the iflm stars Vincent, the orphaned son of the last Whale Singer. Pitched at Cartoon Movie at various stages — in concept in 2018, in development in 2020 and in production in 2025 — the iflm is a co-production between Germany, the Czech Republic and Canada and has already been sold in more than 30 international territories.

Rounding out the category is French director, writer and illustrator Ugo Bienvenu with “Arco”, a

Rounding out the category is French director,

with “

”, a

Rounding out the category is French director, writer and illustrator Ugo Bienvenu with “Arco”, a sci-if iflm premiered at Cannes that won several awards at Annecy and the European Film

including Annecy, where it won the Audience Award 2025 — and has been nominated for major awards, including the 98th Academy Awards, the César Awards and the European Film Awards.

European Animation Journal18/02/2026

Rounding out the category is French director, writer and illustrator Ugo Bienvenu with “Arco”, a sci-if iflm premiered at Cannes that won several awards at Annecy and the European Film Awards. Bienvenu’s debut tells an optimistic and colourful story about Arco, a boy from an idyllic future who accidentally lands in 2075 and, with the help of a young girl named Iris, shares a hopeful vision of the future before ifnding his way home. The iflm is in the race for Best Animated Feature Film at the Academy Awards, as well as for the César Awards and the Annie Awards.

CARTOON MOVIE TRIBUTES 2026 NOMINEES

European Producer of the Year

Folimage / Les Armateurs (France) / Lunanime (Belgium) / Auvergne-Rhône-Alpes Cinéma / JPL Films (France) / Dragons Films (Belgium) / Pictanovo / TNZPV Productions (France) for “The Songbirds’ Secret”.

Gringo Films (Germany) / Fabrique d’Images (Luxembourg) / Senator Film Produktion / Traumhaus Studios (Germany) for “Stitch Head”.

MAUR iflm (Czech Republic) / Vivement Lundi ! (France) / Artichoke (Slovakia) / ZVVIKS (Slovenia) for “Tales from the Magic Garden”.

Special Touch Studios / Creative Touch Studios (France) / Paul Thiltges Distributions (Luxembourg) / Yzanakio (Canada) / Need Productions / Lunanime (Belgium) for “Allah Is Not Obliged”.

European Distributor of the Year

Flins y Pinículas (Spain).

Les Films du Préau (France).

Kino Mediteran (Croatia).

European Director of the Year

Irene Iborra Rizo for “Olivia and the Invisible Earthquake”.

Maïlys Vallade & Liane-Cho Han for “Little Amelie”.

Reza Memari for “The Last Whale Singer”.

Ugo Bienvenu for “Arco”.

Tags:

Reza Memari and ‘The Last Whale Singer’ Lead Cartoon Movie Tributes Winners

By Dan Sarto |

Zaven Najjar’s feature debut ‘Allah Is Not Obliged’ also wins, along with Paris-based independent distributor Les Films du Préau, at the forum’s 28th edition wrapping today in Bordeaux.

Thursday, March 5, 2026 at 2:28pm

Zaven Najjar’s feature debut ‘Allah Is Not Obliged’ also wins, along with Paris-based independent distributor Les Films du Préau, at the forum’s 28th edition wrapping today in Bordeaux.

Reza Memari and ‘The Last Whale Singer’ Lead Cartoon Movie Tributes Winners

By Dan Sarto

| Thursday, March 5, 2026 at 2:28pm

Zaven Najjar’s feature debut ‘Allah Is Not Obliged’ also wins, along with Paris-based independent distributor Les Films du Préau, at the forum’s 28th edition wrapping today in Bordeaux.

By Dan Sarto

| Thursday, March 5, 2026 at 2:28pm

| Thursday, March 5, 2026 at 2:28pm In 2D 3D Geographic Region:

Reza Memari’s ‘The Last Whale Singer.’

European animation industry professionals attending Cartoon Movie have named the winners of the 2026 Cartoon Tributes, recognizing companies and individuals whose work made a notable impact on the European animation sector over the previous year. The awards were presented during the forum’s 28th edition that just concluded in Bordeaux, France.

Reza Memari’s ‘The Last Whale Singer.’

The Producer of the Year prize went to Special Touch Studios (France), Paul Thiltges Distributions (Luxembourg), Lunanime (Belgium), Need Productions (Belgium), and Yzanakio (Canada) for AllahIsNotObliged, the feature debut of director Zaven Najjar. The film, which follows a Guinean orphan forced to become a child soldier, was first presented in development at Cartoon Movie in 2018, premiered at the Annecy International Animation Film Festival, and was released in French cinemas on March 4.

Distributor of the Year was awarded to Paris-based Les Films du Préau, an independent distribution company specializing in films for young audiences. Founded in 2000 by Emmanuelle Chevalier and Marie-Agnès Bourillon, the company’s catalogue includes more than 200 titles such as LivingLarge, The Gruffalo, and Petite Casbah.

Director of the Year was awarded to Reza Memari for TheLastWhaleSinger, his second animated feature following Richard the Stork. The film centers on Vincent, the orphaned son of the last Whale Singer, who must confront his fears and discover his voice to help save the oceans. The project was presented at Cartoon Movie at several stages, from concept in 2018 to development in 2020 and production in 2025. The film is a co-production between Germany, the Czech Republic, and Canada and has been sold in more than 30 international territories.

The awards ceremony took place at the Palais des Congrès de Bordeaux, where 50 animated projects from 21 countries were presented across two days to potential partners and investors.

Also nominated in the Producer of the Year category were Folimage, Les Armateurs, Lunanime, Auvergne-Rhône-Alpes Cinéma, JPL Films, Dragons Films, Pictanovo, and TNZPV Productions for TheSongbirds’Secret; Gringo Films, Fabrique d’Images, Senator Film Produktion, and Traumhaus Studios for Stitch Head; and MAUR film, Vivement Lundi !, Artichoke, and ZVVIKS for TalesfromtheMagicGarden

In the Director of the Year category, additional nominees included Irene Iborra Rizo for Olivia and the Invisible Earthquake, Maïlys Vallade and Liane-Cho Han for Little Amélie or the Character of Rain, and Ugo Bienvenu for Arco. For Distributor of the Year, the nominees were Flins y Pinículas (Spain) and Kino Mediteran (Croatia).

Since its first edition in 1999, Cartoon Movie has helped support financing for 513 animated features with a combined budget of €3.42 billion. Organized by CARTOON, the annual forum aims to strengthen the production and distribution of animated feature films in Europe and receives support from Creative Europe – MEDIA, CNC, Région Nouvelle-Aquitaine, Bordeaux Métropole, Magelis, and France Télévisions. The Brussels-based non-profit association CARTOON also organizes Cartoon Forum and training seminars including CartoonNext, Cartoon Springboard, and Cartoon Business.

Source: CARTOON

Dan Sarto is Publisher and Editor-in-Chief of Animation World Network.

Press release - 24 February 2026

EUROPA DISTRIBUTION WORKSHOP

CARTOON MOVIE - 3-6 March 2026

Brussels, 24 February 2026

Europa Distribution continues its various events and activities, once again strengthening its long-standing and successful collaboration with Cartoon Movie (3-6 March). This partnership, establishedmore than 15 years ago, aims to enhance access for independent film publishers and distributors to the most importantmarket and pitching event dedicated to European animated films. It provides a valuable opportunity for the European Network to refine its members’release strategies, promotional campaigns and innovative initiatives, with a particular focus on animation.

Aclosed workshop will take place on Tuesday March 3 and host case studies on recent European animation films’releases in various markets. On this occasion, distributors Vanessa Ciszewski (Luftkind Filmverleih, Germany), Michal Dvorak (Zero Gravity, Czech Republic), Florian Hafsia (Distri 7, Belgium), Adeline Margueron (Le Parc Distribution, Belgium), Richard Reiter (Filmladen Filmverleih, Austria) and Igor Stankovic (MCF MegaCom Film, Serbia) will share their marketing and release strategies for several animation films released recently. Particularly, they will present detailed analysis on the following films: Animal Tales of Christmas Magic (DE), Arco (FR, US), Falcon Express (FR), Hola Frida (FR, CA) and Tafiti – Across the Desert (DE). The activity in Cartoon Movie provides distributors from a wide range of countries the opportunity to meet, network, share best practices and acquisition strategies and discuss the latest developments in animation.

In the coming months, Europa Distribution will continue its discussions on the unique challenges faced in the circulation, release and promotion of independent European ﬁlms. Europa Distribution will hold a workshop on the release of European documentaries at CPH:DOX from 15-18 March and right after that, a training dedicated to communication and negotiation, followed by a common working session with exhibitors from Europa Cinemas at the Soﬁa Meetings from 18-22 March. Afterwards, ED will hold the closing session for their EDMS mentorship programme in Brussels on April 10 and a workshop focusing on Asian releases in the scope of Focus Asia, from 26-29 April in Udine.

Eleven projects represented are from CEE countries and UA (HR, CZ, EE, GE, HU, PL and RO), and four projects are from Nordic countries (DK, NO and SE). The co-production and pitching event for European animated feature films will take place in Bordeaux, France, from March 3 to 5.

Five of the selected projects are supported by the Nouvelle-Aquitaine Region and accompanied by ALCA: Blaise (KG Productions), Detective Kibbles (La Station Animation), Jim Queen (Bobbypills), Pangea (Miyu Productions) and Smecheria or theConfidences of a Cheat (Walking the Dog, BE, in co-production with Hutong Productions and Aparte Film, RO). Pangea and Detective Kibbles will likely be produced in the Angoulême studios.

Cartoon Movie 2026 Selects Projects

�� Kloudia Sakowski

1 day ago

The selection committee of Cartoon Movie has chosen 50 projects from 21 countries after a record-breaking 150 submissions for its 2026 event, taking place from March 3 to 5.

More info on ZDF Studios’ Weiss & Morales.

HappyHuntingvstheApocalypse is produced by the Bordeaux-based studio Kawanimation. Novanima Productions, based in the region Nouvelle-Aquitaine, is the co-producer of the Czech project Firebird. The regional co-writers and co-directors Chintis Lundgren and Draško Ivezić are involved in Saima: Scenes From a Midlife Crisis. Jim Queen (Bobbypills) is supported by the Charente department.

Of the projects, 38 percent actively champion diversity and inclusion at the heart of their storytelling. 37 percent of the projects are directed by at least one woman, and over half (52 percent) are driven by at least one lead female producer. 48 percent of the selected projects feature a female main character, showcasing powerful stories such as Carmen and the Wooden Spoon (Thinkwild Studios, ES) or Billie Beat (Little Dream Entertainment, DE).

Content for young adults and adult audiences now represents 38 percent of the lineup, compared to 30 percent in 2025. Meanwhile, 58 percent of the selected projects target children and family audiences.

More info on ZDF Studios’ Weiss & Morales.

HappyHuntingvstheApocalypse is produced by the Bordeaux-based studio Kawanimation. Novanima Productions, based in the region Nouvelle-Aquitaine, is the co-producer of the Czech project Firebird. The regional co-writers and co-directors Chintis Lundgren and Draško Ivezić are involved in Saima: Scenes From a Midlife Crisis Jim Queen (Bobbypills) is supported by the Charente department.

MOVIE FAÇONNE L’AVENIR DE L’ANIMATION EUROPÉENNE AVEC 50 NOUVEAUX PROJETS DE LONGS MÉTRAGES

CARTOON MOVIE FAÇONNE L’AVENIR DE L’ANIMATION EUROPÉENNE AVEC 50 NOUVEAUX PROJETS DE LONGS MÉTRAGES

Les 50 projets de longs métrages d’animation sélectionnés pour la 28ᵉ édition de Cartoon Movie auront l’opportunité d’accélérer leur financement et d’élargir leur portée internationale. Choisis parmi un nombre record de 150 candidatures – soit une augmentation de 22 % par rapport à l’édition précédente – ces projets seront présentés à des coproducteurs, agents de vente, distributeurs, responsables de plateformes de streaming, éditeurs et investisseurs, ainsi qu’à d’autres acteurs clés de l’industrie cinématographique. Considéré comme l’un des principaux événements européens dédiés à la coproduction et au pitch de projets d’animation, Cartoon Movie se tiendra à Bordeaux du 3 au 5 mars.

Issus de 21 pays européens, les projets sélectionnés témoignent de la vitalité actuelle de l’animation européenne. La sélection réunit à la fois des voix émergentes et des réalisateurs reconnus, des projets d’auteur comme des œuvres destinées à un large public, ainsi que des productions portées par de jeunes studios indépendants aux côtés de sociétés de production de renommée internationale.

Abordant une grande diversité de thématiques, les projets se déroulent aussi bien dans des univers réalistes que fantastiques et couvrent un large éventail de genres cinématographiques, parmi lesquels l’aventure, l’action, la comédie, le drame, la science-fiction ou encore le documentaire.

La France arrive en tête de la sélection avec 15 projets, suivie de l’Allemagne avec 6 projets et de l’Espagne avec 5. Les pays d’Europe centrale et orientale (République tchèque, Croatie, Estonie, Géorgie, Hongrie, Pologne et Roumanie) totalisent 11 projets, tandis que la région nordique –Danemark, Norvège et Suède – est représentée par 4 projets. La Belgique, l’Italie, l’Irlande et les Pays-Bas comptent chacun 2 projets, tandis que l’Autriche, la Grèce, le Luxembourg et l’Ukraine complètent la sélection avec un projet chacun.

Partager ce contenu au moyen de

La Radio du Cinéma – Répliques & musiques de ﬁlms 24/7

https://radioducinema.radio-website.com/agenda/cartoon-movie-2026-b...

La Radio du Cinéma – Répliques & musiques de films 24/7

Du mardi 3 au jeudi 5 mars 2026, la planète animation pose ses valises à Bordeaux (NouvelleAquitaine) pour Cartoon Movie, forum européen de pitching et de coproduction dédié au long métrage animé. Objectif : repérer les projets qui feront parler d’eux, rencontrer les décideurs du secteur, et accélérer le financement des films en développement.

Cartoon

Movie,

un radar pour repérer les films animés qui arrivent

Cartoon Movie, un radar pour repérer les films animés qui arrivent

Cartoon Movie n’est pas un festival : ici, pas de tapis rouge ni de compétition officielle, mais un format conçu pour faire avancer des projets concrets. Des producteurs y présentent leurs films à un public de professionnels (producteurs, acheteurs, distributeurs, diffuseurs, plateformes, vendeurs internationaux), avec une promesse simple : donner aux projets la visibilité et les partenaires nécessaires pour passer à l’étape supérieure.

Le palmarès « indirect » parle de lui-même : des films comme Arco (Ugo Bienvenu) ou Amélie et la métaphysique des tubes ont été pitchés à Cartoon Movie avant de voyager largement. Pour les pros, c’est souvent le premier endroit où l’on entend parler d’un projet au bon moment : quand tout reste possible, y compris un casting international, une coproduction stratégique, ou un distributeur qui s’engage tôt.

Ce qui vous attend du 3 au 5 mars 2026 à Bordeaux

Sur trois jours, Cartoon Movie enchaîne sessions de pitch, rencontres ciblées et temps forts de networking. Le programme officiel annonce notamment :

• Mardi 3 mars : Cartoon Talks et rendez-vous one-to-one (de 14 heures à 18 heures), puis dîner d’accueil.

• Mercredi 4 mars : journée de pitches et moments de networking (dont formats “show” autour des pauses déjeuner/café).

• Jeudi 5 mars : poursuite des pitches, clôture et cocktail de départ en soirée.

• Mercredi 4 mars : journée de pitches et moments de networking (dont formats “show” autour des pauses déjeuner/café).

• Jeudi 5 mars : poursuite des pitches, clôture et cocktail de départ en soirée.

À noter : les one-to-one sont planifiés à l’avance sur la base des demandes des participants, avec des créneaux annoncés de 20 minutes. Les Cartoon Talks sont inclus dans les frais standards pour les participants éligibles.

Lieu, accès, accréditation : le mode d’emploi

L’édition 2026 se tient au Palais des Congrès de Bordeaux, côté Bordeaux-Lac. Le site est desservi par le tram ligne C (arrêt Palais des Congrès), pratique depuis le centre-ville.

Pour l’accréditation, l’organisation indique des créneaux dédiés :

L’édition 2026 se tient au Palais des Congrès de Bordeaux, côté Bordeaux-Lac. Le site est desservi par le tram ligne C (arrêt Palais des Congrès), pratique depuis le centre-ville.

La Radio du Cinéma – Répliques & musiques de ﬁlms 24/7

https://radioducinema.radio-website.com/agenda/cartoon-movie-2026-b...

Pour l’accréditation, l’organisation indique des créneaux dédiés :

• Mardi 3 mars 2026 : retrait possible de 13h30 à 18h30 au Congress Centre (Welcome Desk), ou de 14 heures à 19 heures dans le hall de votre hôtel si la réservation est faite via CARTOON.

29/01/2026, 09:50

• Mercredi 4 et jeudi 5 mars 2026 : de huit heures à 18 heures au Congress Centre (Welcome Desk).

À qui s’adresse Cartoon Movie, et comment s’inscrire

L’événement est pensé pour les professionnels : producteurs (avec projet sélectionné ou en “observer”), investisseurs, distributeurs, diffuseurs, streamers, auteurs, réalisateurs, studios, compositeurs… Inscriptions Cartoon Movie 2026 • Qui peut s’accréditer ?

Hôtels partenaires et réservation

Pourquoi y aller : repérage, deals, et lecture du marché

Cartoon Movie sert à gagner du temps. Si vous cherchez un prochain long métrage à accompagner, un nouveau talent à suivre, un coproducteur solide, un vendeur international qui connaît votre ligne éditoriale, ou un distributeur prêt à s’engager tôt, c’est l’un des rares endroits où tout le monde est au même endroit, avec des projets structurés pour être pitchés, discutés et challengés.

Pour les équipes en développement, l’intérêt est tout aussi clair : tester un concept, affiner un positionnement, et identifier les bons partenaires selon le territoire, la cible et le modèle de financement.

Infos pratiques

• Événement : Cartoon Movie 2026

• Dates : du 3 au 5 mars 2026 (Bordeaux, Nouvelle-Aquitaine)

• Lieu : Palais des Congrès de Bordeaux Lac, Avenue Jean Gabriel Domergue, 33300 Bordeaux, France

• Accès : tram ligne C, arrêt Palais des Congrès

• Programme & repères : Cartoon Talks le mardi 3 mars (de 14 heures à 18 heures), pitches les mercredi 4 et jeudi 5 mars

• Inscriptions : portail officiel

• Contact Cartoon Movie : movie@cartoon-media.eu animation • long métrage d’animation • Bordeaux • Cartoon Movie • pitch • coproduction • industrie • producteurs • distributeurs • tendances du marché

Pictanovo au Cartoon movie 2026 – Pictanovo

CARTOON MOVIE 2026 : LES HAUTS-DE-FRANCE À

BORDEAUX

Du 3 au 5 mars 2026, Bordeaux devient le cœur de l’animation européenne. Le Cartoon Movie, rendez-vous incontournable de la coproduction de longs métrages d'animation, réunit près de 850 professionnels autour de 48 projets en développement, offrant un véritable tremplin aux films de demain.

FAVORISER

L'ACCÈS AUX MARCHÉS PROFESSIONNELS

Cette année, Pictanovo accompagne trois studios des Hauts-de-France à ce marché stratégique : Octopolis, Something Big et Tchack feront partie de la délégation, bénéficiant d’accréditations à tarifs préférentiels.

L’objectif ? Faciliter les rencontres avec des coproducteurs, distributeurs et investisseurs internationaux, et transformer la créativité régionale en projets concrets sur le marché européen.

DES PROJETS PITCHÉS

Deux projets de longs métrages cofinancés par Pictanovo seront présentés au public et aux professionnels :

>> FLICK ! présenté en développement, produit par Wizz et Fost, soutenu en écriture et développement par Pictanovo

>> SAIMA : SCENES FROM A MIDLIFE CRISIS présenté en développement, produit par Avec ou sans Vous, Alexandra Film, Adriatic Animation et soutenu en écriture par Pictanovo.

Autre motif de satisfaction : la nomination de Pictanovo aux Cartoon Movie Tributes 2026 dans la catégorie "Producteur européen de l’année" aux côtés de tous les producteurs des films Le secret des mésanges, Allah n'est pas obligé et Les contes du pommier.

CONTACT SUR PLACE : les professionnels présents pourront également échanger avec Jérôme Allard (chef du Pôle Numérique de Pictanovo). N’hésitez pas à le contacter pour échanger sur vos (futurs) projets ! jallard@pictanovo.com

Voir le site du Cartoon Movie

Les professionnels belges de l’animation à la conquête de Cartoon Movie

Pour tout professionnel de l’animation belge, participer à Cartoon Movie, le principal événement européen de coproduction de longs métrages d'animation, est à la fois un privilège et une vraie nécessité, tant les opportunités y sont nombreuses. C’est à Bordeaux que s’est conclu ce forum de coproduction européen, où 50 projets provenant de 20 pays ont été présentés par des producteurs et réalisateurs enthousiastes devant leurs pairs, et face à de potentiels investisseurs, chaînes de télévision, distributeurs et agents de vente internationaux. Un rendez-vous incontournable, qui (comme chaque année) confirme la place de la Belgique au cœur de l’animation européenne.

Les professionnels belges de l’animation à la conquête de Cartoon Movie

Deuxprojetsbelgesmajoritairesétaientprésentés,ainsique denombreusescoproductions. Dreamwalker,quenous avionsdécouvertàcemêmeévénementen2024,poursuit sondéveloppementsousl’impulsiondeViviFilm.Ducôtéde WalkingtheDog,prestigieuxstudioayantcollaboréavec SylvainChometpour LesTriplettesdeBelleville et Marcelet MonsieurPagnol,maisaussiavecTommMoorepour BrendanetleSecretdeKells etavecAriFolmanpour Oùest AnneFrank,c’est undocumentaireaniméquiétaitprésenté, sousletitre Smecheria,lesconfidencesd’untricheur.Unfilm entreBruxellesetlaRoumanie,oùleréalisateurAntoine FontainenousamènedansunvoyageaucôtédeDoru,un joueurroumainde60ansdontlavieestaussiinsaisissable quelesjeuxd’illusionetd’escamotagequ’ilpratiqueluimême.

Kevin Giraud

9 mars 2026

Kevin Giraud

9 mars 2026

Kevin Giraud

9 mars 2026

Au-delàdecesdeuxprojets,ilestréjouissantdeconstater quelesstudiosetproducteur.icesbelgess’impliquent toujoursplus danslaproductioneuropéenned’animation,

entreBruxellesetlaRoumanie,oùleréalisateurAntoine

FontainenousamènedansunvoyageaucôtédeDoru,un joueurroumainde60ansdontlavieestaussiinsaisissable quelesjeuxd’illusionetd’escamotagequ’ilpratiqueluimême.

Au-delàdecesdeuxprojets,ilestréjouissantdeconstater quelesstudiosetproducteur.icesbelgess’impliquent toujoursplus danslaproductioneuropéenned’animation, avecdebeauxsuccèsd’estime.Lelong-métrage Allahn’est pasobligé,coproduitparNeedProductionsetquivientd’être triplementrécompenséàAnima,areçuleprixdelaMeilleure Productiondel’annéeauCartoonMovie.Unprixamplement mérité,pourunfilmquisortiraenBelgiquele17juin.

Parmilesprojetsprésentéscetteannée,pasmoinsdesix comptentdescoproducteursbelgesminoritaires.Du nouveaulong-métragedelacinéasteroumaineAnca Damian, Starseed (coproduitparWrongMenetQuetzalcoatl) àl’hilarant JimQueen dustudiofrançaisBobbypills (coproduitparUmedia,quicoproduitégalement Lecœurdu djembé),laBelgiqueestprésentedanstroisdescinqprojets lesplusplébiscitésparlepublicduCartoonMovie2026. Il étaitunefoisunœuf, premierlong-métragedela réalisatriceNinaGantz(WandertoWonder, GrandPrixAnima du meilleur court métrage international en 2024) , s’inscrit sur ce podium avec Dreamwalker et Le cœur du djembé.

Fait marquant: la société Be Side productions s’est positionnée sur le projet Before they were gods durant l’événement. Ce projet, entre docu-fiction et fantasme rock’n’roll, s’annonce très intéressant et pourrait bien activer l’un des nombreux studios présents ou représentés cette année au Cartoon Movie, comme L’Enclume, Dreamwall, ou encore Fabrique Fantastique.

Une chose est sûre, l’animation belge est plus dynamique que jamais, et ce Cartoon Movie l’a à nouveau prouvé.

Depuis sa création en 1999, Cartoon a aidé 513 longs métrages à obtenir un financement, pour un budget total de 3,42 milliards d'euros. Le prochain Cartoon Movie se tiendra à Bordeaux, du 4 au 6 mars 2027. du meilleur court métrage international en 2024) , s’inscrit sur ce podium avec Dreamwalker et Le cœur du djembé

Belgique -

CULTURA

GuerradeIránSesióndecontrol

Destacadapresenciadeproyectosespañoles enelCartoonMoviedeBurdeos

Burdeos(Francia),3mar(EFE).-ElCartoonMoviedeBurdeos (suroeste),lamayorplataformadecopr...

Destacadapresenciadeproyectosespañoles enelCartoonMoviedeBurdeos

Burdeos(Francia),3mar(EFE).-ElCartoonMoviedeBurdeos (suroeste),lamayorplataformadecopr...

EFE

03/03/2026alas14:54h.

Burdeos (Francia), 3 mar (EFE).- El Cartoon Movie de Burdeos (suroeste), la mayor plataforma de coproducción de cine de animación en Europa, inicia este martes su vigésima octava edición, en la que los largometrajes españoles ocupan una posición destacada entre el medio centenar de ﬁlmes ﬁnalmente seleccionados. La presente edición acogerá a 50 proyectos procedentes de 21 países, cinco de los cuales son largometrajes de producción española, lo que convierte a España en el tercer país con mayor presencia en el encuentro, únicamente por detrás de Francia, con 15 proyectos, y de Alemania, con seis. IMÁGENES: POL LLOBERAS. INCLUYE PLANOS RECURSO DE LA FACHADA DEL PALACIO DE CONGRESOS DE BURDEOS, DE SU ENTRADA PRINCIPAL, DE SU RECEPCIÓN, DEL ESPACIO DEDICADO AL ENCUENTRO ENTRE PROFESIONALES DE LA ANIMACIÓN, DE LA DECORACIÓN SOBRE PROYECTOS DE ANIMACIÓN DESARROLLADOS EN LA REGIÓN FRANCESA DE NUEVA AQUITANIA, DEL MONTAJE DE PARTE

EVENTO, DE LA

PLANOS RECURSO DE LA FACHADA DEL PALACIO DE CONGRESOS DE BURDEOS, DE SU ENTRADA PRINCIPAL, DE SU RECEPCIÓN, DEL ESPACIO DEDICADO AL ENCUENTRO ENTRE PROFESIONALES DE LA ANIMACIÓN, DE LA DECORACIÓN SOBRE PROYECTOS DE ANIMACIÓN

DESARROLLADOS EN LA REGIÓN FRANCESA DE NUEVA AQUITANIA, DEL MONTAJE DE PARTE DEL EVENTO, DE LA ENTRADA DE PÚBLICO A UNA CONFERENCIA Y DE LA EXPOSICIÓN DEL EXPERTO EN INVESTIGACIÓN Y DESARROLLO EN ANIMACIÓN JOSEPH JACQUET SOBRE EL PROYECTO “LA VIE DE CHÂTEAU”, ASÍ COMO PARTE DE SU METRAJE. Comenta Reportarunerror

TE PUEDE INTERESAR

Jouw Citroën direct beschikbaar

Ontdekonzestock!Veelmodellen directklaaromtevertrekken.Proﬁtee… Citroën België | Patrocinado

De waarde van uw huis is openbaar bekend!

Home Value | Patrocinado

CartoonMovie2026:Larenovaciónseimponeen unaindustriaeuropeadelaanimacióncadavez másabierta

Por MarcoSánchezSequera - 10marzo,2026

CartoonMovie2026:Larenovaciónseimponeen unaindustriaeuropeadelaanimacióncadavez másabierta

Por MarcoSánchezSequera - 10marzo,2026

CartoonMovie2026:Larenovaciónseimponeen unaindustriaeuropeadelaanimacióncadavez másabierta

 Audiovisual451, en Burdeos.

Por MarcoSánchezSequera - 10marzo,2026

Un total de 831 profesionales de la animación europea procedentes de 42 países, cifra muy similar a la de 2025, se han dado cita la pasada semana en la ciudad francesa de Burdeos, por décimo año consecutivo, con motivo de la 28ª edición del foro de coproducción Cartoon Movie. Hasta 50 proyectos de largometraje de 21 países europeos se han presentado en este evento de la asociación CARTOON con el principal objetivo de encontrar socios para completar su financiación.

 Audiovisual451, en Burdeos.

Más de 257 compradores han asistido al mercado, de los cuales un 20 % lo ha hecho por primera vez, mientras que han sido 448 las compañías representadas. En cuanto al balance por sexos, cabe señalar que, en esta edición de Cartoon Movie, por un 54,9 % de hombres, ha participado un 44,6 % de mujeres, algo más que en años anteriores.

Más de 257 compradores han asistido al mercado, de los cuales un 20 % lo ha hecho por primera vez balance por sexos, cabe señalar que, en esta edición de Cartoon Movie, por un 54,9 % de hombres, ha participado

Fotografía de CARTOON.

A pesar de que su industria no vive su momento de mayor esplendor, Francia ha vuelto a liderar la selección en este 2026 con 15 proyectos, seguida de Alemania (6) y España (5), mientras que el conjunto de países de Europa Central y Oriental (Chequia, Croacia, Estonia, Georgia, Hungría, Polonia y Rumanía) continúa incrementando su representación, con 11 obras. Los nórdicos (Dinamarca, Noruega y Suecia) han participado con tres propuestas; Bélgica, Italia, Irlanda y Países Bajos han hecho lo propio con dos cada uno; y Austria, Grecia, Luxemburgo y Ucrania completan la lista, con un proyecto por país.

- Spain -

Fotografía de CARTOON.

Coincidiendo con la celebración de la iniciativa especial ‘Québec-Canada Land in Europe: A Space for Creation’, el foro ha reunido a numerosos profesionales provenientes de Canadá, y especialmente de la provincia francófona de Quebec. Seis han sido los proyectos presentados en las sesiones de pitch, de la mano de SODEC y Telefilm Canada, por parte de este país norteamericano, cuyos productores han viajado hasta Burdeos en busca de forjar alianzas con la industria europea de la animación en un contexto en las que las relaciones con Estados Unidos, su vecino sur, no atraviesan su mejor época.

Un año más, un grupo de 70 estudiantes de escuelas de animación de la región francesa de Nueva Aquitania acudió a Cartoon Movie para participar en su programa de coaching, su feria de empleo y el nuevo taller dedicado al Elevator Pitch. Durante las horas previas a la inauguración oficial del evento, se debatió sobre las prácticas sostenibles en animación y la relación cada vez más estrecha entre XR y el cine en tres mesas redondas, seguidas de encuentros one-to-one

PolíticadeCookies

de ‘Tukuy’. Fotografía de CARTOON.

EldetalledelosproyectosdeCartoonMovie2026

Pitch de ‘Tukuy’. Fotografía de CARTOON.

EldetalledelosproyectosdeCartoonMovie2026

La selección de de Cartoon Movie 2026, realizada a partir de 150 postulaciones (un 22 % más que en 2025), ha incluido 30 largometrajes en desarrollo (60 %), seguidos por 12 proyectos en concepto (24 %) y otros 7 en producción (14 %), y se ha visto completada por un sneak preview. Cabe destacar que ocho de la obras participantes ya habían sido presentadas a este mercado o a otras citas de CARTOON en anteriores etapas de desarrollo; tal es el caso de ‘Aya en el desierto’ o de ‘Silence Sometimes’, dos propuestas españolas que se dieron a conocer en el marco de Cartoon Springboard de Madrid.

Pitch

Pitch de ‘Tukuy’. Fotografía de CARTOON.

Con un presupuesto global de 275,3 millones de euros, las películas seleccionadas en 2025 tienen un coste medio de 5,5 millones de euros, una cantidad ligeramente inferior a la de la edición anterior. Asimismo, la coproducción sigue siendo uno de los puntales de la financiación del cine de animación en Europa, hasta el punto de que 34 de los proyectos son coproducciones entre dos o más países, tanto de Europa Creativa MEDIA como de fuera del programa (68 %).

En cuanto a la segmentación por audiencias, las películas infantiles y familiares han representado en Cartoon Movie 2026 más de la mitad del total (56 %), mientras que las dirigidas a adultos y jóvenes/adultos han crecido de nuevo, del 31 al 38 %, en relación al último año. El programa también ha contado, en esta ocasión, con dos proyectos preescolares.

Desde cineastas experimentados hasta profesionales noveles presentaron sus obras en la 28ª edición de Cartoon Movie, una edición en la que la presencia de mujeres en la dirección de los largometrajes participantes ha aumentado notablemente (39 % en 2026 frente al 22 % de 2025), no así en el caso de las mujeres productoras (34 % frente a 35 %). Además, más de la mitad de los proyectos de la selección (62 %) cuenta, al menos, con una protagonista femenina.

En lo referente a las técnicas de animación, el 2D encabeza la lista con el 54 % de las películas, mientras que un 30 % son propuestas realizadas en 3D. Un total de nueve proyectos son adaptaciones de libros y novelas gráficas ya publicadas, y el 38 % incluyen la diversidad y la inclusión en sus narrativas, con especial atención a las discapacidades.

Fotografía de CARTOON.

Tendenciasquehandominadolaconversación

Fotografía de CARTOON.

Tendenciasquehandominadolaconversación

Una amplia gama de géneros -aventura, acción, comedia, drama y ciencia ficción- han convivido en la selección de Cartoon Movie 2026, que ha aportado también variedad en cuanto a

Una amplia gama de géneros -aventura, acción, comedia, drama y ciencia ficción- han convivido en la selección de Cartoon Movie 2026, que ha aportado también variedad en cuanto a la temática de los proyectos, con especial relevancia de formatos documentales e híbridos que aspiran a reflejar realidades sociales y políticas estrechamente vinculadas a las tensiones del mundo actual, muchas veces utilizando la fantasía o el biopic como vehículo para explorar el

Fotografía de CARTOON.

Tendenciasquehandominadolaconversación

Pero si por algo ha destacado esta edición, es por la asistencia al foro de talentos emergentes y nuevas caras dispuestas a dar sus primeros pasos en el mundo de la animación, especialmente en el caso de la representación española. En un año en el que grandes producciones han quedado fuera de la selección en favor de otros proyectos más independientes, jóvenes directores como Julia Horrillo o Álvaro Robles han debutado con sus primeros largometrajes animados, ambos cocinados a fuego lento dentro del ecosistema de CARTOON; productoras con recorrido en el ámbito de la imagen real, como la catalana Alhena Production o la gallega Treboa Media, se han atrevido a impulsar sus primeras propuestas de este tipo; e incluso distribuidoras de autor como #ConUnPack han viajado esta vez a Burdeos en busca de títulos para el público adulto.

Precisamente, la animación para jóvenes y adultos sigue escalando, poco a poco, posiciones dentro de un programa, hasta hace poco tiempo, completamente dominado por las películas infantiles y familiares, que han continuado gozando este año de un espacio considerable gracias al empuje de proyectos con fuerte ambición comercial. Muchos de ellos son adaptaciones literarias con vocación de convertirse en IPs globales que, en ciertos casos, se sirven de un 3D que recuerda demasiado al de Pixar, cuando no apuestan por una estética anime cada vez más frecuente en los diversos encuentros CARTOON. Este sano equilibrio ha propiciado que en la selección de 2026, tanto a nivel europeo como español, convivan voces que desprenden frescura con compañías ya consolidadas dentro del sector, tales como Thinkwild Studios y Mr. Miyagi Films, y presupuestos altos con otros bastante inferiores, cortesía del abaratamiento que posibilita la IA.

Y es que la inteligencia artificial sigue siendo el gran elefante en la habitación si hablamos de audiovisual, más si cabe para una industria de la animación en la que esta tecnología continúa penetrando sin cesar, como han puesto de manifiesto los tráilers de muchos de los proyectos de esta edición, obligados a informar a la audiencia del uso de dichas herramientas. A pesar de todo, cada vez más profesionales parecen dejar a un lado el pánico inicial para ir abrazando paulatinamente este cambio de paradigma, en el que, para casi todo el mundo, «renovación» es la palabra mágica que resume la coyuntura que está atravesando el sector, en múltiples sentidos. Pero, si hay algo que secunda la absoluta totalidad de participantes nacionales en esta 28ª edición de Cartoon Movie, es el momento dulce que vive el cine español de animación

Audiovisual451 - 10/03/2026

todo el mundo, «renovación» es la palabra mágica que resume la coyuntura que está atravesando el sector, en múltiples sentidos. Pero, si hay algo que secunda la absoluta totalidad de participantes nacionales en esta 28ª edición de Cartoon Movie, es el momento dulce que vive el cine español de animación.

Pitch de ‘Aya en el desierto’. Fotografía de CARTOON.

Unapresenciaespañolamuysólida

La animación española ha estado representada en esta edición por cinco propuestas, tres de ellas de animación 2D, dirigidas al público joven y adulto y en etapa de desarrollo: ‘Aya en el desierto’, producción de Alhena Production (Norbert Llaràs) con dirección de Julia Horrillo, quien firma el guion junto a Verónica Adell; ‘Piso 13’, dirigida por Soraya Antelo, escrita por Roberto G. Méndez, y producida por Treboa Media (Paula Mariñas); y ‘Silence Sometimes’, coproducción de la española Filmakers Monkeys (Néstor López) y la mexicana Ánima Estudios (Fernando de Fuentes) que escribe y dirige Álvaro Robles.

También han formado parte de las presentaciones ante potenciales socios, agentes de ventas, distribuidores, representantes de plataformas de streaming e inversores, otros dos proyectos españoles de animación 2D y en fase de concepto: ‘Carmen y la cuchara de palo’, película para el público familiar producida por Thinkwild Studios, con Carlos Gómez-Mira en la dirección y Rossana Giacomelli a cargo del guion; y ‘Tukuy’, coproducción de Huraa AIE (Edwin Buitrago) y Doce Entertainment / Mr. Miyagi Films (David Matamoros) dirigida por Aline Romero y coescrita por ella misma y Merce Castellanos.

Finalmente, Burdeos ha acogido la puesta de largo, en formato pitch, de otros tres títulos con participación española: ‘Halloween vs. Day of the Dead’, del alemán Studio 100 International y 3Doubles Producciones (Darío Sánchez); ‘Monster Mia’, de Arx Anima Animation Studio (Austria) junto a Peng! Boom! Tschak! Films (Alemania) y la española Arxlight Pictures (Nicolás Matji); y ‘Pirate Mo and the Legend of the Red Ruby’, liderada por la alemana Ulysses Filmproduktion en compañía de Letterbox Filmproduktion (Alemania), y de nuevo, Arx Anima Animation Studio y Arxlight Pictures.

Losproyectosquemáshanllamadolaatención

Según la organización, los diez proyectos que mayor impacto han conseguido entre los compradores son:

- 10/03/2026

Losproyectosquemáshanllamadolaatención

Según la organización, los diez proyectos que mayor impacto han conseguido entre los compradores son:

1. ‘Kindred Spirits’ – Cartoon Saloon (Irlanda) y Folivari (Francia)

2. ‘Dreamwalker’ – Vivi Film (Bélgica), Parmi les lucioles films (Francia) y Lighthouse Studios (Irlanda)

3. ‘Once Upon an Egg’ – Keplerfilm (Países Bajos), A Private View (Bélgica) y Hausboot (Chequia)

4. ‘Akira’s Flying Wheelchair’ – TeamTO Films (Francia)

5. ‘The Heart of the Djembe’ – Cottonwood Media (Francia), Booya Studio (Costa de Marfil) y Umedia (Bélgica)

6. ‘Flick’ – WIZZ (Francia) y FOST (Francia)

‘Hakim’s Odyssey’ – Folivari (Francia) y Solab Films (Francia)

7. ‘Pangea’ – Miyu Productions (Francia)

8. ‘Night Tram’ – Negativ (Chequia), Sacrebleu Productions (Francia), BFilm (Eslovaquia) y ART SHOT (Lituania)

‘Starseed’ – Aparte Film (Rumanía), Special Touch Studios (Francia), Wrong Men (Bélgica), Quetzalcoatl (Bélgica), Yzanakio (Canadá) y Known Associates Group (Sudáfrica)

9. ‘Blaise’ – KG Productions (Francia)

10. ‘Cosmo Pincess’ – Sacrebleu Productions (Francia) ‘Kokum’ – Paul Thiltges Productions (Luxemburgo) y Special Touch Studios (Francia)

Spainy 3Doubles Producciones (Darío Sánchez); ‘Monster Mia’, de Arx Anima Animation Studio (Austria) junto a Peng! Boom! Tschak! Films (Alemania) y la española Arxlight Pictures (Nicolás Matji); y ‘Pirate Mo and the Legend of the Red Ruby’, liderada por la alemana Ulysses Filmproduktion en compañía de Letterbox Filmproduktion (Alemania), y de nuevo, Arx Anima Animation Studio y Arxlight Pictures.

CartoonMovie2026:ÁlvaroRoblesdebutaen

Burdeoscon‘Avecessilencio’,delamanode FilmakersMonkeys

CartoonMovie2026:ÁlvaroRoblesdebutaen

CartoonMovie2026:lvaroRoblesdebutaen

CartoonMovie2026:ÁlvaroRoblesdebutaen Burdeoscon‘Avecessilencio’,delamanode

Por MarcoSánchezSequera - 11marzo,2026

Burdeoscon‘Avecessilencio’,delamanode

FilmakersMonkeys

Burdeoscon‘Avecessilencio’,delamanode

Por MarcoSánchezSequera - 11marzo,2026

FilmakersMonkeys

Por MarcoSánchezSequera - 11marzo,2026

Por MarcoSánchezSequera

- 11marzo,2026

La compañía española Filmakers Monkeys y la mexicana Ánima Estudios han presentado en Cartoon Movie 2026 su nueva coproducción animada, ‘A veces silencio’. Escrito y dirigido por el debutante Álvaro Robles, con José Luis Ágreda como gráfico, este largometraje en fase de desarrollo y de unos 90 minutos se sirve de la animación 2D por ordenador para dar forma a un drama romántico con tintes de realismo mágico, y que está destinado a un público joven y adulto.

Este filme cuenta la historia de Silvia, cuyo nacimiento deja a los médicos perplejos. Tras cortar el cordón umbilical, la bebé llora, pero su llanto es silencioso. María, su madre, intenta preguntarle qué le pasa, pero resulta que tampoco puede usar la voz. Tras realizarle varias pruebas, los médicos descubren que cualquier cosa que entre en contacto con la piel de Silvia pierde la capacidad de emitir sonido para siempre. De adulta, Silvia regenta una pequeña floristería heredada de su madre en un barrio de Madrid. Decide llevar una vida tranquila y solitaria, consciente de su «maldición». Sin embargo, músico de gran talento, su frágil equilibrio comienza a desmoronarse

Este filme cuenta la historia de Silvia, cuyo nacimiento deja a los médicos perplejos. Tras cortar el cordón umbilical, la bebé llora, pero su llanto es silencioso. María, su madre, intenta preguntarle qué le pasa, pero resulta que tampoco puede usar la voz. Tras realizarle varias pruebas, los médicos descubren que cualquier cosa que entre en contacto con la piel de Silvia pierde la capacidad de emitir sonido para siempre. De adulta, Silvia regenta una pequeña floristería heredada de su madre en un barrio de Madrid. Decide llevar una vida tranquila y solitaria, consciente de su «maldición». Sin embargo, cuando conoce a Marco, un músico de gran talento, su frágil equilibrio comienza a desmoronarse - Publicidad -

sirviera para experimentar con el diseño sonoro. Mientras me documentaba, me encontré con la leyenda de Sunanda Kumariratana, una princesa tailandesa del siglo XIX que murió ahogada durante el hundimiento de su barco debido a que, como la ley del momento castigaba con la muerte a cualquiera que la tocase, nadie se atrevió a lanzarse al agua para salvarla. Esa tragedia, junto con la historia de ‘La sirenita’, en la que la protagonista sacrifica su voz por amor, me ayudaron a dar forma a la premisa de ‘A veces silencio’.»

La semilla de este proyecto data de 2016, según rememora Álvaro Robles: «En aquel momento,

con la muerte a cualquiera que la tocase, nadie se atrevió a lanzarse al agua para salvarla. Esa tragedia, junto con la historia de ‘La sirenita’, en la que la protagonista sacrifica su voz por amor, me ayudaron a dar forma a la premisa de ‘A veces silencio’.»

Audiovisual451 - 11/03/2026

2/3

ahogada durante el hundimiento de su barco debido a que, como la ley del momento castigaba con la muerte a cualquiera que la tocase, nadie se atrevió a lanzarse al agua para salvarla. Esa tragedia, junto con la historia de ‘La sirenita’, en la que la protagonista sacrifica su voz por amor, me ayudaron a dar forma a la premisa de ‘A veces silencio’.»

con la leyenda de Sunanda Kumariratana, una princesa tailandesa del siglo XIX que murió ahogada durante el hundimiento de su barco debido a que, como la ley del momento castigaba con la muerte a cualquiera que la tocase, nadie se atrevió a lanzarse al agua para salvarla. Esa tragedia, junto con la historia de ‘La sirenita’, en la que la protagonista sacrifica su voz por amor, me ayudaron a dar forma a la premisa de ‘A veces silencio’.»

Esta propuesta no es un proyecto infantil ni puramente familiar, sino que está pensado para un público joven y adulto. «Buscamos conectar con aquellas personas que reconocen en el silencio, en las pausas y en los pequeños gestos, algo profundamente humano, delicado y necesario», aseguran las productoras ejecutivas Reyes Arnal y Pilar Díaz. «Creemos que esta es una película de autor que puede resonar especialmente en el público de entre 30 y 55 años que ha vivido el Madrid de los 90 y lo recuerda con nostalgia, pero a su vez es una historia universal sobre la dificultad de comunicarnos y lo que ocurre cuando lo que no se dice pesa más que lo que se dice. Nos interesa que el espectador se sienta interpelado.»

Robles apunta que, desde un principio, tuvo claro que la animación 2D era el vehículo idóneo para llevar ‘A veces silencio’ a la gran pantalla: «Queremos hacer una película que pueda ser vista tanto por personas oyentes como por la comunidad sorda, sin necesidad de pases especiales. Pensamos en las salas de cine como un lugar de encuentro donde se viven experiencias compartidas, así que la idea es utilizar la animación a la hora de representar el sonido visualmente.»

De esta manera, el ruido y el silencio tendrán tratamientos visuales distintos a lo largo de la cinta. «Silvia y todo lo que haya entrado en contacto con su piel tendrá un tratamiento sin línea exterior y con línea interior de color, más limpio y con un acabado más redondeado Por el contrario, todo lo que emita sonido tendrá un acabado de línea negra, más anguloso, con líneas que desbordarán a los propios personajes y una textura de grano de celuloide«, explica el director.

De esta manera, el ruido y el silencio tendrán tratamientos visuales distintos a lo largo de la cinta. «Silvia y todo lo que haya entrado en contacto con su piel tendrá un tratamiento sin línea exterior y con línea interior de color, más limpio y con un acabado más redondeado. Por el contrario, todo lo que emita sonido tendrá un acabado de línea negra, más anguloso, con líneas que desbordarán a los propios personajes y una textura de grano de celuloide«, explica el director.

Robles reconoce que, en este sentido, ha sido fundamental la labor, tanto del director de arte José Luis Ágreda (‘Buñuel en el laberinto de las tortugas’, ‘Robot Dreams’, ‘Decorado’) como de la directora de animación Laura Soret, que ya colaboró con él en su anterior cortometraje, ‘Umbrellas’. Entre sus principales referencias en materia de estilo, el cineasta murciano cita el clásico de Disney zorro y el caballo’

Robles reconoce que, en este sentido, ha sido fundamental la labor, tanto del director de arte José Luis Ágreda la directora de animación ‘Umbrellas’ clásico de Disney zorro y el caballo’

Álvaro Robles, en el pitch de ‘A veces silencio’. Fotografía de CARTOON.

Tras pasar por las Residencias de la Academia de Cine, Cartoon Springboard y Berlinale Co-Production Market, donde se alzó con el VFF Talent Highlight Award, el proyecto prosigue en este momento su andadura por mercados y festivales, que le ha llevado a participar recientemente en foros como el Laboratorio Ópera Prima de ESCAC, Mallorca Talents Lab del Atlàntida Film Fest o Sundance Producers Lab. «Decidimos apostar por mercados típicamente reservados a la imagen real para luchar contra el mantra de la animación como género, y lo cierto es que el resultado está siendo increíblemente bien recibido, sobre todo a nivel internacional», subraya Néstor López, productor por parte de Filmakers Monkeys.

‘A veces silencio’ se encuentra ya en una fase avanzada de desarrollo: «Tenemos definida la propuesta creativa y el enfoque visual, y estamos trabajando sobre una cuarta versión de guion para afinar todavía más el tono y la profundidad emocional de la historia», aclaran Reyes Arnal y Pilar Díaz. En este punto, Álvaro Robles ha viajado a Burdeos en busca de un tercer coproductor europeo que permita cerrar ya la financiación, de cara a iniciar la producción durante este mismo año. «Otro de nuestros objetivos es conseguir ventas internacionales y los primeros intereses de preventas y posibles licencias, así como potenciales distribuidores. Además, posicionar el proyecto en mercados de la importancia de Cartoon Movie siempre es de ayuda a la hora de pensar en la futura world premiere de la película en festivales», concluye López.

Además de ‘A veces silencio’, otros cuatro proyectos españoles han sido seleccionados para participar este año en la 28ª edición de Cartoon Movie, que ha tenido lugar en la ciudad de Burdeos: ‘Aya en el desierto’, dirigida por Julia Horrillo y producida por Alhena Production; ‘Carmen y la cuchara de palo’, cinta de Thinkwild Studios que dirige Carlos Gómez-Mira a partir de un guion de Rossana Giacomelli; ‘Piso 13’, producción de Treboa Media con dirección de Soraya Antelo y guion de Roberto G. Méndez; y ‘Tukuy’, película de Aline Romero que producen Huraa AIE y Doce Entertainment / Mr. Miyagi Films.

MarcoSánchezSequera

La productora catalana Alhena Production presentará en Cartoon Movie 2026 su primer proyecto animado, ‘Aya en el desierto’. Dirigido por Julia Horrillo, que firma el guion junto a Verónica Adell, este largometraje en desarrollo de 90 minutos de duración se sirve de la animación digital 2D para dar forma a una historia ficticia de migraciones que aúna drama y aventuras, y que está destinada a un público joven y adulto.

CartoonMovie2026:AlhenaProductiondebutaen laanimacióncon‘Ayaeneldesierto’,unahistoria sobrelasmigraciones

Por MarcoSánchezSequera - 23febrero,2026

CartoonMovie2026:AlhenaProductiondebutaen laanimacióncon‘Ayaeneldesierto’,unahistoria sobrelasmigraciones

CartoonMovie2026:AlhenaProductiondebutaen

laanimacióncon‘Ayaeneldesierto’,unahistoria sobrelasmigraciones

Por MarcoSánchezSequera - 23febrero,2026

CartoonMovie2026:AlhenaProductiondebutaen laanimacióncon‘Ayaeneldesierto’,unahistoria sobrelasmigraciones

Por MarcoSánchezSequera

- 23febrero,2026

La protagonista del filme es Aya, una niña de 13 años que es interceptada en la costa de Cádiz junto a un grupo de migrantes subsaharianos, disfrazada de niño. Tras pasar la noche en un polideportivo, y mientras intenta reunirse con su prima en España, Aya recuerda momentos clave de su viaje: desde la huida de la guerra en Costa de Marfil hasta el cruce del estrecho. En el camino, fantasea con las aventuras de la legendaria reina Baulé Akwa Boni, cuyo coraje la ayuda a sobrellevar las dificultades mientras mantiene vivo el recuerdo de su madre, con la esperanza de volver a verla algún día.

- Publicidad -

«Me crié entre Sevilla y Zahara de los Atunes, una ruta migratoria que hace años era bastante caliente. Habitualmente, me encontraba con pateras que aparecían varadas en la playa, y esto es algo que, si vives allí, terminas naturalizando. Pero, un día, me asomé a una de esas barcazas, y dentro hallé los pantalones de un niño pequeño, lo cual produjo un cambio en

- Publicidad -

mí», recuerda Julia Horrillo, a propósito del origen del proyecto. «En ese momento, estábamos en plena crisis de los refugiados, yo tenía 19 años, estaba estudiando Comunicación Audiovisual y empecé a informarme sobre el tema, porque era algo que me tocaba muy de cerca. Finalmente, decidí que hacer una película de animación sobre el tema podía ser una buena opción para mi trabajo final de grado.»

Norbert Llaràs, productor por parte de Alhena Production, supo por primera vez de ‘Aya en el desierto’ antes de la pandemia, gracias a una de las convocatorias de pitching de proyectos universitarios que organiza anualmente el Clúster Audiovisual de Catalunya: «En cuanto

«Me crié entre Sevilla y Zahara de los Atunes, una ruta migratoria que hace años era bastante

mercados, y estamos en conversaciones con dos posibles socios, uno francés y otro español«, revela la productora Montse Capón

Entre los numerosos foros por los que ha pasado hasta ahora ‘Aya en el desierto’, sobresalen Cartoon Springboard, Torino Film Lab, la residencia para mujeres cineastas COOFILM, el Festival de Annecy (Working Animation from Spain) o MIA Roma, donde recibió el Premio Paramount a las Nuevas Historias. La próxima parada será otro evento CARTOON, pero esta vez en Burdeos: «Nuestro principal objetivo es encontrar socios y un distribuidor que nos ayude a arrancar la financiación, algo que es muy importante para, ya de cara al año que viene, poder pensar en dar el siguiente paso», explica Capón.

«También queremos aprovechar para acercarnos a estudios de animación, ya sean propiamente africanos o franceses con raíces africanas, porque creo que un proyecto sobre África debe contar con la participación de gente de allí, y especialmente de personas pertenecientes a las culturas concretas que son retratadas en esta película», añade Julia Horrillo. «Dentro del equipo creativo, ya contamos con un compositor africano que está trabajando en la banda sonora, así como con un director de doblaje marfileño.»

Además de ‘Aya en el desierto’, otros cuatro proyectos españoles han sido seleccionados para participar en la 28ª edición de Cartoon Movie, que tendrá lugar del 3 al 5 de marzo en Burdeos: ‘Carmen y la cuchara de palo’, cinta de Thinkwild Studios que dirige Carlos GómezMira Sagrado a partir de un guion de Rossana Giacomelli; ‘Piso 13’, película de Soraya Antelo escrita por Roberto G. Méndez y producida por Treboa Media; ‘Silence Sometimes’, coproducción de la española Filmakers Monkeys (Néstor López) y la mexicana Ánima Estudios que está escrita y dirigida por Álvaro Robles; y ‘Tukuy’, película de Aline Romero que coproducen Huraa AIE y Doce Entertainment / Mr. Miyagi Films.

Marco Sánchez Sequera

CartoonMovie2026:Laanimacióngallega, presenteenBurdeosdelamanode‘Piso13’ysu

futuroapocalíptico

CartoonMovie2026:Laanimacióngallega, presenteenBurdeosdelamanode‘Piso13’ysu futuroapocalíptico

Por MarcoSánchezSequera - 26febrero,2026

CartoonMovie2026:Laanimacióngallega,

Por MarcoSánchezSequera - 26febrero,2026

CartoonMovie2026:Laanimacióngallega, presenteenBurdeosdelamanode‘Piso13’ysu futuroapocalíptico

CartoonMovie2026:Laanimacióngallega, presenteenBurdeosdelamanode‘Piso13’ysu

futuroapocalíptico

Por MarcoSánchezSequera - 26febrero,2026

presenteenBurdeosdelamanode‘Piso13’ysu futuroapocalíptico

Por MarcoSánchezSequera - 26febrero,2026

La productora gallega Treboa Media presentará en Cartoon Movie 2026 su nuevo proyecto animado, ‘Piso 13’, un largometraje escrito por Roberto G. Méndez con dirección de Soraya Antelo. En fase de desarrollo, se trata de una historia de ciencia ficción y aventura, de unos 90 minutos y animación 2D, destinada al público joven y adulto.

Este filme con tono distópico y toques de terror sigue a un grupo de adolescentes que, de un día para otro, se ven atrapados en un 13º piso sobre una niebla letal poblada por monstruos Los adultos que les rodean están convencidos de que la única forma de seguir vivos es sacrificar a sus mayores y utilizarlos a modo de cebo para pescar bestias como alimento, pero Lucía se niega a aceptar esa lógica tan cruel. Ella y sus amigos están convencidos de que este nuevo mundo puede construirse de otra manera, y que la forma en que cuidamos (o abandonamos) a nuestros mayores define quiénes somos.

Este filme con tono distópico y toques de terror sigue a un grupo de adolescentes que, de un día para otro, se ven atrapados en un 13º piso sobre una niebla letal poblada por monstruos. Los adultos que les rodean están convencidos de que la única forma de seguir vivos es sacrificar a sus mayores y utilizarlos a modo de cebo para pescar bestias como alimento, pero Lucía se niega a aceptar esa lógica tan cruel. Ella y sus amigos están convencidos de que este nuevo mundo puede construirse de otra manera, y que la forma en que cuidamos (o abandonamos) a nuestros mayores define quiénes somos

Este filme con tono distópico y toques de terror sigue a un grupo de adolescentes que, de un día para otro, se ven atrapados en un 13º piso sobre una niebla letal poblada por monstruos. Los adultos que les rodean están convencidos de que la única forma de seguir vivos es sacrificar a sus mayores y utilizarlos a modo de cebo para pescar bestias como alimento, pero Lucía se niega a aceptar esa lógica tan cruel. Ella y sus amigos están convencidos de que este nuevo mundo puede construirse de otra manera, y que abandonamos) a nuestros mayores define quiénes somos

‘Piso 13’.

La semilla de lo que hoy es ‘Piso 13’ parte de la curiosidad que siempre ha despertado en su creador la icónica fotografía ‘Almuerzo sobre un rascacielos’, de Charles Clyde Ebbets, en la que se ve a unos obreros suspendidos en el cielo de Nueva York: «Siempre que la veía, pensaba lo mismo: imagínate que no pueden bajar, que se tienen que quedar ahí para siempre. Ahí había una historia, por lo que pensé en escribir una serie o una película de imagen real, pero sabía que nadie en la industria audiovisual gallega iba a producir algo así. Entonces, decidí que había que dibujarlo», asegura Roberto G. Méndez.

- Spain -

- Publicidad -

‘Piso 13’.

En ese momento, se incorporó al proyecto el ilustrador Martín Gil, su propio hijo, como concept artist encargado de diseñar el universo visual y los personajes. «Empezamos escribiendo un cómic, y enseguida se convirtió en una película de animación 2D», apunta este guionista con más de 30 años de trayectoria profesional en cine y televisión.

El primer impulso para hacer realidad ‘Piso 13’, que todavía se encuentra en «una fase muy temprana», en palabras de su productora Paula Mariñas, fue la concesión de la ayuda para la escritura de guiones de AGADIC, organismo dependiente de la Xunta de Galicia. Esta subvención permitió al equipo desarrollar en profundidad la historia de Roberto G. Méndez, quien está trabajando en otro proyecto al mismo tiempo con Treboa.

«Continuamos presentándonos a más ayudas públicas y mercados que nos permitan armar el proyecto con la ambición que merece. Es un recorrido largo, pero también estimulante, y cada pequeño avance nos confirma que hay espacio para una historia como esta«, añaden desde la compañía. «En paralelo, hemos empezado a explorar la coproducción.»

Cartoon Movie será la primera parada internacional de ‘Piso 13’, que no había pasado hasta ahora por ningún otro foro ni laboratorio, y el objetivo del equipo en Burdeos es claro: «Buscamos socios con ganas de subirse a este viaje con nosotros. Queremos tejer alianzas desde un encaje natural, con gente que empatice con el proyecto y que aporte su experiencia para ayudarnos a que crezca en la dirección que imaginamos.»

Además de ‘Piso 13’, otros cuatro proyectos españoles han sido seleccionados para participar este año en la 28ª edición de Cartoon Movie, que tendrá lugar del 3 al 5 de marzo en la ciudad francesa de Burdeos: ‘Aya en el desierto’, dirigida por Julia Horrillo y producida por Alhena Production; ‘Carmen y la cuchara de palo’, cinta de Thinkwild Studios que dirige Carlos Gómez-Mira Sagrado a partir de un guion de Rossana Giacomelli; ‘Silence Sometimes’, coproducción de la española Filmakers Monkeys (Néstor López) y la mexicana Ánima Estudios que está escrita y dirigida por Álvaro Robles; y ‘Tukuy’, película de Aline Romero que producen Huraa AIE y Doce Entertainment / Mr. Miyagi Films.

Marco Sánchez Sequera

CONVOCATORIASINSCRIPCIONESENFESTIVALESYEVENTOS

CartoonMovie2026abresu convocatoriaparapresentar proyectosdelargometrajes deanimación

octubre22,2025porAdmin

Elprestigioso foroeuropeodecoproducciónyde pitching paraproyectos delargometrajedeanimaciónse celebrarádel3al5demarzode2026enBurdeos, Francia.

CartoonMovie2025.

Durantes dos días,los productoresparticipantesen

CartoonMovietendránla oportunidaddepresentarsus proyectos paracine conelobjetivode avanzaren ifnanciaciónyencontrarcoproductoresodistribuidores internacionales.

Spain -

CartoonMovietendránla oportunidaddepresentarsus proyectos paracine conelobjetivode avanzaren ifnanciaciónyencontrarcoproductoresodistribuidores internacionales.

Buscar

Durantes dos días,los productoresparticipantesen

ifnanciaciónyencontrarcoproductoresodistribuidores internacionales.

CartoonMovietendránla oportunidaddepresentarsus proyectos paracine conelobjetivode avanzaren ifnanciaciónyencontrarcoproductoresodistribuidores internacionales.

La convocatoria paratrabajos delargometrajede animaciónpermanecerá abiertahastael12denoviembre de2025.

La convocatoria paratrabajos delargometrajede animaciónpermanecerá abiertahastael12denoviembre de2025. Puedeparticiparcualquierproductoreuropeoqueesté localizadoenunpaís pertenecientea EuropaCreativa MEDIA.

La convocatoria paratrabajos delargometrajede animaciónpermanecerá abiertahastael12denoviembre de2025.

Puedeparticiparcualquierproductoreuropeoqueesté localizadoenunpaís pertenecientea EuropaCreativa MEDIA.

La convocatoria paratrabajos delargometrajede animaciónpermanecerá abiertahastael12denoviembre de2025.

Proyectosquepuedenserenviados

Puedeparticiparcualquierproductoreuropeoqueesté localizadoenunpaís pertenecientea EuropaCreativa MEDIA.

Proyectosquepuedenserenviados

Cadaproductora solopuedeenviarunapelículade animación,perosilacintasehapresentadoa Sneak Preview,es posibleenviarunsegundoproyectoenotra categoría.

Puedeparticiparcualquierproductoreuropeoqueesté localizadoenunpaís pertenecientea EuropaCreativa MEDIA.

Proyectosquepuedenserenviados

Cadaproductora solopuedeenviarunapelículade animación,perosilacintasehapresentadoa Sneak Preview,es posibleenviarunsegundoproyectoenotra categoría.

Proyectosquepuedenserenviados

Los requisitos sonlos siguientes:

Películadeanimación(mínimode50%deanimación) conduraciónmínimade60minutos.

Calidaddecine.

Cadaproductora solopuedeenviarunapelículade animación,perosilacintasehapresentadoa Sneak Preview,es posibleenviarunsegundoproyectoenotra categoría.

Películadeanimación(mínimode50%deanimación) conduraciónmínimade60minutos.

Destinadaadistribuciónensalasdecine.

Los requisitos sonlos siguientes:

Los requisitos sonlos siguientes: internacionales.

Destinadaadistribuciónensalasdecine.

Todas las nuevas técnicas deanimaciónson aceptadas.

Los requisitos sonlos siguientes:

Cadapropuestadebeir acompañadadeunacartade interés deundistribuidor,unagentedeventas internacionalounaplataformade streaming queindique elinterés porelproyecto.Deberáincluir nombredela compañía,nombreyapellidodelapersonadecontactoy cartaenformatoPDF (máximo10MB).

- Spain -

Porotrolado,laorganizaciónavisadequelos

elinterés porelproyecto.Deberáincluir nombredela

Porotrolado,laorganizaciónavisadequelos productores cuyotrabajohayasidoseleccionado no podránretirarlodespués del8deenerode2026o tendránquepagarunacuantíade1.000euros paraser justos conaquellas personas quenotuvieronla oportunidaddeserelegidos.

Materialesdesolicitud

1. Sinopsis: brevedescripcióndelahistoria eninglés.

Materialesdesolicitud

Serápublicadaenlaaplicaciónyenlaweb deCartoon. Máximo700caracteres incluyendo espacios.

compañía,nombreyapellidodelapersonadecontactoy cartaenformatoPDF (máximo10MB).

elinterés porelproyecto.Deberáincluir nombredela compañía,nombreyapellidodelapersonadecontactoy cartaenformatoPDF (máximo10MB).

1. Sinopsis: brevedescripcióndelahistoria eninglés. Serápublicadaenlaaplicaciónyenlaweb deCartoon. Máximo700caracteres incluyendo espacios. elinterés porelproyecto.Deberáincluir nombredela compañía,nombreyapellidodelapersonadecontactoy cartaenformatoPDF (máximo10MB).

1. Sinopsis: brevedescripcióndelahistoria eninglés. Serápublicadaenlaaplicaciónyenlaweb deCartoon. Máximo700caracteres incluyendo espacios. compañía,nombreyapellidodelapersonadecontactoy cartaenformatoPDF (máximo10MB).

1. Sinopsis: brevedescripcióndelahistoria eninglés. Serápublicadaenlaaplicaciónyenlaweb deCartoon. Máximo700caracteres incluyendo espacios.

2. Archivodelproyecto (unPDFquenoexcedalas 25 páginas): incluyepáginadesumarioconeltítulo,los productores ycoproductores,laduración,elgénero ylaaudiencia;elconceptodelproyecto;sinopsisy diversos stills delproyecto;elementosgráficos; tratamientoystorylines;descripcióndelos personajes;descripcióndelestadodeprogreso;y

- Spain -

CartoonMovie2025.

personajes;descripcióndelestadodeprogreso;y notadeintencióndelproductor.

3. Cartadeinterés.

productores ycoproductores,laduración,elgénero ylaaudiencia;elconceptodelproyecto;sinopsisy diversos stills delproyecto;elementosgráficos; tratamientoystorylines;descripcióndelos personajes;descripcióndelestadodeprogreso;y notadeintencióndelproductor.

3. Cartadeinterés.

páginas): incluyepáginadesumarioconeltítulo,los productores ycoproductores,laduración,elgénero ylaaudiencia;elconceptodelproyecto;sinopsisy diversos stills delproyecto;elementosgráficos; tratamientoystorylines;descripcióndelos personajes;descripcióndelestadodeprogreso;y notadeintencióndelproductor.

4. Vídeo: siestádisponible,sedeberáincluirunenlace almismoenelformulariodesolicitud.Tambiénse puedeproporcionarunvídeo víaWeTransfera: movie@cartoon-media.eu.

3. Cartadeinterés.

4. Vídeo: siestádisponible,sedeberáincluirunenlace almismoenelformulariodesolicitud.Tambiénse puedeproporcionarunvídeo víaWeTransfera: movie@cartoon-media.eu.

5. Imágenes: además delas imágenes dearchivodela propuesta,sedebenpreparar tres stills delproyecto paralaaplicaciónmóvilylawebdeCartoon,así comoparalaagendaylaprensa:

4. Vídeo: siestádisponible,sedeberáincluirunenlace almismoenelformulariodesolicitud.Tambiénse puedeproporcionarunvídeo víaWeTransfera: movie@cartoon-media.eu.

5. Imágenes: además delas imágenes dearchivodela propuesta,sedebenpreparar tres stills delproyecto paralaaplicaciónmóvilylawebdeCartoon,así comoparalaagendaylaprensa:

Un stillvertical: 1920×2560px,RGB,jpg,máx.10MB. Coneltítulodelproyecto.Conlogosoelnombrede laproductora.

5. Imágenes: además delas imágenes dearchivodela propuesta,sedebenpreparar tres stills delproyecto paralaaplicaciónmóvilylawebdeCartoon,así comoparalaagendaylaprensa:

Un stillhorizontal: 1920×1150px,RGB,jpg, máx.10MB.Sintexto.Debeserdiferentedela vertical.

Un stillcuadrado: 650×650px,solojpg,máx.1MB.

Un stillvertical: 1920×2560px,RGB,jpg,máx.10MB. Coneltítulodelproyecto.Conlogosoelnombrede laproductora.

Un stillhorizontal: 1920×1150px,RGB,jpg, máx.10MB.Sintexto.Debeserdiferentedela vertical.

Asimismo,enlas categorías deproducciónoSneak Preview,es obligatorioenproyectos depelículasde animaciónunextractodecincominutos.

Un stillcuadrado: 650×650px,solojpg,máx.1MB.

Un stillhorizontal: 1920×1150px,RGB,jpg, máx.10MB.Sintexto.Debeserdiferentedela vertical.

Un stillcuadrado: 650×650px,solojpg,máx.1MB.

Asimismo,enlas categorías deproducciónoSneak Preview,es obligatorioenproyectos depelículasde animaciónunextractodecincominutos.

Los interesados pueden presentarsuproyecto siguiendo los pasos delsiguiente enlace.

Los interesados pueden presentarsuproyecto siguiendo los pasos delsiguienteenlace.

- Spain -

Ocho proyectos iberoamericanos en Cartoon Movie 2026 — Radix

Radix

Ocho proyectos iberoamericanos en Cartoon Movie 2026 — Radix

Radix

Cartoon Movie, foro de pitch y coproducción de largometrajes europeos de animación, ha revelado los proyectos que formarán parte de su edición 2026. Tras un récord de 150 proyectos inscritos, el comité de selección se ha decantado por 50 obras provenientes de 21 países.

En cuanto al estatus, hay 30 en desarrollo, doce en concepto, siete en producción y una en sneak preview. Todos los títulos presentados tienen cualidades que auguran un futuro prometedor para la animación a escala global.

En el terreno iberoamericano hay ocho títulos de nuestra región. Cinco como productor principal y tres como coproductor. Los países representados son España (8) y México (1).

En otras latitudes, sobresale el filme irlandés Kindred Spirits, de Tomm Moore y bajo la producción de Cartoon Saloon; el holandés Once Upon an Egg, que marca el primer largometraje de Nina Gantz; así como el rumano Starseed, bajo la batuta de Anca Damian. No menos destacada es la presencia de dos coproducciones africanas: Ejo, coproducida por Nigeria, y The Heart of the Djembe, coproducida por Costa de Marfil.

No menos destacada es la presencia de dos coproducciones africanas: Ejo, coproducida por Nigeria, y The Heart of the Djembe, coproducida por Costa de Marfil.

A continuación, la selección iberoamericana de Cartoon Movie 2026: 13th Floor (Piso 13)

Dirección: Soraya Antelo Morales

Guion: Roberto González Méndez

Autoría gráfica: Martín Gil

Producción principal: Treboamedia (España)

Dirección: Soraya Antelo Morales

Guion: Roberto González Méndez

Autoría gráfica: Martín Gil

Producción principal: Treboamedia (España)

Una Galicia imaginada, en un futuro cercano. Una extraña niebla —extraña, tóxica y llena de monstruos— cubre la ciudad, y probablemente el mundo, hasta la altura del piso 13. Abajo, nadie quedó con vida. Arriba… Por encima del piso 13, solo sobrevivieron aquellos que, ese día cuando apareció la niebla, decidieron no bajar. Han pasado cinco meses desde ese día, y la mayoría sigue con vida. Pero la mayoría no significa todos. Porque nadie sobrevive cinco meses sobre un océano de monstruos sin aprender a pescarlos, y nadie aprende a pescarlos sin encontrar algo que usar. Ellos, los sobrevivientes, encontraron algo. Lo encontraron muy rápido. Y fundaron un nuevo mundo. Un nuevo mundo aterrador.

Aya in the Desert (Aya en el desierto)

Dirección: Julia Horrillo

Guion: Julia Horrillo, Verónica Adell

Producción principal: Alhena Production (España)

En la costa de Cádiz, un grupo de migrantes subsaharianos es interceptado y llevado a un polideportivo para pasar la noche. Entre ellos se encuentra Aya, una niña de 13 años disfrazada de niño. Mientras intenta reunirse con su prima en España, Aya recuerda momentos clave de su viaje: desde la huida de la guerra en Costa de Marfil hasta el cruce del estrecho en barco. En el camino, imagina las aventuras de la legendaria reina baulé Akwa Boni, cuyo coraje refleja el suyo y la ayuda a sobrellevar las dificultades mientras mantiene vivo el recuerdo de su madre, con la esperanza de volver a verla algún día.

Carmen and the Wooden Spoon (Carmen y la cuchara de palo)

En el camino, imagina las aventuras de la legendaria reina baulé Akwa Boni, cuyo coraje refleja el suyo y la ayuda a sobrellevar las dificultades mientras mantiene vivo el recuerdo de su madre, con la esperanza de volver a verla algún día.

Carmen and the Wooden Spoon (Carmen y la cuchara de palo)

Dirección: Carlos Gómez-Mira Sagrado

Guion: Rossana Giacomelli Soto

Producción principal: Thinkwild Studios (España)

Cuenta la historia de Carmen, una niña creativa y sensible de siete años que no encaja en la escuela ni en su nueva vida tras la separación de sus padres. Su Nonna, una alegre y excéntrica abuela italiana, llega para cuidarla y le regala una cuchara mágica que la transporta a los recuerdos esenciales de su pasado. A través de estos viajes, Carmen descubre la juventud, la pasión y los sacrificios de Nonna. A medida que su memoria comienza a desvanecerse, Carmen y su madre se unen para cuidarla y preservar su legado emocional.

Halloween vs. Day of the Dead

Dirección: Celso García

Guion: Celso García, Francisco Payó, Lorena Machuca

- Spain -

Producción principal: Studio 100 International (Alemania)

Coproducción: 3Doubles Producciones (España)

Dirección: Celso García

Guion: Celso García, Francisco Payó, Lorena Machuca

Producción principal: Studio 100 International (Alemania)

Coproducción: 3Doubles Producciones (España)

Tras perder a su querido abuelo, Pumpkid, un niño de Halloween Ville, descubre una leyenda: en el vecino pueblo del Día de Muertos, los muertos regresan por una noche para visitar a sus seres queridos. Desesperado por un momento más juntos, cruza el puente prohibido, rompiendo una regla que se ha mantenido por generaciones. Allí conoce a Bony Lu, una bondadosa catrina, y juntos develan un misterio que amenaza con cancelar las festividades más queridas de ambos pueblos. Ahora, con el tiempo agotándose, Pumpkid y Bony Lu deben unir fuerzas para recuperar los dulces navideños perdidos y restaurar la magia de Halloween y el Día de Muertos antes de que ambas celebraciones se arruinen este año.

Monster Mia

Dirección: Verena Fels

Adaptación: Monstrous Maud

Producción principal: arx anima animation studio (Austria)

Coproducción: Peng-Boom-Tschak Films (Alemania), arx anima MD (Alemania), Arxlight Pictures (España)

Bienvenidos al pueblo de Primrose Valley, donde las calles están impecables y los jardines perfectamente cuidados. Algunos dirían que Primrose es un lugar agradable, pero para Mia es terriblemente común. Durante toda su vida, Mia se ha sentido fuera de lugar, no solo en su pueblo, sino también dentro de su propia familia. Su hermana gemela, Marie, es la chica perfecta de Primrose. Siempre mantiene una imagen pulida y ordenada sin ningún esfuerzo, sabe exactamente cómo encajar y caerle bien a todo el mundo. Mia, en cambio, siempre llega tarde, ama la ropa extravagante y a su rata mascota Quentin, y, lo más importante, está convencida de que los monstruos aún existen. Tras demasiados incidentes en la escuela, la directora de Primrose envía a Mia a la misteriosa Academia Rotwood. La escuela es oscura y está infestada de murciélagos, lo que le provoca escalofríos a Mia, especialmente cuando descubre que todos sus nuevos compañeros son ¡monstruos de verdad! Al principio, Mia está encantada, pero pronto se da cuenta de que nadie en Rotwood puede saber que es humana, o se meterá en graves problemas. Su única

Radix Animación - 16/12/2025

terriblemente común. Durante toda su vida, Mia se ha sentido fuera de lugar, no solo en su pueblo, sino también dentro de su propia familia. Su hermana gemela, Marie, es la chica perfecta de Primrose. Siempre mantiene una imagen pulida y ordenada sin ningún esfuerzo, sabe exactamente cómo encajar y caerle bien a todo el mundo. Mia, en cambio, siempre llega tarde, ama la ropa extravagante y a su rata mascota Quentin, y, lo más importante, está convencida de que los monstruos aún existen. Tras demasiados incidentes en la escuela, la directora de Primrose envía a Mia a la misteriosa Academia Rotwood. La escuela es oscura y está infestada de murciélagos, lo que le provoca escalofríos a Mia, especialmente cuando descubre que todos sus nuevos compañeros son ¡monstruos de verdad! Al principio, Mia está encantada, pero pronto se da cuenta de que nadie en Rotwood puede saber que es humana, o se meterá en graves problemas. Su única opción es convencer a todos de que ella también es un monstruo. Con el tiempo, Mia hace nuevos amigos: Paprika, una vampira vegana, y Oscar, un monstruo torpe que siempre pierde la cabeza. Mia por fin ha encontrado un lugar donde siente que pertenece. Sin embargo, junto a sus nuevos amigos monstruos, deberá frustrar el malvado plan de su director, Van Vlad, quien quiere convertir a todos los humanos de Primrose en monstruos.

Pirate Mo and the Legend of the Red Ruby

Dirección: Florian Westermann

Adaptación: Seeräubermoses

Autoría obra original: Kirsten Boie

Guion: Richie Conroy

Producción principal: Ulysses Filmproduktion (Alemania)

Coproducción: Letterbox Filmproduktion (Alemania), arx anima Animation Studio (Austria), Arxlight Pictures (España)

A bordo de un barco, cuando terribles piratas vagaban por los siete mares, una niña, Mo, crece con una tripulación de lobos de mar desorganizados y la mascota del barco… una cabra. Tras convertirse en una niña valiente, Mo debe lidiar con la carrera de piratería de su padre y superar pruebas mientras busca comprender el enigma de su origen. Capturada por el malvado pirata Pata de Palo Olle, Mo se topa con el camarero Hannes. Junto con él, Claas y su variopinta tripulación, la valiente Mo tendrá que derrotar a Olle y encontrar el Rubí Rojo Sangriento de la Perdición para restaurar la paz y la armonía en la tierra. Pirata Mo es una aventura de capa y espada llena de corazón, agallas y esperanza por un mundo mejor, liderada por una joven cuya bondad solo es comparable a su audacia.

Silence Sometimes (A veces silencio)

Animación - 16/12/2025

de Palo Olle, Mo se topa con el camarero Hannes. Junto con él, Claas y su variopinta tripulación, la valiente Mo tendrá que derrotar a Olle y encontrar el Rubí Rojo Sangriento de la Perdición para restaurar la paz y la armonía en la tierra. Pirata Mo es una aventura de capa y espada llena de corazón, agallas y esperanza por un mundo mejor, liderada por una joven cuya bondad solo es comparable a su audacia.

Silence Sometimes (A veces silencio)

Dirección: Álvaro Robles

Guion: Álvaro Robles

Autoría gráfica: José Luis Ágreda

Producción principal: Filmakers Monkeys (España)

Coproducción: Ánima Etudios (México)

El nacimiento de Silvia deja a los médicos perplejos. Tras cortar el cordón umbilical, la bebé llora, pero su llanto es silencioso. María, su madre, intenta preguntarle qué le pasa, pero tampoco puede usar la voz. Tras realizarle varias pruebas, los médicos descubren que cualquier cosa que entre en contacto con la piel de Silvia pierde la capacidad de emitir sonido. De adulta, Silvia regenta una pequeña floristería en un barrio de Madrid, heredada de su madre. Decide llevar una vida tranquila y solitaria, consciente de lo que puede hacerle a cualquiera que la toque. Sin embargo, cuando conoce a Marco, un músico de gran talento, su frágil equilibrio comienza a desmoronarse.

Tukuy

Dirección: Aline Romero

Guion: Merce Castellanos, Aline Romero

Producción principal: Huraa AIE (España)

Coproducción: Doce Entertainment / Mr. Miyagi Films (España)

Nacida del vapor de una nube, Tukuy es un espíritu del viento destinado a una transformación sin fin. En su último día antes de convertirse en volcán, emprende un viaje más allá del arcoíris que tiembla entre las montañas. En el camino, descubre que el verdadero milagro no es lo eterno, sino aprender a existir: abrazar el presente antes de que se disuelva en el aire. Una fábula poética sobre

GEOPOLÍTICADEMOCRACIACIENCIASOCIEDADECONOMÍA

LlegaraCádiz enunapatera:la española‘AyaenelDesierto’

LlegaraCádiz enunapatera:la española‘AyaenelDesierto’ desembarcaenCartoonMovie

desembarcaenCartoonMovie

04marzo 2026-18:25 3minutos

Burdeos (Francia), 4 mar (EFE).- La película española ‘Aya en el Desierto’, un filme de animación a cargo de Alhena Production sobre una niña que cruza el estrecho de Gibraltar en una patera hasta Cádiz, desembarca en el Cartoon Movie de Burdeos (Francia), el mayor foro de coproducción de cine animado en Europa.

Radio Televisión Española en 2026, presenta ahora su proyecto a profesionales de la animación de toda Europa.

Si bien aseguró sentir «vértigo» ante la presentación de su película, que ya recibió el premio Paramount + en Roma en 2024, Horrillo se mostró optimista con la posibilidad de «pescar talento» entre los asistentes al Cartoon Movie para sumar al proyecto y «darle legitimidad» a la cinta.

Noticias en los medios suizos sobre España e Hispanoamérica: cada semana en su bandeja de entrada

Dirección de correo electrónico

Al Cartoon Movie acuden desde animadores y dibujantes de todo el continente hasta productores con voluntad de invertir, lo cual lo convierte en un nexo idóneo para proyectos como el de Horrillo, originalmente presentado en el Cartoon Springboard de 2022, foro análogo en el que descubrir a los jóvenes talentos de la industria y que se celebra en Madrid.

Dirección de correo electrónico

Al registrarse, recibirá un paquete de bienvenida y hasta seis actualizaciones al año.

Autorizo el tratamiento de mis datos para el boletín de SWI swissinfo.ch.

Suscríbase gratis

La película, que aún se encuentra en fase de desarrollo, cuenta la historia de Aya, una niña marfileña que llega a la ciudad gaditana en una patera disfrazada de chico y se refugia en la fantasía del relato de una legendaria guerrera marfileña para lidiar con sus circunstancias, cuyas aventuras «se imagina como un reflejo de su propia experiencia».

En el caso de ‘Aya en el Desierto’, que originalmente se concibió como un trabajo final de grado (TFG), primero tuvo que pasar por muchos años de documentación y revisión. Un recorrido que ha sido «largo e intenso» pero que ha dado sus frutos, dijo Horrillo. «Una vez entregamos el TFG, dijimos ‘pues ya está, hasta aquí esta historia’, pero nos seleccionaron en el clúster de la semana del talento audiovisual de Cataluña, donde presentamos el proyecto y conocimos a Alhema, la productora», contó su directora.

- Switzerland -

«Una vez entregamos el TFG, dijimos ‘pues ya está, hasta aquí esta historia’, pero nos seleccionaron en el clúster de la semana del talento audiovisual de Cataluña, donde presentamos el proyecto y conocimos a Alhema, la productora», contó su directora.

Así lo describió en declaraciones a EFE la directora y coguionista de la película, Julia Horrillo, que, tras haber recibido 400.000 euros de

Con ‘Aya en el Desierto’, Horrillo dijo querer hablar de aquello que

Así lo describió en declaraciones a EFE la directora y coguionista de

Con ‘Aya en el Desierto’, Horrillo dijo querer hablar de aquello que

Con ‘Aya en el Desierto’, Horrillo dijo querer hablar de aquello que le «tocaba de cerca» con esta película, en referencia a su infancia

Con ‘Aya en el Desierto’, Horrillo dijo querer hablar de aquello que le «tocaba

con

«Una

sido «largo e intenso» pero que ha dado sus frutos, dijo Horrillo.

historia’, pero nos seleccionaron en el clúster de la semana del talento audiovisual de Cataluña, donde presentamos el proyecto y conocimos a Alhema, la productora», contó su directora.

Con ‘Aya en el Desierto’, Horrillo dijo querer hablar de aquello que le «tocaba de cerca» con esta película, en referencia a su infancia en Sevilla y a la costa gaditana.

«A lo largo de mi vida me he encontrado muchas pateras en mi playa y cuando eres pequeña no le das la importancia que tiene porque no eres capaz de verla, pero una vez te haces mayor te vas dando cuenta de que has normalizado una crisis humanitaria», explicó.

La producción también ha recibido el apoyo económico del Instituto Catalán de Empresas Cultural y del programa MEDIA de la Comisión Europea, pero el Cartoon Movie le ofrecerá ahora la oportunidad de explorar tanto nuevas vías de financiación como potenciales compañeros de trabajo.

La presente edición del Cartoon Movie de Burdeos acoge a 50 proyectos procedentes de 21 países, cinco de los cuales son

La presente edición del Cartoon Movie de Burdeos acoge a 50 proyectos procedentes de 21 países, cinco de los cuales son «Una vez entregamos el TFG, dijimos ‘pues ya está, hasta aquí esta historia’, pero nos seleccionaron en el clúster de la semana del talento audiovisual de Cataluña, donde presentamos el proyecto y conocimos a Alhema, la productora», contó su directora.

La presente edición del Cartoon Movie de Burdeos acoge a 50 proyectos procedentes de 21 países, cinco de los cuales son

La presente edición del Cartoon Movie de Burdeos acoge a 50 proyectos procedentes de 21 países, cinco de los cuales son largometrajes de producción española, lo que convierte a España en el tercer país con mayor presencia en el encuentro, únicamente por detrás de Francia, con 15 proyectos, y de Alemania, con seis.

EFE

plc/cat/psh (foto) (vídeo)

- Switzerland -

GEOPOLÍTICADEMOCRACIACIENCIASOCIEDADECONOMÍA

ElCartoonMoviedeBurdeoscomienza conunadestacadapresenciade proyectosespañoles

03marzo 2026-13:38 4minutos

Pol Lloberas Cardona

La presente edición acogerá a 50 proyectos procedentes de 21 países, cinco de los cuales son largometrajes de producción española, lo que convierte a España en el tercer país con mayor presencia en el encuentro, únicamente por detrás de Francia, con 15 proyectos, y de Alemania, con seis.

«España ha sido durante muchos años el segundo o el tercer país con más presencia y que Alemania esté por delante es casi una excepción (…) España está muy involucrada con las películas», afirmó en declaraciones a EFE la directora del Cartoon Movie, Annick Maes.

Este 2026, España estará representada por ‘A veces silencio’, la historia de una chica que ensordece todo lo que toca; ‘Aya en el Desierto’, en la que una niña marfileña trata de cruzar el estrecho de Gibraltar; ‘Carmen y la Cuchara de Palo’, que trata la tradición familiar a través de tres generaciones; ‘Tukuy’, sobre el viaje de un espíritu nacido del viento, y ‘Piso 13’, que plantea una Galicia posapocalíptica.

- Switzerland -

«España ha sido durante muchos años el segundo o el tercer país con más presencia y que Alemania esté por delante es casi una

A estos proyectos cabe añadir otros tres que contarán con una participación minoritaria española: ‘Monster Mia’, en la que una niña convencional llega a un instituto de monstruos; ‘Pirate Mo and the Legend of the Red Ruby’, sobre una pequeña pirata que trata de hallar un tesoro perdido, y ‘Halloween vs. Day of the Dead’, donde un niño-calabaza y a una niña-esqueleto tratan de salvar dichas festividades.

Dado que el evento reunirá a profesionales de todo el continente para presentar sus proyectos entre este martes y el próximo jueves, el Cartoon Movie supone una oportunidad para promocionarse y conocer «la animación del mañana», según detalló su directora.

«El objetivo es promover la creatividad, acelerar el desarrollo y estimular la coproducción (…) Es el lugar ideal para asociarse y encontrar oportunidades de financiación», explicó Maes.

En esto coincidió el director de ‘Carmen y la Cuchara de Palo’, Carlos Gómez-Mira, que planteó a EFE la posibilidad de convertir su película en «una serie animada» después de que el filme, originalmente concebido como un cortometraje, fuera recibido con múltiples premios internacionales.

‘Carmen y la Cuchara de Palo’, un relato sobre el legado familiar que invita a mayores y pequeños a, según Gómez-Mira, hacer «lecturas a diferentes niveles», será presentada el jueves.

«Nunca estás acostumbrado (a estos foros) por muchos premios y festivales que hayas ganado, porque esto es una experiencia completamente diferente. Aquí vamos a exponer nuestra película para ver si le puede resultar interesante a algún distribuidor, exhibidor, plataforma de televisión extranjera o posible coproductora», detalló.

Desde la primera edición del Cartoon Movie en 1999, más de 500 películas consiguieron su financiación en el foro, entre las cuales se cuentan producciones como las exitosas ‘Tadeo Jones’ (2013) o ‘Buñuel en el Laberinto de las Tortugas’ (2019).

Además del Cartoon Movie, cada año se celebran el Cartoon Forum en Toulouse (sur), dedicado a las series animadas; el Cartoon Business en Bruselas, para fomentar la generación de contactos en el sector; el Cartoon Next en Marsella, centrado en las nuevas formas de animación, y el Cartoon Springboard en Madrid, dedicado a los «jóvenes talentos».

- Switzerlandde Gibraltar; ‘Carmen y la Cuchara de Palo’, que trata la tradición familiar a través de tres generaciones; ‘Tukuy’, sobre el viaje de un espíritu nacido del viento, y ‘Piso 13’, que plantea una Galicia posapocalíptica.

Tanto ‘A veces silencio’ como ‘Aya en el Desierto’ fueron presentadas en los Cartoon Springboard de años anteriores, que han resultado particularmente productivos para las producciones españolas y cuya próxima edición se celebrará en Madrid entre el 3

Business en Bruselas, para fomentar la generación de contactos en el sector; el Cartoon Next en Marsella, centrado en las nuevas formas de animación, y el Cartoon Springboard en Madrid, dedicado a los «jóvenes talentos».

plc/ngp/cat/cg (foto) (vídeo)

Lospreferidosdelpúblico

Comerciantessuizosdecrudoevalúan oportunidadesenVenezuela

- Switzerland -

Cartoon Movie impulsa el futuro del largometraje animado europeo con... https://www.tegustamuchoelcine.com/2026/01/cartoon-movie-impulsa-e...

Cartoon Movie impulsa el futuro del largometraje animado europeo con 50 nuevos proyectos

David

Cartoon Movie reafirma su posición como uno de los motores fundamentales de la animación europea con la selección de 50 proyectos de largometraje para su 28ª edición, que se celebrará en Burdeos del 3 al 5 de marzo. En un contexto de transformación del sector audiovisual, marcado por la internacionalización, la sostenibilidad y la diversidad, el evento se consolida como un espacio estratégico para acelerar la financiación y la visibilidad global de la animación hecha en Europa.

La convocatoria de este año alcanzó un récord histórico de 150 candidaturas, lo que supone un aumento del 22 % respecto a la edición anterior. De ellas, se eligieron proyectos procedentes de 21 países europeos, reflejo de un ecosistema creativo sólido, plural y en plena expansión. Francia lidera la selección con 15 proyectos, seguida de Alemania (6) y España (5), mientras que Europa Central y del Este suma 11 propuestas, confirmando su creciente peso en el panorama animado continental.

Cartoon Movie impulsa el futuro del largometraje animado europeo con... https://www.tegustamuchoelcine.com/2026/01/cartoon-movie-impulsa-e...

1 van 2

La diversidad es uno de los grandes rasgos de esta edición. La selección combina autores consagrados, como Tomm Moore, Anca Damian o Patrick Imbert, con nuevas voces emergentes y estudios independientes, sin perder de vista el atractivo para el gran público. Las temáticas abarcan desde relatos íntimos y sociales hasta aventuras fantásticas, ciencia ficción, documentales animados y narrativas híbridas, demostrando la madurez artística del sector.

20/01/2026, 10:33

En términos de representación, los avances son significativos. El 37 % de los proyectos cuenta con al menos una mujer en la dirección, el 52 % está liderado por una productora principal y casi la mitad presenta personajes femeninos protagonistas. Además, el 38 % de las obras integra temáticas relacionadas con la diversidad y la inclusión, una señal clara de que la animación europea asume un rol activo en la construcción de nuevos imaginarios culturales.

2 van 2

narrativas híbridas, demostrando la madurez artística del sector.

- 19/01/2026

Con un presupuesto global de 275,2 millones de euros y un promedio de 5,5 millones por película, la coproducción sigue siendo clave. El 58 % de los proyectos involucra alianzas entre países del programa Europa Creativa MEDIA y territorios externos como Canadá, Japón, México o varios países africanos, fortaleciendo el alcance internacional de las producciones europeas.

Desde el punto de vista técnico, la animación 2D continúa siendo predominante (54 %), mientras que la 3D representa el 30 %, confirmando una convivencia equilibrada entre tradición y tecnología. En cuanto a públicos, más de la mitad de los proyectos se orientan a familias y niños, pero crece de forma sostenida la producción destinada a jóvenes adultos y adultos, que ya representa el 38 % de la selección.

Cartoon Movie no es solo un mercado de pitches, sino también un espacio de reflexión. Las Cartoon Talks abordarán temas clave como la sostenibilidad en la distribución y producción, así como las sinergias con industrias como el videojuego y la XR/VR. Todo ello refuerza la idea de que la animación europea no solo busca competir, sino liderar narrativas responsables e innovadoras en el escenario global.

20/01/2026, 10:33

ConnectingCanadawithEurope’sanimation sector

CanadasteppedintothespotlightatFrance'sCartoonMovieaspartofefforts tosupportthedomesticanimationindustryonaglobalstage.

CCanada’s funders are looking to the European market to better support the country’s animation industry.

anada’s funders are looking to the European market to better support the country’s animation industry.

Telefilm Canada and SODEC brought a delegation of Canadian producers and buyers to Bordeaux, France to take part in the pitch forum Cartoon Movie from March 3 to 5. The annual event sees European producers pitch animated feature films to potential financiers and coproduction partners.

Six Canadian teams had an opportunity to pitch their projects — four in concept and two in development — for a special Canada-Quebec spotlight at the event. Another six teams will be selected to pitch at Cartoon Movie’s TV-focused sister event, Cartoon Forum, in September. (Applications are open until April 2.)

- Canada -

“Now, more than ever, we need to try to get coproducing partners, [and] animation is an obvious [target],” Élaine Dumont, SODEC’s general manager, international affairs, exports and film marketing, tells PlaybackDaily. “Animated films are made for the international [market].”

Six Canadian teams had an opportunity to pitch their projects — four in concept and two in development — for a special Canada-Quebec spotlight at the event.

Another six teams will be selected to pitch at Cartoon Movie’s TV-focused sister event, Cartoon Forum, in September. (Applications are open until April 2.)

Cartoon, the organizing body behind the two events, was founded by the European Union’s Media Programme in 1987 to support the local animation industry. The organization began with Cartoon Forum and then branched into features with Cartoon Movie in 1999. According to Cartoon, the Forum has helped more than 1,000 projects raise 3.75 billion euros, while Movie has seen more than 500 films raise 3.42 billion euros.

Canada was previously involved with the event through Cartoon Connection, which took place in Quebec City from 2011 to 2018 and allowed Canadian participants the opportunity to vie for attendance at Cartoon Movie.

“It was the North American event for Cartoon, but policies changed and [Media Programme] refocused their financing on Europe,” says Dumont.

Since then, Dumont says she has received regular feedback from Quebec producers requesting the ability to apply to Cartoon Movie.

The opportunity came in 2025 when Dumont met with Cartoon’s general director Annick Maes at the European Film Market, and the idea was sparked to host a spotlight for Canada across the organization’s two events.

“[Canadian and European animation have the] same spirit, same culture, the same understanding, and the same approach, which is very important in coproduction,” says Maes.

Shortly after, Dumont and SODEC brought Telefilm into the mix, with the Canada Media Fund (CMF) on board to support applications for Cartoon Forum.

Telefilm’s chief program officer Francesca Accinelli says it was an “easy yes” for Telefilm. “SODEC [is] often able to lead in a lot of places,” she says. “The Quebec government really invests in ensuring there’s a presence globally, so [we’re] grateful that they open the door sometimes for the rest of Canada.”

The initiative marks the latest step in Telefilm’s concerted effort to increase its support for animation in Canada. The funder announced a $420,000 envelope for animation in its Development Program at the Annecy International Animation Film Market (MIFA) in June 2025, and has invested approximately $23 million across 80 animated projects since 2021.

Accinelli says Telefilm was already receiving positive feedback from the Canadian delegates while at Cartoon Movie, with the producers behind Shanghai Ballade (Lofty Sky Pictures; pictured left) and The President’sDaughter (Quarterlife Crisis Productions) already booking meetings with potential coproducing partners and publishers.

The Canada-Quebec spotlight session was attended

The Canada-Quebec spotlight session was attended by 237 professionals overall, including 104 buyers and 70 producers, according to Cartoon. To compare with the other pitch sessions, the most-attended pitch (Cartoon Saloon’s KindredSpirits) saw 342 attendees and 118 buyers, while the second-most (Vivi Film’s Dreamwalker) had 218 attendees and 94 buyers.

The event offers immediate market insights on the viability of the pitched films, with Cartoon Movie issuing feedback forms to all pitch attendees, which are given directly to the producers.

Dumont says the timing of Cartoon Movie is also a boon to producers. “If you want to be part of the game … you have to be here before [Annecy],” she says. “You’re not necessarily going to sign here, but you need to be part of the list of projects that [buyers] want to have a look at before MIFA.”

Canada will also have an expanded presence at MIFA this year, with more details to come ahead of the June event. This month, Ontario Creates launched a call for applications for producers across Canada to take part in a delegation to MIFA, in collaboration with Telefilm, the Canadian Media Producers Association and Creative BC.

The spotlight was mutually beneficial for Canada and Cartoon. Dumont says SODEC brought multiple buyers to the event, including sales representatives from Pink Parrot Media and Attraction, as well as distributors Les Films Opales and AZ Films and broadcaster Télé-Québec. The plan is to bring even more Canadian broadcasters to Cartoon Forum in September.

Maes says the Canadian delegation helped boost the number of new buyers at the festival. Cartoon reported that 257 buyers were in attendance, with 20% new to the event. Cartoon Movie hosted a total of 831 participants across 48 countries in 2026.

Cartoon Movie reported a record-breaking 150 submissions for 2026, a 22% increase from the prior year, with 50 films selected. Maes says these numbers demonstrate how “the creativity never stops” in the European animation industry despite the “difficult economic situation” the sector is in, largely attributed to the disruption from streaming services.

“We’re in the same boat,” says Dumont of Canada’s animation sector. “It’s easier to raise $25 million with a big-name actor or finance a $2 million film, but the films in between [those budgets] really struggle to find their financing … It takes

three, four or five countries to raise the money. We all have to get together to make the films.”

SODEC, Teleiflm team for pitch event with France’s Cartoon Movie

BY ANDREW TRACY

January 14, 2026

Six Canadian animated projects have been selected for a spotlight session at the European pitching forum.

TTelefilm Canada and SODEC have partnered on an initiative giving six Canadian producers the opportunity to pitch their animated feature-film projects in a special session at the 2026 Cartoon Movie forum in Bordeaux, France.

elefilm Canada and SODEC have partnered on an initiative giving six Canadian producers the opportunity to pitch their animated feature-film projects in a special session at the 2026 Cartoon Movie forum in Bordeaux, France.

Launched in 1999, Cartoon Movie connects animated film producers with a wide range of potential financial partners in order to find co-producers, accelerate financing and negotiate agreements with distributors, sales agents and video game companies.

SODEC and Telefilm have selected six projects — three from Quebec, and three from other provinces across Canada — via an open call to participate in the forum’s Canadian spotlight event, titled Québec-Canada Land in Europe: A Space for Creation. The selected producers will pitch their projects with the goal of securing European co-producers, while also expanding connections and partnerships with players in the European market.

- Canada -

The three Quebec projects chosen for the initiative are Jane, the Fox & Me, from

The three Quebec projects chosen for the initiative are Jane, the Fox & Me, from EmbuscadeFilms; MargueriteandtheDuke from10thAveProductions (Lydia

The three Quebec projects chosen for the initiative are Jane, the Fox & Me, from EmbuscadeFilms; MargueriteandtheDuke from10thAveProductions (Lydia Embuscade Films; MargueriteandtheDuke, from 10th Ave Productions (Lydia andtheMistRider); and The Mountain of Dreams, from CarpeDiem Film & TV.

Two projects are from Toronto-based prodcos: ShanghaiBallade from Lofty Sky Pictures, the studio behind the award-winning EternalSpring; and The President’s Daughter from Quarterlife Crisis Productions.

Rounding out the field is PuddleJumpers, from Vancouver’s Flying Kraken Creative Studios.

Cartoon Movie takes place from March 3 to 5.

Picturedtop(L-R): Jane, the Fox & Me (Embuscade Films); Marguerite and the Duke (10th Ave Productions); The Mountain of Dreams (CarpeDiemFilm&TV)

Pictured bottom (L-R): Shanghai Ballade (LoftySkyPictures); Puddle Jumpers (FlyingKrakenCreativeStudios); The President’s Daughter (Quarterlife Crisis Productions)

ImagescourtesyofCartoonMovie

Cartoon Movie lets Canadians pitch for the first time, eh!

And they’ll get a chance to do the same at Cartoon Forum, as part of a new initiative to build stronger ties between Europe and the Great White North.

By Ryan Tuchow

This year’s Cartoon Movie lineup could feature a lot more beavers and mounties.

January 13, 2026

As part of a new initiative, the annual pitchfest invited a handful of Canadian studios to submit their animated films for consideration for the first time—and it’s already selected six projects that will be presented to European buyers and distributors at the event.

All six films are in very early stages of development. Half are aimed squarely at kids and families: Marguerite and the Duke (10th Avenue Productions) and The Mountain of Dreams (CarpeDiem Film & TV) and The President’s Daughter (Quarterlife Crisis Productions) And the rest skew a bit older to target teens and young adults: Jane, the Fox and Me (Embuscade Films), Puddle Jumpers (Flying Kraken Creative Studios) and Shanghai Ballade (Lofty Sky Pictures).

A few of the producers behind these projects provided more details to Kidscreen

The Mountain of Dreams is a fantasy film about a young girl who enters a dangerous world, and learns lessons about how to fix it that she brings back to the real world. It’s all avout giving kids hope that they can play a role in solving Earth’s ecological problems. CarpeDiem Film & TV has presented at Cartoon Movie as a co-producer before, and its distribution division Pink Parrot Media is handling sales for the film. The script is locked, the studio has started on designs and it’s moving into financing.

Quarterlife Crisis Productions’ The President’s Daughter is the studio’s first animated feature. It’s a hand-drawn film based on Samia Nkrumah, the real-life daughter of Ghana’s first president, Kwama Nkrumah. When her father is ousted in a coup, Samia has to flee to Egypt while wrestling with the question of whether her father is a hero or a villain. The studio is seeking co-producers, financing and distribution.

Meanwhile, Puddle Jumpers is a fantasy action-adventure aimed at tween and teen girls about Bryn, a teenager writing a graphic novel about the hero she wishes she was. But when her book ends up unleashing an evil monster, she has to step up to become the hero she always was. Studio Flying Kraken is looking for financing, co-pro opportunities and partnerships, including publishing.

These and the other three projects will be presented at the event—which is to be held from March 3 to 6 in Bordeaux, France—in a showcase called “Québec-Canada Land in Europe: A Space for Creation”.

The press release announcing this news alludes to the initiative being replicated at Cartoon Forum in September, but doesn’t offer any details about what that will look like. As of press time, CARTOON (the organizer that runs both events) had not responded to our request for more information on this point.

Canadian funding orgs Telefilm Canada, SODEC and Quebecreatif were instrumental in setting up this initiative with CARTOON to help Canadian producers pitch and engage with European buyers and distributors. CARTOON is positioning it as a way for two challenged markets to come together and form new business connections.

Canada has a long history in animation, and has established itself well in the animated feature film market. Recent copros including The Breadwinner (Canada, Ireland, Luxembourg) and Night of the Zoopocalypse (Canada, France, Belgium) have been distributed theatrically in more than 100 countries, according to the release.

Amid the current kids TV commissioning slowdown, many animation studios have pivoted to films to tap into this market’s growing demand for kids & family content, easier access to financing and untapped revenue streams— heightening the importance of events like Cartoon Movie in the industry. Last year’s edition welcomed more than 800 attendees, roughly 250 of which were buyers.

Cartoon Movie 2026 unveiled its full list of projects back in December. Of the 50 that have been selected to present this year, most (29) are aimed at kids and families.

CarpeDiem producer Marie-Claude Beauchamp says this new initiative is a long overdue recognition of Canada’s growing film animation industry and the country’s track record of creating, producing and selling original IPs. “There are determined and resilient Canadian producers who have been fighting for local IPs,” she says. “They have the power and strength to break into the international market.”

Updated 1:54 p.m. ET with quote from Marie-Claude Beauchamp of CarpeDiem, and details on a few of the projects.

15/12/2025,19:16

You’llknowalotofthestudios goingtoCartoonMovie

Mostofthe50projectsselectedfornextyear'spitchfestareforkidsandfamilies,astheindustrycontinues toembracefeaturefilms.

ByRyanTuchow

15/12/2025,19:16

Kidscreen»Archive»You’llknowalotofthestudiosgoingtoCartoonMovie

December15,2025

Mostofthe50projectsselectedfornextyear'spitchfestareforkidsandfamilies,astheindustrycontinues toembracefeaturefilms.

ByRyanTuchow

CARTOONhasselected50projectsforits2026CartoonMoviefilmpitchfest,andtherearegoingtobealot offamiliarkidsindustryfacesattheeventinMarch.

Moreandmorekidscontentstudioshave pivotedtofeaturefilms totapintoagrowingmarketdemandfor family-friendlymovies,escapethecurrentchallengesoffinancingtelevision,expandbrandsandrevenue streams,andexperimentwithlonger-formstorytelling.Andthat’swhytheCartoonMovieeventisonmore radarsthesedays.

December15,2025

Arecord-breaking150submissionswerereceivedthisyear,andsomeofthestudiosthathavebeenselected topitchtheirfilmsindevelopmentinhopesofconnectingwithco-producers,distributors,broadcastersand financingincludeCottonwoodMedia,TeamTOandFolimage.

CARTOONhasselected50projectsforits2026CartoonMoviefilmpitchfest,andtherearegoingtobealot offamiliarkidsindustryfacesattheeventinMarch.

CottonwoodMedia( FindMeinParis )isbringing TheHeartoftheDjembe (pictured)tothemarket.This80minutefilmisabouteight-year-oldImaniwhodreamsofplayingadjembedrum.Theonlyproblemisher instrumentiscursed.Shehastojourneyintotheforesttoliftthehexandsavehervillagefromadrought. BooyaStudios(IvoryCoast)andUmedia(Belgium)areco-producers.

i n s t r u m B o oy a

Themajorityofthisyear’sprojects areaimedatkidsandfamilies(29intotal),andFranceishighly representedintheselectionwith15projects,followedbyGermanywithsixandSpainwithfive.

https://kidscreen.com/2025/12/15/youll-know-a-lot-of-the-studios-going-to-cartoon-movie/?utm_source=newsletter&utm_medium=email&utm_campaign=youll… 1/2

FrenchstudiosLesArmateursandFolimagearecollaboratingona2D-animatedadaptationofaFrenchkids bookseriescalledCornebidouillethathassoldmorethanamillioncopiesinFrance.Their75-minutefilm conceptfocusesonameanwitchwhomeetshermatchinastubbornboywhorefusestoeathercursedsoup. LesArmateursandFolimagepreviouslyteameduponkidsfilm TheSongbirds’Secret ,whichpremiered

DutchstudioSubmarineAnimation( FoxandHareSavetheForest) ispitchingafeature-lengthadaptationofthe popularanimatedseries Sam&Julia. Basedonasame-namebookseriesthathassoldmorethanamillion copies,thisfilmforpreschoolersstarsamousewho\teamsupwithaneighbortosolvethemysteryofwhois stealingeveryone’stoysinhernewbuilding.ThisisaprettyhotEuropeanbrand,whichM.A.R.K.13(oneofthe film’sco-producers)adaptedinto aseries thatFranceTélévisionsandNPOintheNetherlandsairedlastyear.

Andfinally,TeamTOispitchingitsAkiraKurosawa-inspiredfilm Akira’sFlyingWheelchair, aboutaninventor andaparalyzedformertrackstarinaflyingwheelchairwhoexploreamysticalforest.The studiowasat CartoonForuminSeptembershowcasingitsfirstanime-inspiredseries: ShadowSoccer .

CartoonMoviewilltakeplaceinBordeaux,FrancefromMarch3to5.Afulllistoftheselectedprojectscanbe found here

https://kidscreen.com/2025/12/15/youll-know-a-lot-of-the-studios-going-to-cartoon-movie/?utm_source=newsletter&utm_medium=email&utm_campaign=youll… 2/2

Québec and Canada to Shine at Cartoon Movie!

jgeday

Six Québec and Canadian projects have been selected to be pitched at the 27th Cartoon Movie, which will take place from March 3 to 5, 2026, in Bordeaux, France. This first official presence of Québec and Canada at this major European animation event will be supported by a significant delegation of professionals in production, distribution, international sales, publishing, and broadcasting, all working to foster new collaborations and expand international networks.

On this occasion, the recognized expertise of Québec and Canada in animation will be showcased through the initiative “Québec-Canada Land in Europe: A Space for Creation.” This platform will highlight the sector’s dynamism and creativity by presenting an exceptional selection of projects, while offering creators and industry professionals valuable opportunities for exchange, collaboration, and the development of long-term partnerships.

The Société de développement des entreprises culturelles (SODEC) and Telefilm Canada are particularly proud to support this first presence, contributing to the promotion of Québec and Canadian animated cinema and to the visibility of the industry’s expertise and know-how on the European stage.

To learn more about this initiative and the projects selected, please click here

To learn more about the selected Québec projects, please click here (available in French only).

To learn more about this initiative and the projects selected, please click here

-30-

To learn more about the selected Québec projects, please click here (available in French only).

About SODEC

-30-

About SODEC

SODEC’s mandate is to promote and support the development of cultural enterprises in Quebec and abroad in the audiovisual, book, digital creativity sectors, publishing, fine crafts, art market, music and entertainment. SODEC also has a mandate to preserve and showcase 32 heritage buildings that reflect Quebec’s identity.

About Telefilm Canada

As a Partner of Choice, Telefilm Canada is a Crown corporation dedicated to the success of Canada’s audiovisual industry, fostering access and excellence by delivering programs that support cultural resonance and audience engagement. With a lens of equity, inclusivity and sustainability, Telefilm bolsters dynamic companies and a range of creative talent at home and around the world. Telefilm also makes recommendations regarding the certification of audiovisual coproduction treaties to the Minister of Canadian Heritage, and administers the programs of the Canada Media Fund.

Media contact

Joyce Richards Advisor, Strategic Communications Joyce.Richards@telefilm.ca

Joyce Richards Advisor, Strategic Communications

Joyce.Richards@telefilm.ca

QUÉBEC-CANADA LAND IN EUROPE: A SPACE FOR CREATION

Six Québec and Canadian projects have been selected to be pitched at the 27th Cartoon Movie , which will take place from March 3 to 5, 2026, in Bordeaux, France. On this occasion, the recognized expertise of Québec and Canada in animation will be showcased through the initiative Québec-Canada Land in Europe: A Space for Creation .

This first of ficial presence of Québec and Canada at this major European animation event will be supported by a significant delegation of professionals in production, distribution, international sales, publishing, and broadcasting, all working to foster new collaborations and expand international networks.

TeleﬁlmCanada and SODEC are particularly proud to support this ﬁrst presence, contributing to the promotion of Québec and Canadian animated cinema and to the visibility of the industry’s expertise and knowhow on the European stage.

COMPANIESATTENDINGCARTOONMOVIE

PRODUCERSATTENDINGCARTOONMOVIE

Canadian copros win Tributes awards at Cartoon Movie

BY KELLY TOWNSEND

Canadian copros win Tributes awards at Cartoon Movie

BY KELLY TOWNSEND

Allahn'estpasobligé and TheLastWhaleSinger were recognized at the annual animation pitch event in Bordeaux, France.

TTwo Canadian coproductions were feted at the animation feature pitch forum Cartoon Movie in Bordeaux, France on Thursday (March 5).

wo Canadian coproductions were feted at the animation feature pitch forum Cartoon Movie in Bordeaux, France on Thursday (March 5).

Two Canadian coproductions were feted at the animation feature pitch forum Cartoon Movie in Bordeaux, France on Thursday (March 5).

Zaven Najjar’s Allahn’estpasobligé (AllahisNotObliged) won Producer of the Year as part of the Cartoon Tributes awards, while Reza Memari picked up the director award for his work on TheLastWhaleSinger.

The awards recognize excellence in the European animation industry. Delegates at Cartoon Movie voted for the winners during the event, which ran from March 2 to 5.

- Canada -

Montreal’s Yzanakio is among the coproduction partners on Najjar’s Allah n’est pasobligé, which tracks a young Guinean orphan’s perilous journey to connect with his family in Liberia. It is produced by France’s Special Touch Studios alongside Yzanakio and fellow copro partners Creative Touch Studios (France),

The awards recognize excellence in the European animation industry. Delegates at Cartoon Movie voted for the winners during the event, which ran from March 2 to 5.

TheLastWhaleSinger is produced by Berlin’s Telescope Animation in coproduction with Montreal’s La Boîte à Fanny and Prague-headquartered PFX. The film sees a young humpback whale search for a mystical song that will save the ocean from a monster that emerges from a melting iceberg.

Both Allahn’estpasobligé and TheLastWhaleSinger are distributed by Maison 4:3 in Canada.

Rounding out the winners at Cartoon Movie were France’s Les Films du Préau, which won Distributor of the Year, and the Czech/Denmark copro Acorn’s Adventure, which took the Eurimages Co-development Award.

Canada and Quebec took part in a spotlight session at Cartoon Movie on Wednesday (March 4), which saw six teams pitch animated feature projects either in concept or development.

Photo©CartoonMovie;pictured(L-R): Allah n’est pas obligé producersAdrien Chef,Anne-LaureGuégan,AnnemieDegryseandSébastienOnomo;LesFilmsdu Préau’s Emmanuelle Chevalier; and Reza Memari

Cartoon Movie 2026 – Sept projets qui ont retenu mon attention

2026 – Sept attention

De nombreux projets de long métrages ont été présentés lors du Cartoon Movie

2026 ayant eu lieu à Bordeaux au début du mois de Mars : voici les projets qui m’ont intéressé lors des différents pitchs. Veuillez noter que leur degré d’avancement ne sont pas tous les mêmes et que les images dans cet article peuvent ne pas être représentatives du long métrage Jnal (si celui-ci vient à arriver sur les écrans).

9 avril 2026 par Muriel • Scroll

KKiinnddrreedd SSppiirriittss

Un enfant réfugié irlandais seul à New York en 1847. Un ;ls Choctaw loin de la chaleur de sa famille. Lorsque leurs chemins se croisent, Mara et Tushka vont vivre des aventures épiques et des rencontres magiques, sous le regard attentif du frère de Mara, Dan, qui ne peut accepter son propre passage dans le royaume des esprits. Ensemble, ils partent à la recherche d’une famille et d’un endroit où ils se sentiront chez eux. Explorant le lien historique entre les nations irlandaise et choctaw, Kindred Spirits est un ;lm sur la grâce, la compassion et l’humanité.

Avec l’association entre Cartoon Saloon et Folivari, Tomm Moore nous plonge dans son nouveau projet de long métrage qui mêle la solidarité entre amérindiens et irlandais sur fond de boxe sur le sol américain (cri d’aigle obligatoire). Au scénario, on retrouve Will Collins (l’excellent épisode de Star Wars : Visions qu’est La caverne des hurlements), habitué de Cartoon Saloon, et la scénariste Shelley Davis qui apporte son expertise autochtone. Les visuels donnent un aperçu de la nature automnale mais aussi des motifs patchworks représentatifs de culture amérindienne. On peut toutefois déplorer que le duo composée de Mara et Tushka avancent autour de la mort de Dan, le frère de Mara. Peut-être que les studios ne font pas assez conJance à leurs protagonistes ? Je reste tout de même curieuse de ce projet prévu pour juillet 2029.

TThhee

HHeeaarrtt ooff tthhee DDjjeemmbbee

Imani, huit ans, est une petite ;lle pleine d’entrain qui vit avec sa grand-mère dans le village d’Alkeboulane. Son plus grand rêve ? Jouer du djembé, comme son défunt père et son frère, qui perpétue son héritage. Mais à Alkeboulane, les femmes n’ont pas le droit de toucher cet instrument, sous peine d’attirer une puissante malédiction. Lorsqu’une sécheresse implacable s’abat sur le village, Imani se lance dans un périlleux voyage au cœur de la nature sauvage : elle doit trouver Denga, le dieu de l’abondance, et découvrir la vérité cachée dans la forêt.

Imani parviendra-t-elle à sauver son village et à briser l’ancienne malédiction du djembé ? Une histoire palpitante mêlant musique, magie et courage, où le rythme d’une jeune ;lle pourrait changer le destin de son monde.

Excellente surprise de cette édition du Cartoon Movie, The Heart of Djembe, réalisé par Mathieu Vavril, arrive à créer une quête initiatique pertinente et construite autour de son héroïne Imani. Le Jlm arrive à mélanger enjeux locaux avec les périls subis par le village et les mythes volontairement oubliés et mystérieux concernant les dangers de la pratique du Djembé. Les studios Cottonwood Media, Booya Studio et Umedia tiennent une pépite qui, pour un budget de 4 millions d’euros, pourrait voir le jour en 2029.

OOnnccee uuppoonn aa EEgggg

Dans le ;lm en stop motion Once upon an Egg, nous suivons deux pigeons de ville gris tout à fait ordinaires, Molly et Mick, qui ont eu la chance de faire leur nid au

Dans le ;lm en stop motion Once upon an Egg, nous suivons deux pigeons de ville gris tout à fait ordinaires, Molly et Mick, qui ont eu la chance de faire leur nid au sommet d’un stand de frites au cœur d’Amsterdam. Un jour, tout bascule lorsqu’une équipe de nettoyage emporte leur nid — et avec lui, leur seul œuf. Le cœur brisé, ils se mirent en route à la recherche d’un nouveau foyer et d’un nouveau sens à leur vie. Tout en prenant soin l’un de l’autre, ils comprennent que ce n’est qu’en s’adaptant à une ville en pleine mutation qu’ils pourront se construire une nouvelle vie — et fonder une famille — qui leur soit propre.

Réalisé par Nina Gantz, Once upon a egg est une histoire émouvante et drôle mettant à l’honneur cet oiseau considéré comme moche qu’est le pigeon. Molly et Mick sont l’incarnation de la daronnie à l’ancienne, mais ils vont devoir s’occuper d’un bébé perruche qui leur tombe entre les ailes. La réalisatrice a mis en avant l’utilisation de matériaux de récupération pour créer des silhouettes de pigeons, comme par exemple l’utilisation de gants pour leur silhouette. Initialement, je n’avais pas prévu de voir ce pitch mais c’était une agréable surprise que je me devais de vous partager. La coproduction entre KleperJlm, A private view et Hausboot prévoit un budget de 9 millions d’euros, ce qui est assez cohérent pour de la stop motion, mais pas d’année de sortie éventuelle.

IIggii

À l’époque préhistorique, au sein d’une tribu de chasseurs-cueilleurs primitifs quadrupèdes, vit Igi, un jeune garçon qui devient ;nalement le premier à se tenir debout dans une société d’individus voûtés. « Personne ne se tient debout comme ça », déclare le nouveau chef, replaçant de force Igi dans la posture attendue. Igi est désormais confronté à un choix crucial : se conformer et réprimer ses capacités exceptionnelles, se fondre dans la masse, ou explorer plus profondément ses dons et risquer l’exil du seul foyer sûr qu’il connaisse.

Porté par le studio géorgien 20 Steps Animation et le sudio grec Heretic, adapté de l’œuvre éponyme de Jemal Karchkhadze, Igi est réalisé par Natia Nikolashvili. Le projet nous place dans une réiexion philosophique autour de la question de libre arbitre dans une société préhistorique cruelle. L’esthétique présentée ici se rapproche de la Planète des Singes avec une dimension plus sombre et plus intense vu le réalisme induit dans l’esthétique de ces personnages proto-humains. Les scènes laissent volontairement le spectateur dans un état introspectif bienvenu. Avec son budget de 1,6 millions d’euros, il serait attendu pour le printemps 2027.

CCoossmmoo PPrriinncceessss

Quelque part dans l’in;ni cosmos, un astronaute perdu et une princesse cosmique se rencontrent. Son espoir : rentrer chez lui. Le sien : échapper à son destin qui est de devenir une étoile. Fascinée par ses récits sur la « Terre », elle l’aide à retrouver son chemin, espérant trouver elle-même refuge. Ce pacte improbable les lance dans une odyssée périlleuse à travers le cosmos, une quête qui pourrait bouleverser à jamais leur destin… et celui de l’univers tout entier.

Animation -09/04/2026

Produit par Sacrebleu et réalisé par Quentin Rigaux, Cosmo Princess est une ode iamboyante à l’esthétique et aux références des animes des années 80-90 (Goldorak, Mazinger Z, Cobra, Dragon Ball ont été cités par Ron Dyens et le réalisateur durant le pitch). La bande annonce envoie du lourd en couleurs, et cela fait du bien de retrouver de la science-Jction fantaisiste avec cet optimisme visuel. Mon seul bémol vient de la construction du personnage de la princesse du titre, qui se révèle hélas à la fois cliché et un fusible narratif pour le destin du héros. Avec son budget de 8 millions d’euros, Cosmo Princess pourrait sortir sur les écrans en 2029.

LLoolllliippoopp TTaattttoooo

Lollipop Tattoo (le nom doux d’une cicatrice de mastectomie) explore l’odyssée surréaliste de la créatrice face au cancer du sein. Deux fois. Son avatar, Eva, se glisse dans ses souvenirs de jeunesse, entre attractions balnéaires et soleil, qui se transforment en quelque chose de sombre et de corporel alors qu’elle jongle entre vie familiale et maladie. Rosebud, son mari, lutte pour soutenir Eva émotionnellement et elle compte sur sa meilleure amie Crystal, tandis que les besoins et les humeurs de leur ;ls Angelo changent. La mère d’Eva aux ÉtatsUnis, Shortie, submergée par le chagrin pour son ;ls Dean décédé, ne parvient pas à faire face. Dix ans plus tard, Eva s’en sort, touchée à la fois mentalement et physiquement, mais toujours debout.

France -

Réalisé par Lisa Marie Russo, Lollipop Tattoo aborde la masectomie et le deuil de

Little big Animation -09/04/2026

émotionnellement et elle compte sur sa meilleure amie Crystal, tandis que les besoins et les humeurs de leur ;ls Angelo changent. La mère d’Eva aux ÉtatsUnis, Shortie, submergée par le chagrin pour son ;ls Dean décédé, ne parvient pas à faire face. Dix ans plus tard, Eva s’en sort, touchée à la fois mentalement et physiquement, mais toujours debout.

Réalisé par Lisa Marie Russo, Lollipop Tattoo aborde la masectomie et le deuil de façon décalé et coloré. On y découvre une galerie de personnages touchants qui soutiennent Eva comme ils le peuvent. Panoramine, Punn Pictures et Fly Film ont choisi Violette Delvoye (Les liaisons foireuses) pour la direction artistique de ce projet en concept, donc en tout début de production. Avec son budget prévisionnel de 4 millions d’euros, ce long métrage ambitieux serait attendu pour 2029.

SSaannddeerr’’ss MMiiddssuummmmeerr

Sander (14 ans) cache ses blessures derrière une routine stricte et une apparence irréprochable. Contraint de fêter le solstice d’été dans la maison de campagne chaotique de sa grand-mère, ses pires cauchemars deviennent réalité. Il est transporté dans un monde fantastique qeuri où tout ce que Sander déteste est présent : une nature sauvage, des créatures impulsives et un manque total de discipline. Lorsqu’il rencontre la charmante reine solaire, Sander trouve une âme sœur dans sa quête d’ordre. Mais la reine solaire prépare un rituel macabre pour le solstice d’été, et Sander doit affronter sa plus grande peur : révéler ses imperfections et sa vulnérabilité. Sander’s Midsummer est une histoire d’acceptation de soi et de reconnexion avec la nature, avec nous-mêmes et avec ceux qui nous aiment.

6/8 - France -

Little big Animation -09/04/2026

Sander’s Midsummer, réalisé par Hanne Berkaak, nous dépeint la vie d’un ado coincé dans la rigueur et les préceptes masculinistes qui va se retrouver projeté dans un univers représentant tout ce qu’il déteste, un projet en concept on ne peut plus ancré dans notre époque. La présentation des studios norvégiens et allemand MikfroJlm, Den site skiling et Knudsen Pictures a eu le mérite d’être fun et encace mais n’a pas donné de budget précis pour ce projet en concept.

← Article précédent

Article suivant→

Mots-clefs : 20 Steps Animation, A private view, Booya Studio, cartoon movie, cartoon saloon, Cottonwood Media, Fabrique d'Images, Fantabulous, Fly Film, Folivari, Hausboot, Heretic, Human/PFX, KleperJlm, New Europe Film Sales, Panoramine, Punn Pictures, Sacrebleu Production, Umedia / Rangé sous : Cartoon Movie 2026, Festivals et événements

Annecy 2026 – Les Work in Progress des longs métrages qui ont retenu notre attention

15 avril 2026 par La rédaction •

8/8 - Franceimperfections et sa vulnérabilité. Sander’s Midsummer est une histoire d’acceptation de soi et de reconnexion avec la nature, avec nous-mêmes et avec ceux qui nous aiment.

Critique Annecy 2025 – Amélie et la

Animaatiossa kaikki on mahdollista – Nick Cave menee kouluun 1970-luvun alun Tukholman lähiössä

Heikki Jokinen

Animaatiossa kaikki on mahdollista – Nick Cave menee kouluun 1970-luvun alun Tukholman

Animaatiossa kaikki on mahdollista – Nick Cave menee kouluun 1970-luvun alun Tukholman lähiössä

lähiössä

Heikki Jokinen, teksti

Heikki Jokinen

Heikki Jokinen, teksti

Vuosi 1971, eteläisen Tukholman huonomaineinen lähiö Rågsved. Luokalle tulee uusi 14-vuotias poika, Nicholas Cave Australiasta. Hän saa paikan Joakim Thåströmin vierestä. Muiden silmissä hieman oudot pojat ystävystyvät. He alkavat etsiä totuutta, kestävää kauneutta ja halpaa viiniä.

Heikki Jokinen, teksti

Me tunnemme heidät aivan muualta. Joakim Thåström on Ruotsin suurimpia rocktähtiä, punkyhtye Ebba Grönin ja Imperietin sielu. Sittemmin hän siirtyi soolouralle. Australialainen muusikko Nick Cave nousi maailmanmaineeseen Bad Seeds -yhtyeensä kautta.

– Näin unen, aivan oikeasti. Siinä musiikilliset sankarini Nick Cave ja Thåström tutustuvat toisiinsa – ja sitten heräsin, sanoo Before They Were Gods -elokuvan ohjaaja ja käsikirjoittaja Måns Mårlind.

– Herättyäni tajusin, että he ovat sen ikäisiä, että olisivat voineet olla samalla luokalla, hän lisää vuonna 1957 syntyneistä rocktähdistä. He täyttävät ensi vuonna 70.

Miksi ei, Mårlind päätti, ja alkoi tehdä elokuvaa unensa pohjalta. Hän kertoo olleensa tuohon aikaan masentunut avioeronsa vuoksi ja halunneensa tehdä jotakin, joka antaa toivoa.

– Herättyäni tajusin, että he ovat sen ikäisiä, että olisivat voineet olla samalla luokalla, hän lisää vuonna 1957 syntyneistä rocktähdistä. He täyttävät ensi vuonna 70.

Miksi ei, Mårlind päätti, ja alkoi tehdä elokuvaa unensa pohjalta. Hän kertoo olleensa tuohon aikaan masentunut avioeronsa vuoksi ja halunneensa tehdä jotakin, joka antaa toivoa.

– Molemmat etsivät rakkautta ja elämän tarkoitusta, mutta tulokulma on eri. Caven pohtiva, Thåströmin vihaava. He rakastuvat samaan tyttöönkin, Linneaan. Kaksi tulevaa rocktähteä ovat kaksi puoltani, utelias ja juro.

– Maailma on kauhea, emme voi luottaa mihinkään. Nuorten pulma on se, että heillä ei ole mihin verrata, minun ikäiselläni on. Siksi moni etsii turvaa uskonnostakin. Esikuvana Mystiska 2:an

– Maailma on kauhea, emme voi luottaa mihinkään. Nuorten pulma on se, että heillä ei ole mihin verrata, minun ikäiselläni on. Siksi moni etsii turvaa uskonnostakin.

Esikuvana Mystiska 2:an

Visuaalisesti elokuvahanke heijastaa tiukasti 1970-luvun Ruotsia. Esikuvana on Rolf Gohsin (1933–2020) erittäin 1970-lukuhenkinen, yhä arvostettu Mystiska 2:an -sarjakuva. Suomeksi sitä on nähty vain hiukan Mustanaamio-lehdessä Salaperäiset kaverukset -nimellä.

– Halusin ohjata animaation, koska siten voin tehdä maagista realismia. Näytelmäelokuva vanhenee, animaatio ei, Mårlind sanoo.

Molemmat rocktähdet lupautuivat tekemään osansa ääniraidalla, ohjaaja kertoo. Caven osuus äänitetään Lontoossa.

– Meille oli suurempi juttu saada Thåström suostumaan elokuvaan kuin Nick Cave, joka rakasti

käsikirjoitusta. Thåström taas ei anna edes haastatteluja.

Tuotantoyhtiö tiedotti hankkeesta jo sen aiemmassa suunnitteluvaiheessa 2022.

– Koska en koskaan ollut Ruotsissa vuonna 1971 enkä ole ikinä tavannut Thåströmiä, olen tietysti kiinnostunut tietämään, mitä emme koskaan tehneet, Cave sanoi tiedotteessa.

Elokuva on hauska, mutta en sanoisi sitä komediaksi, Mårlind määrittelee.

– Se voi itkettää ja olla syvällinenkin, mutta en ole Disney.

Elokuva on ollut tekeillä jo neljä vuotta, mutta yhä kehittelyvaiheessa. Seitsemän miljoonan euron budjetin kokoaminen 80 minuutin animaatiolle vaatii työtä.

Night Tram.

Prahan paras raitiovaununkuljettaja

Michaela Pavlátován (s. 1961) Night Tram vie meidät prahalaisen raitiovaununkuljettaja Boženan elämään. Hän on ollut vuosikymmeniä kaupungin paras kuljettaja, mutta uusi johto erottaa hänet.

Aiempi varmuus katoaa, uuden työn ja uusien työtapojen oppiminen on vaikeaa. Božena menettää työsuhdeasuntonsakin ja muuttaa poikansa luo.

Tsekki Pavlátová on arvostettu itsenäinen animaatio-ohjaaja. Hänen lyhytelokuvansa ovat keränneet tukun palkintoja aina esikoiselokuvasta Words, Words, Words (1991) alkaen. Hänen pitkä animaationsa My Sunny Maad (2021) kertoi Afganistaniin muuttavasta tsekkinaisesta.

Night Tram sai kipinän Pavlátován lyhytelokuvasta Tram (2012). Se on vahvan eroottinen fantasia

Finland -

raitiovaununkuljettaja Boženan ajatuksista vaununsa ohjaimissa. Nyt hän asettuu eri elämänvaiheeseen, vanhenee. Fantasiat keskittyvät työn säilyttämiseen.

Night Tram -elokuvan työryhmää. Keskellä ohjaaja Michaela Pavlátová. Kuva: Celia Lenoir

Ikä muuttaa näkymättömäksi

– Night Tram on hauska elokuva ikääntymisestä, ja se pohjautuu omiin kokemuksiini, Pavlátová sanoo.

– Kun täytin 60, tunsin vanhenevani. En ymmärtänyt, mitä tapahtuu. Keho muuttuu, on outo, mutta sisällä olet yhä sama.

– Tämä on myös yhteiskunnallinen kysymys: olet näkymätön. Mutta älä panikoi, meitä on monta. Tapaat vielä muita ihmisiä ja sinulla on tuttuja vuosien varrelta, moni muistaa sinut.

Boženakin muuttuu näkymättömäksi. Työ loppuu, asunto häviää eikä pojankaan perhe halua pitää hantä luonaan. Božena laitetaan vanhainkotiin, jossa hän muuttuu hyönteiseksi maailmankirjallisuudesta tutun prahalaisnovellin tapaan.

– Muutos ei kerro vain siitä miltä hänestä tuntuu, vaan myös siitä miten muut näkevät hänet.

– Elokuvaani vanhana olemisesta tarvitsin nuoria ihmisiä. Siinä missä Božena kutistuu, pojantytär Helenka vanhenee ja kasvaa. He oivaltavat tarvitsevansa toisiaan.

Rahoituksesta on koottu 80 prosenttia, 78-minuuttinen elokuva valmistunee aikataulun mukaan

Finland -

toukokuuksi 2027. Budjetti on 2,6 miljoona euroa.

Visuaalisesti elokuva vaihtelee realistisesta surrealistiseen. Värimaailma sopeutuu kuhunkin tilanteeseen, piirrosta leimaa käsityön henki. Kokonaisuudessa on vahva luovan tekijän läsnäolon tuntu.

Lopuksi Pavlátová haluaa vielä painottaa tärkeää asiaa.

– Tämä on komedia, jos ette sattuneet ymmärtämään sitä.

Aikuisten animaatiota halutaan

Bordeaux’ssa järjestettävä Cartoon Movie on jokavuotinen eurooppalaisen pitkän animaatioelokuvan yhteistuotantotapahtuma. Tänä vuonna paikalle saapuneille 832 alan ammattilaiselle esiteltiin 50 rahoitusta, levitystä tai yhteistyökumppaneita etsivää, uutta elokuvahanketta. Ne ovat tuotannon eri vaiheissa, konseptina, kehitteillä tai tuotannossa.

Aikuisille suunnattu animaatio haukkaa joka vuosi reippaan osan hankkeista. Tänä vuonna aikuisille ja nuorille aikuisille suunnattiin 19 hanketta.

Tapahtuman järjestävän Cartoonin johtaja Annick Maes sanoo, että Euroopasta löytyy yhä uusia ostajia, jotka haluavat aikuisten animaatioita.

Tämän vuoden tapahtumasta hän nostaa esille uutena narratiivina afrikkalaisaiheiset elokuvat.

– Niitä ei ole paljoa nähty Michel Ocelot’n jälkeen, Maes sanoo viitaten Kirikou-animaatiolla (1998) maailmanmaineeseen nousseeseen ranskalaisohjaajaan.

Muina ajankohtaisten aikuisten animaatioiden näkyvinä teemoina hän nostaa esiin maailman todellisuuden, sodat ja muuttoliikkeen.

Ejo.

Lapset kansanmurhan raunioilla

Afrikka-aiheisia hankkeita nähtiin Bordeaux’ssa tänä vuonna kolme. Niistä kaksi liittyi Ruandan kansanmurhaan.

Puolalaishanke Ejo kertoo verisestä kesästä 1994. Kaksi eri heimoihin kuuluvaa lasta pelastui joukkomurhasta. 12-vuotias Didi asuu yksin tuhotun kylän raunioissa, nälän ja kauheuksien muiston vaivaamana. Ruokaa on löydettävä, mutta samalla varottava kierteleviä murharyhmiä.

Kylän raunioille palaa myös Didin aiemman elämän ystävä, 8-vuotias Eric. Hän on sukua murhaajille, ja Didi kohdistaa vihansa poikaan. He huomaavat kuitenkin pian, että yhdessä on helpompi selviytyä oudoksi muuttuneessa maailmassa.

Tarina luotaa vihan, trauman, toipumisen, anteeksiannon ja hennon toivon teemoja.

Ejo-elokuvan tuottaja Kasia Panas. Kuva: Celia Lenoir

Elokuvan tuottaa puolalainen Animoon-yhtiö. Tuottaja Kasia Panas kertoo, että heiltä on kysytty, miksi puolalaiset haluavat tehdä elokuvan Ruandasta.

– Me halusimme kuunnella. Puhuimme monien kanssa, Ruandasta ja Puolasta. Kävimme Ruandassa opintomatkalla.

Animoon hakeutui yhteistyöhön ruandalaisen studio IYUGI:n kanssa, mikä tuo paikallisen ymmärryksen mukaan elokuvantekoon. Osa animaatiosta tehdään Nigeriassa.

Elokuva on mustavalkoista viivapiirrosta. Se tuo mieleen Manu Larcenet’n piirtämään sarjakuvaan La Route, joka perustuu Cormac McCarthyn romaaniin, mutta on selvästi lyyrisempää.

Ejon budjetti on 2,8 miljoonaa euroa, ja siitä oli koossa ennen Cartoon Movieta 78 prosenttia. Pituutta elokuvalle tulee 80 minuuttia.

Elokuva on mustavalkoista viivapiirrosta. Se tuo mieleen Manu Larcenet’n piirtämään sarjakuvaan La Route, joka perustuu Cormac McCarthyn romaaniin, mutta on selvästi lyyrisempää.

- 08/04/2026

Ejon budjetti on 2,8 miljoonaa euroa, ja siitä oli koossa ennen Cartoon Movieta 78 prosenttia. Pituutta elokuvalle tulee 80 minuuttia.

Kigali Night.

Silminnäkijänä Ruandassa

Ranskalainen Samuel Lajos suositti 18 kuukauden siviilipalveluksensa audiovisuaalisena assistenttina Ranskan kulttuurikeskuksessa Kigalissa, Ruandan pääkaupungissa. Vuosi oli 1994, jolloin kansanmurha puhkesi.

– En ollut koskaan kuullut Ruandasta, Afrikan politiikka oli minulle etäistä. Löysin maan, joka oli sisällissodan partaalla. Olisi väärin sanoa, että se oli hyvää aikaa, mutta löysin fantastisen maan ja sain hyviä ystäviä, Lajos sanoo.

– Kuinka on mahdollista, että en nähnyt, mitä tapahtuu? Tämä elokuva ei ole dokumentti, se kertoo fiktiona mitä koin.

Elokuva Kigali Night kuvaa, kuinka maa ajautuu sotaan ja väkivallasta tulee arkipäivää. Työssään Lajos – tai oikeamminkin häntä muistuttava päähenkilö – kiertää maassa ja saa todistaa yhä

useammin merkkejä tilanteen huononemisesta. Maan radio ja televisio eivät siitä kuitenkaan kertoneet.

– Emme voi sanoa, että emme tienneet.

Sarjakuvapiirtäjä ja kuvittaja Xavier Coste vastaa elokuvan visuaalisesta asusta. Tämä on hänen ensimmäinen animaatiohankkeensa.

– Etsin kuvista subjektiivisuutta. Samuelin muistot eivät ole tarkkoja, se antoi tilaa omille väreilleni ja tyylilleni, Coste sanoo.

– Tulen sarjakuvasta, mutta en yritä toistaa tyyliäni.

Tulos onkin vaikuttava. Maalaukselliset kuvat hehkuvat Afrikan värejä ja lämpöä. Luonnon kauneus ja vihreys ovat osa tarinaa, sitä kiehtovaa maata, jonka Lajos löysi.

Palatsista maanpakoon

Tämän vuoden kolmas Afrikka-aiheinen hanke tulee Kanadasta. Eurooppalainen animaatioteollisuus verkottuu tehokkaasti maailmalle, ja tänä vuonna vieraina oli joitakin hankkeita Kanadan ranskankielisestä Quebecistä.

The President’s Daughter perustuu Samia Nkrumahin ohjaaja Ian Ketekulle kertomiin lapsuudenkokemuksiin. Samia (s. 1960) on Ghanan ensimmäisen presidentin Kwame

Nkrumahin tytär.

– Animaatiossa ei ole nähty monia afrikkalaisia sankareita. Nkrumah oli sellainen, Keteku sanoo.

Hän on itsekin ghanalaista sukujuurta sekä monialainen taiteilija. Keteku on muun muassa voittanut World Poetry Slamin.

Keskustelua Kigali Night -elokuvan jälkeen. Keskellä ohjaaja Samuel Lajus. Kuva: Ivan Rozhdestvenskii

The President’s Daughter.

Kwame Nkrumahista tuli Ghanan ensimmäinen presidentti vuosiksi 1960–1966. Maa oli ensimmäinen mustan Afrikan itsenäistynyt siirtomaa ja Nkrumahista tuli pan-afrikkalaisuuden tunnetuin puolestapuhuja. Sotilaat kaappasivat vallan Ghanassa vuonna 1966 ja Nkrumah pakeni Guineaan.

– Ghanasta ja Nkrumahista tuli valon soihtu Afrikalle. Kuten Nkrumah itse sanoi: En ole afrikkalainen, koska synnyin täällä, vaan koska se syntyi minussa.

Samia-tyttären kanssa puhuessaan Keteku kuitenkin ymmärsi, että unelmoijien toimiessa perhe usein kärsii. Perhe pakeni Egyptiin, josta Samian äiti oli kotoisin.

Vuodet 1957–1966 kattavan elokuvan visuaalisen asun luo Torontossa asuva ghanalaislähtöinen kuvittaja Gyimah Gariba. Piirros on sujuvaa, animaation suuren linjan mukaista työtä. Se sopii, sillä elokuva on suunnattu koko perheelle, ei vain aikuisille.

– Tajusimme, että meillä on todellinen prinsessatarina. Palatsista maanpakoon, rikkauksista ryysyihin, Gariba sanoo.

Heikki Jokinen

Kirjoittaja on vapaa journalisti ja kriitikko. Hän osallistui Cartoon Forumiin kutsuttuna ja kutsuja vastasi matkakuluista.

SubscribePastIssues Translate

SANDER’S MIDSUMMER - NEW PROJECT UNVEILS AT CARTOON!

Together with producer Kristine Knudsen of Den siste skilling and Sandra Perez of Knudsen Pictures, we are proud to bring Hanne Berkaak’s next feature after Pesta to Cartoon Movie! Sander’s Midsummer will be presented in concept on Thursday Mach 5th at 12:15 in Amphi Blue.

SANDER’S MIDSUMMER - NEW PROJECT UNVEILS AT CARTOON!

Sander’s Midsummer will be a 3D film for families, children 8-11. It tells the story of Sander (14), who conceals his wounds beneath strict routines and a flawless surface.

Forced to celebrate Midsummer at his grandmother’s chaotic country house, his worst nightmares come true. He is transported to a floral fantasy world with everything Sander detests: untamed nature, impulsive creatures, and a total lack of discipline.

When he meets the enchanting Solar Queen, Sander finds a counterpart in his strive for order. But the Solar Queen is planning a gruesome Midsummer ritual, and Sander must confront his worst fear: revealing his own imperfection and vulnerability.

Sander’s Midsummer is a story of self-acceptance and reconnection - with nature, ourselves, and the people who love us.

Sander’s Midsummer will be a 3D film for families, children 8-11. It tells the story of Sander (14), who conceals his wounds beneath strict routines and a flawless surface. Forced to celebrate Midsummer at his grandmother’s chaotic country house, his worst nightmares come true. He is transported to a floral fantasy world with everything Sander detests: untamed nature, impulsive creatures, and a total lack of discipline. When he meets the enchanting Solar Queen, Sander finds a counterpart in his strive for order. But the Solar Queen is planning a gruesome Midsummer ritual, and Sander must confront his worst fear: revealing his own imperfection and vulnerability.

Sander’s Midsummer is a story of self-acceptance and reconnection - with nature, ourselves, and the people who love us.

To book meetings in Berlin or Bordeaux, please reach out to producer Tonje Skar Reiersen.

Cartoon Movie 2026: “Optimism and Fun is Back.” Nordic animation holds strong as market mood improves

Written by: Davide Abbatescianni

Cartoon Movie 2026: “Optimism and Fun is Back.” Nordic animation holds strong as market mood improves

Cartoon Movie 2026: “Optimism and Fun is Back.” Nordic animation holds strong as market

The event’s 50-project line-up highlighted the shifting dynamics of the international co-production market.

Cartoon Movie 2026 (3–5 March) once again conﬁrmed its role as Europe’s main pitching and co-production forum for animated features, bringing together 831 participants from 42 countries and 448 ﬁrms in Bordeaux. A total of 50 projects from 20 countries were presented, spanning a wide range of genres, audiences and artistic approaches. Alongside a strong European presence, the programme also opened up to international partners through the Québec–Canada “Land in Europe” initiative. Within this diverse line-up, Nordic producers stood out through both their projects and their growing visibility in the European animation ecosystem.

Among them was Puk Grasten’s Betty Balloon (Betty Ballon, Denmark), a preschool-oriented animated feature now in production. The story follows a four-year-old balloon navigating everyday life and unexpected friendships in a neighbourhood populated by balloon and cactus families. The project was presented as a work in progress ahead of its planned Danish theatrical release in October 2026, with LevelK handling worldwide rights.

Nordic animation showcases its range

Sweden was represented by Måns Mårlind’s Before They Were Gods, an adult-oriented coming-of-age story imagining the teenage years of future music icons Nick Cave and Joakim Thåström in early-1970s youth culture.

Four projects with Nordic majority producers were presented this year, illustrating the range of storytelling and target audiences emerging from the region.

Nordic animation showcases its range

Four projects with Nordic majority producers were presented this year, illustrating the range of storytelling and target audiences emerging from the region.

Norway pitched two projects. The ﬁrst is Will Ashurst and Kjersti G. Steinsbø’s Gingerbread Town (Pepperkakebyen, Norway/Germany/Ireland/Slovakia), a family 3D adventure set in Bergen’s famous gingerbread city exhibition and seeking sales, distributors and broadcasters. “Think Night at the Museum, with gingerbread! The ﬁlm is about embracing imperfection and creating a more tolerant community,” Den Siste Skilling’s producer Kristine Knudsen tells NFTVF. “It was a thrill to present the project to the enthusiastic industry audience at Cartoon Movie, and the positive feedback from the market was strong.”

The second project is Hanne Berkaak’s Sander’s Midsummer (Sanders midtsommer), currently at concept stage and blending fantasy elements with a coming-of-age story about a vulnerable boy searching for perfection who is thrown into the beauty of imperfect nature. Knudsen is producing, with Mikroﬁlm’s Tonje Skar Reiersen, and with Berlin’s Knudsen Pictures co-producing.

Finland also appeared as a minority partner through Fiilin Good Films on Kostiantyn Fedorov’s Ukraine-led Family Squad

The awards presented during the event reﬂected the diversity of Europe’s animation landscape. The Eurimages Co-Production Development Award went to Filip Mašek’s Czech-German co-pro Acorn’s Adventure (Kastánci). Meanwhile, the Cartoon Tributes recognised several key industry players: the Producer of the Year award went to the teams behind Allah Is Not Obliged (Allah n’est pas obligé), the Distributor of the Year prize to Les Films du Préau, and the Director of the Year honour to Reza Memari for The Last Whale Singer

but

ﬁdence is slowly

Business is cautious, but conﬁdence is slowly returning

Beyond individual projects, many participants noted a cautiously optimistic atmosphere across the market this year,

Gingerbread Town / Photo: Cartoon Movie

Finland also appeared as a minority partner through Fiilin Good Films on Kostiantyn Fedorov’s Ukraine-led Family Squad

Business is cautious, but conﬁdence is slowly returning

Beyond individual projects, many participants noted a cautiously optimistic atmosphere across the market this year, even as structural challenges remain. Reiersen described the general mood as improved compared with recent editions. “Optimism and fun is back,” she observed, noting that previous years had been overshadowed by uncertainty surrounding the theatrical market and debates about the potential impact of artificial intelligence on the animation industry. This year’s event, she suggested, felt more hopeful, even if the financial landscape remains difficult.

Reiersen also pointed to the growing visibility of Nordic animation within the European co-production environment. Looking at the Nordic projects presented this year, she said they illustrate the diversity of films being developed in the region, spanning preschool content, family entertainment and stories aimed at young adult audiences. “Compared with five or ten years ago,” she added, “the Nordic presence at Cartoon Movie has grown significantly.” In the past, it was rare to see more than a couple of Nordic projects in the selection, whereas the region now appears far more consistently in the line-up.

At the same time, producers are adapting to a changing financing reality. According to Reiersen, budgets for animated features are often shrinking even as production costs continue to rise. The shift reflects a landscape in which streamers are investing less aggressively in animated features, broadcasters are becoming more cautious, and the theatrical market remains uncertain. As a result, some projects are exploring ways to optimise production pipelines, for instance by combining traditional animation techniques with motion-capture workflows or real-time tools such as game engines.

She also noted creative trends shaping the current generation of projects. The inﬂuence of Japanese anime is increasingly visible across European productions, particularly in projects aimed at teenagers and young adults. In addition, more stories are set outside Europe, including projects exploring African settings, while Eastern European and Nordic producers are gaining greater visibility. Together, these developments contribute to a broader range of visual styles and narrative perspectives.

Meanwhile, Mårlind described the overall mood at the market as “positive and inspired”. Billing himself as a “new kid on the animation block” after working mainly in live action, he noted that in Sweden animation has traditionally remained limited largely to children’s content, making events like Cartoon Movie particularly valuable as a meeting point for creators and producers across Europe.

For Finnish journalist Heikki Jokinen, who has followed Cartoon Movie since its ﬁrst edition in 1999, the growth of adult-oriented animation stood out as one of the most striking developments this year. Out of the 50 projects presented in Bordeaux, 19 targeted adult audiences. According to Jokinen, this conﬁrms that adult animation has become “an integral part of European animation production”, with many projects tackling complex historical or political themes, including war and displacement.

Looking at the event from a longer perspective, Jokinen also emphasised how Bordeaux has fostered stronger collaboration between European producers over the decades. The event’s original aim was to encourage cross-border co-production, and this objective has largely been achieved. Today, he observed, there is “a real atmosphere of a common region in production”, even though the European animation market remains more fragmented when it comes to distribution.

- Nordic Countries -

Cartoon Movie 2026 / Photo: Cartoon Movie

2025. 12. 23. iflmhu

A Műanyag égbolt alkotói új iflmen dolgoznak

Vadak és szelídek a Cartoon Movie-n

Vadak és szelídek címmel tervez új egészestés animációs iflmet Bánóczki Tibor és Szabó Sarolta. A Műanyag égbolt alkotópárosa márciusban mutatja be projektjét a Cartoon Movie nemzetközi pitchfórumon.

A franciaországi Bordeaux-ban rendezik meg a Cartoon Movie pitchfórumot 2026. március 3. és 5. között, itt fog debütálni a Vadak és szelídek című magyar iflmterv is – számolt be róla a Dot&Line (https://dotandline.blog.hu/2025/12/16/uj_egesz_estes_iflmen_dolgozik_banoczki_tibor_es_szabo_sarolta#more190

Bánóczki Tibor és Szabó Sarolta (Műanyagégbolt) egész estés animációs iflmterve egy budapesti festőnőről, Teóról szól, aki az anyja temetésére visszatér szülőfalujába. Újra találkozik Misivel, az egykori pappal, akit a Teó anyja által vezetett lejáratókampány miatt megfosztottak tisztségétől. Misi bosszút forral: a falubeliek legmélyebb félelmeit és rémálmait akarja felhasználni ellenük. Bár alkotói válságban van, Teó elfogadja Misi felkérését, hogy kifesse a templomot. A végítéletről szóló festmények ihlette Teó elkezdi összegyűjteni a falusiak rémálmait, hogy ezekből formálja meg a freskókat.

Maurfilm Nominated for the 2026 Cartoon Movie Tributes

CzechproductioncompanyMaurfilmhasbeennominatedforthe2026 CartoonMovieTributesintheProduceroftheYearcategory.

ThenominationhighlightsMaurfilm’sworkasaproducerof Talesfromthe MagicGarden,astop-motionanimatedfeature.The filmisaninternational co-productionbringingtogetherMaurfilm(CzechRepublic),VivementLundi !(France),Artichoke(Slovakia)andZVVIKS(Slovenia),andisco-directedby DavidSúkup,PatrikPašš,LeonVidmarandJean-ClaudeRozec.

TalesfromtheMagicGarden was firstpresentedatCartoonMoviein2019 duringitsdevelopmentstage,wontheEurimagesCo-productionDevelopmentAwardandreturnedtotheeventin2025asasneakpreview.

ThewinnerswillbevotedbytheprofessionalsattendingCartoonMovie,the pitchingandco-productioneventforanimatedfeature filmsthatwillhold itsnexteditiononMarch3to5intheFrenchcityofBordeaux,NouvelleAquitaine.

|TheMoviePage– TalesfromtheMagicGarden FindusonFacebook

Can

TornaCartoon Moviecon 2progettiitaliani

Di MonicaTasciotti 4Febbraio2026

50nuoviprogettidilungometraggiinanimazionesceltitraunnumerorecorddi150candidature(conunaumentodel22% rispettoall’edizioneprecedente).E’laselezionedella28aedizionediCartoonMovie,inprogrammadal3al5marzoprossimi aBordeaux,lamanifestazionechiaveperilifnanziamentoepre-venditedell’industriadell’animazioneeuropea.Provenienti da21paesidelvecchioContinente,comediconsuetoiprogettisarannopresentatiacirca800coproduttori ,agenti, distributori,dirigentidipiattaformedistreaming,editorieinvestitori,ealtriattorichiavedell’industriacinematograifca,non soloeuropea.Unprogrammacheriuniscevociemergentieregistiaffermati,progettid’autoreeorientatialpubblico, produzionidistudiindipendentieoperedicasediproduzionedifamainternazionale.

Ampialagammaditemiaffrontati,cheabbraccianounavarietàdigenericinematograifci,traiqualiavventura,azione, commedia,dramma,fant ascienzaedocumentario.ComesemprelaFranciaèintestaallaselezionecon15progetti,seguita dallaGermaniaconseiedallaSpagnaconcinque.Insieme,ipaesidell’Europacentraleeorientale(RepubblicaCeca,Croazia, Estonia,Georgia,Ungheria,PoloniaeRomania)presentanountotaledi11progetti,mentrelaregionescandinava–Danimarca,NorvegiaeSvezia–nepresentaquattro.Belgio,Italia,IrlandaePaesiBassipresentanodueprogetticiascuno, mentreAustria,Grecia,LussemburgoeUcrainachiudonolalistaconuniflmciascuno.

Lacoproduzionerimaneunodeiprincipalimotoridiifnanziamentoperiiflmd’animazioneinEuropa:29deiprogetti(58%) sonocoproduzionichecoinvolgonosiaPaesiappartenentiaEuropaCreativaMEDIAsiaaltriPaesiesterniaquesto programma(Canada,Costad’Avorio,Giappone,Messico,Nigeria,Sudafrica,SvizzeraeRegnoUnito).Eseancheilnuovo capodiDisneyAnimation,JaredBush,pensaaunpossibileritornoall’animazionein2D,inEuropaquestatecnicanonèmai passatadimodaerimane–ancheperrestrizionidibudget–quellapiùutilizzataconil54% dellaselezione,mentreiprogetti sviluppatiin3Drappresentanoil30%.Perquantoriguardalasegmentazionedelpubblico,il52% deiprogettièrivoltoa famiglieebambini,mentreititolirivoltiagiovaniadultieadulticontinuanoacrescere,conil38% dellaselezione(rispettoal

Dei50inselezione,solosettesonoiprogettiinproduzione(14%).Lalistaècompletatadall’anteprimadi JimQueen diMarco NguyeneNicolasAthané(Bobbypills,Francia).Trentaiprogettiinfasedisviluppo,parial60% deltotale,fraquesti Caruso, lungometraggiodi90minutidivisoinsceneaiffdateadiversipluripremiatiregistid’animazioneitalianichecatturalavitaei successiartisticidelleggendariotenored’operaEnricoCaruso,visualizzataconlostileelasensibilitàartisticadiciascun autore.Unprogettodello StudioCampedelli,ifrmatodaChristianDeVita.

12iprogettiinfasediconcept(24%),fraiquali Riamise,unacittàsenz’acqua,consumatadallasiccità,dallacriminalitàedai rettiligiganti,leultimecreaturesulla Terra.Unprogettoin2Ddestinatoaunpubblicodiadolescenticheparladisostenibilità eamiciziaattraversol’avventurapropostodallostudiotorinese Ibrido insiemeacoproduttorifrancesiegiapponesi,diretto daFrancescoFortieHirokazuKojima.

Aidueprogettiitaliani,siaggiunge LasediaarotellevolantediAkira delregistaeimprenditoreitalo-americanoMarco Balsamo,nuovoPresidenteeCEOdellafranceseTeamTOFilmsacquisitadallasuaRIVAStudiosProductions. Eapropositodi acquisizioni,lanotiziagiàsisapevamaoraèuiffciale.GraphilmEntertainment,lasocietàdianimazioneromanadiMaurizio Forestieri,èdinuovounostudioindipendente.DopolaliquidazionediCyberGroupStudios,lostudioitalianoèriuscitoa riacquistarelapienaproprietà.

Québec-CanadaLandinEurope

Insiemeallapresenzadiun’importantedelegazionediproduttori,distributori,agentidivendita,editoriedemittenti quebecchesiecanadesiinteressatiastabilirenuovepartnershipinEuropa,CartoonMovie2026ospiteràillancio dell’iniziativa Québec-CanadaLandinEurope:UnoSpazioperlaCreazione,voltaamettereinluceunrinnovatoimpegno nellacoproduzioneinternazionale.Unaselezionediseiprogetti(tredalQuébecetredaaltreprovincecanadesi)incercadi coproduttorieuropeisaràpresentatainunasessionededicataorganizzataincollaborazioneconSODECeTeleiflmCanada. Inunmomentoincuil’EuropastaaffrontandopressionieconomicheeilCanadasistaadattandoaunmercatostatunitense inevoluzione,questainiziativafornisceunapotentepiattaformaperlacooperazionetransfrontaliera.

CartoonMovieBordeaux,Carusoel’amoreiforentino

Unlungometraggioanimatosullavitaelacarrieradeltenorenapoletano.Ladonnadietrol’acquistodellaVilla BellosguardodiLastraaSigna

perchénonsipuòparlarediEnricoCarusosenzacitareAdaGiachetti, sopranoesoprattuttoilsuograndeamore: unarelazionepassionale, intensaeburrascosaduratatuttalavita, anchequandoillororapporto amorosoerafinitodatempo.

Iprotagonistiinunascenadelfilm

Carusocartoon.Iltenoreanimato.Un’operad’amore

. ALoveOpera, progettopresentatoalCartoonMoviediBordeaux

Ascoltaquestoarticoloora...

ABordeauxilprogettodellungometraggiomadeinItaly.AllavoroChristianDeVitaconaltriquindiciregisti.

Caruso. ALoveOpera, progettopresentatoalCartoonMoviediBordeaux

Unsoggettoambizioso, unasfidaaffascinante, unʼoperazione chepuntasul madeinItaly: illungometraggio Caruso.ALove

Ascoltaquestoarticoloora...

Ilprogetto, ancorainfasedisviluppoèprodottodalloStudio

unviaggionelmito EnricoCaruso, maancheesoprattutto nellʼavventuraumanadelgrandetenorenapoletano. Magazine Caruso cartoon. Il tenore animato. Unʼopera dʼamore Home Magazine Carusocartoon. Iltenoreanimato. Unʼoperadʼamore

Opera (Caruso. Unʼoperadʼamore) ilprogettopresentatoal

Campedelli (storicacasadiproduzionemilanese), èideatoedirettoda

UCartoonMoviediBordeaux (consideratounodeiprincipalieventiperla coproduzioneelapresentazionediprogettidianimazioneeuropei) è unviaggionelmito EnricoCaruso, maancheesoprattutto nellʼavventuraumanadelgrandetenorenapoletano. Magazine Caruso cartoon. Il tenore animato. Unʼopera dʼamore

Grazie a Sal Da Vinci boccata di ossigeno per la nostra canzone

Campedelli (storicacasadiproduzionemilanese), èideatoedirettoda ChristianDeVita (animatorediprimopianoalivellointernazionale) con altri 15 registiitalianipluripremiati: daSansoneaRak, daConigliaroa Forestieri, solopercitarnealcuni.

ChristianDeVita (animatorediprimopianoalivellointernazionale) con altri 15 registiitalianipluripremiati: daSansoneaRak, daConigliaroa

nsoggettoambizioso, unasfidaaffascinante, unʼoperazione chepuntasul madeinItaly: illungometraggio Caruso.ALove Opera (Caruso. Unʼoperadʼamore) ilprogettopresentatoal

Forestieri, solopercitarnealcuni. Ilfilmèsuddivisoinscene, ciascunaaccompagnatadaunacolonna

CartoonMoviediBordeaux (consideratounodeiprincipalieventiperla coproduzioneelapresentazionediprogettidianimazioneeuropei) è unviaggionelmito EnricoCaruso, maancheesoprattutto nellʼavventuraumanadelgrandetenorenapoletano. Magazine Caruso cartoon. Il tenore animato. Unʼopera dʼamore

sonoradiversa: leprimeregistrazionidiCaruso, recentemente rimasterizzate. Ogniscenaèstatadirettaeanimatadaivariregisti italiani, eognunohadatovitaalleimmaginisecondoilpropriostileela propriasensibilitàartistica. OgnistoriapresenteràunCarusodiverso:17 branichecostituisconolastrutturaportantedellacolonnasonorae dellatrama, sucuisisnodanoeventiemomentidellavitadiCaruso.

Ilfilmèsuddivisoinscene, ciascunaaccompagnatadaunacolonna sonoradiversa: leprimeregistrazionidiCaruso, recentemente rimasterizzate. Ogniscenaèstatadirettaeanimatadaivariregisti italiani, eognunohadatovitaalleimmaginisecondoilpropriostileela propriasensibilitàartistica. OgnistoriapresenteràunCarusodiverso:17 branichecostituisconolastrutturaportantedellacolonnasonorae dellatrama, sucuisisnodanoeventiemomentidellavitadiCaruso.

Magazine Grazie per

Dewaardevanuwhuisisopenbaarbekend!

Home Value

Ovviamenteimportanteilruolodellamusicaedellavocedelgrande tenore, concelebriariedʼopera (daElucevanlestelleaUnafurtiva lagrima) ocanzonipopolarissime (da ‘OsolemioaCore ‘ngrato)

Unavitapartitainpovertàpoiassurtaadaltevetteartistiche, unavita dedicataallʼamore, apartiredallʼappassionatoeburrascosolegamecon lafiorentinaAdaGiachetti (chelotradiràconlʼautista), unsentimento forteanchedopolafinedellalororelazione. Maèstataunavita segnataanchedallasofferenza. Perché, comedicevaCaruso "lavita portaconsémoltasofferenza. Colorochenonhannoprovato veramente, chenonhannosofferto, nonpossonocantare".

Santa giorno

Magazine Caruso cartoon. Il tenore animato. Unʼopera dʼamore

Icinquantaprogettidilungometraggianimatiselezionatiperla 28ª edizionediCartoonMoviehannoavutolapossibilitàdiaccelerareilloro finanziamentoeampliarelaloroportatainternazionale. Sonostatiscelti traunnumerorecorddi 150 candidature, conunaumentodel 22% rispettoallʼedizioneprecedente.

AltroprogettoitalianoallarassegnadiBordeaux (realizzata dallʼassociazioneCartoon, conilsostegnodelprogrammaMedia dellʼUnioneEuropea) èRiamisedirettodaFrancescoFortieHirokazu KojimaeprodottodalloStudioIbrido. Iltitoloèilnomediunacittà senzʼacqua, consumatadallasiccità, dallacriminalitàedairettiligiganti. Isuoiabitantisopravvivonoguadagnandocristalliblu, lʼunicafontedi sostentamento. Mentreiricchiprosperano, dueclansicontendonoil controllo.

Dewaardevanuwhuisisopenbaarbekend!

Home Value

Aldilàdeiprogettiorientatialmercato, laselezionediquestʼanno rifletteilforteimpegnodellʼanimazioneneiconfrontidellepressanti realtàglobali. Migrazione, guerraedesilioemergonocometemi ricorrenti, dimostrandolacapacitàdiquestomezzodiaffrontare questionisocialiepolitichecomplesseconsfumatureeprofondità emotiva. EjodiJacekRokosz (Animoon - PL), KigaliNightdiSamuel Lajus (Parmilesluciolesfilms - FR) oTomi & ErikadiPéterPalátsik & MatthiasBruhn (TrickstudioLutterbeck & BananaTreeFilm - DE), tragli altri, affrontanoquestiargomentinellelorostorie.

TAGDELL'ARTICOLO

Cinema MadeInItaly

0 commenti

Lascia il primo commento

made in Italy

Roberto Davide Papini

1. Home

2. Magazine

3. Cinema e Serie Tv

Cartoon Movie, il film su Enrico Caruso è un inno al made in Italy

4. Cartoon Movie, il film su Enrico Caruso è un inno al made in Italy

Alla rassegna di Bordeaux verrà presentato un lungometraggio (in fase di sviluppo) sulla vita e l’arte del grande tenore napoletano. Presente anche un altro progetto italiano

Roberto Davide Papini

1. Home

2. Magazine

3. Cinema e Serie Tv

Un'immagine di "Caruso. A love Opera"

Voice by

Bordeaux, 2 marzo 2026 – Al di là del titolo ancora solo in inglese (“Caruso. A Love Opera”) il progetto presentato al Cartoon Movie di Bordeaux (dal 3 al 5 marzo, considerato uno dei principali eventi per la coproduzione e la presentazione di progetti di animazione europei) è un inno al made in Italy e non solo per il protagonista, ma anche per i realizzatori. Il film dedicato a Enrico Caruso, uno dei più grandi tenori della storia, gloria canora italiana, è prodotto dallo Studio Campedelli (storica casa di produzione milanese), è ideato e diretto da Christian De Vita (animatore di primo piano a livello internazionale) con altri 15 registi italiani pluripremiati: da Sansone a Rak, da Conigliaro a Forestieri, solo per citarne alcuni. Il film è suddiviso in scene, ciascuna accompagnata da una colonna sonora diversa: le prime registrazioni di Caruso, recentemente rimasterizzate. Ogni scena è stata diretta e animata dai vari registi italiani, e ognuno ha dato vita alle immagini secondo il proprio stile e la propria sensibilità artistica. Ogni storia presenterà un Caruso diverso: 17 brani che costituiscono la struttura portante della colonna sonora e della trama, su cui si snodano eventi e momenti della vita di Caruso.

Un'immagine di "Caruso. A love Opera"

Voice by

- Italy -

italiani pluripremiati: da Sansone a Rak, da Conigliaro a Forestieri, solo per citarne alcuni.

Il film è suddiviso in scene, ciascuna accompagnata da una colonna sonora diversa: le prime registrazioni di Caruso, recentemente rimasterizzate. Ogni scena è stata diretta e animata dai vari registi italiani, e ognuno ha dato vita alle immagini secondo il proprio stile e la propria sensibilità artistica. Ogni storia presenterà un Caruso diverso: 17 brani che costituiscono la struttura portante della colonna sonora e della trama, su cui si snodano eventi e momenti della vita di Caruso.

Una vita partita in povertà poi assurta ad alte vette artistiche, una vita dedicata all’amore (a partire dall’appassionato e burrascoso legame con la fiorentina Ada Giachetti) segnata però anche dalla sofferenza. Perché, come diceva Caruso “la vita porta con sé molta sofferenza. Coloro che non hanno provato veramente, che non hanno sofferto, non possono cantare”.

Alla rassegna di Bordeaux (realizzata dall’associazione Cartoon, con il sostegno del programma Media dell’Unione Europea) ci sarà un altro progetto italiano: “Riamise” diretto da Francesco Forti e Hirokazu Kojima e prodotto dallo Studio Ibrido. Il titolo è il nome di una città senz’acqua, consumata dalla siccità, dalla criminalità e dai rettili giganti. I suoi abitanti sopravvivono guadagnando cristalli blu, l'unica fonte di sostentamento. Mentre i ricchi prosperano, due clan si contendono il controllo.

I 50 progetti di lungometraggi animati selezionati per la 28esima edizione di Cartoon Movie avranno la possibilità di accelerare il loro finanziamento e ampliare la loro portata internazionale. Scelti tra un numero record di 150 candidature, con un aumento del 22% rispetto all'edizione precedente, i progetti saranno presentati a coproduttori, agenti di vendita, distributori, dirigenti di piattaforme di streaming, editori e investitori, oltre ad altri attori chiave dell'industria cinematografica.

l’animation ?

⋮ 05/03/2026

Portrait

Par Stéphane Dreyfus

Publié le 5 mars 2026 à 9h42 Lecture : 3 min

Article réservé à nos abonnés.

Qui est Sébastien Onomo, producteur de « Allah n’est pas obligé » et figure des récits africains dans l’animation ?

⋮ 05/03/2026

Portrait

Par Stéphane Dreyfus

Publié le 5 mars 2026 à 9h42 Lecture : 3 min

Article réservé à nos abonnés.

Le producteur Sébastien Onomo, le 5 février 2024 aux Césars. Pascal Le Segretain / Getty Images/AFP

Alors qu’est sorti au cinéma, mercredi 4 mars 2026, Allah n’est pas obligé, adaptation animée du roman d’Ahmadou Kourouma sur un enfant-soldat guinéen, son producteur, Sébastien Onomo, présente trois projets de longs métrages mettant en scène des récits africains au Cartoon Movie de Bordeaux, rendezvous des professionnels européens du cinéma d’animation.

professionnels européens du cinéma d’animation, qui se tient à Bordeaux, mercredi 4 et jeudi 5 mars 2026.

À peine a-t-il sorti un film en salles que Sébastien Onomo repart au charbon. Le producteur d’Allah n’est pas obligé, adaptation animée audacieuse du roman éponyme d’Ahmadou Kourouma sur l’épopée d’un enfant-soldat guinéen ne présente pas moins de trois projets au Cartoon Movie, rendez-vous des

Le producteur Sébastien Onomo, le 5 février 2024 aux Césars. Pascal Le Segretain / Getty

professionnels européens du cinéma d’animation, qui se tient à Bordeaux, mercredi 4 et jeudi 5 mars

Alors qu’est sorti au cinéma, mercredi 4 mars 2026, adaptation animée du roman d’Ahmadou Kourouma sur un enfant-soldat guinéen, son producteur, Sébastien Onomo, présente trois projets de longs métrages mettant en scène des récits africains au Cartoon Movie de Bordeaux, rendezvous des professionnels européens du cinéma d’animation.

À peine a-t-il sorti un film en salles que Sébastien Onomo repart au charbon. Le producteur d’Allah n’est pas obligé adaptation animée audacieuse du roman éponyme d’Ahmadou Kourouma sur l’épopée d’un enfant-soldat guinéen ne présente pas moins de trois projets au Cartoon Movie, rendez-vous des

Trois films en gestation et autant de récits se déroulant en Afrique : Ejo, sur la survie d’enfants au génocide rwandais, Kokum, récit d’aventures fantastiques inspirées de légendes camerounaises, et Starseed, film de science-fiction se déroulant au Zimbabwe. C’est la marque de fabrique de Sébastien Onomo, qui cherche à donner une voix à ceux qui n’en ont pas, d’où qu’ils viennent.

Accompagner les récits qui ont manqué à sa jeunesse

Il a commencé par l’Asie, avec le superbe Funan (2019) de Denis Do, quête d’une femme lors de la dictature khmère rouge dans les années 1970, inspirée par le témoignage de la mère du réalisateur. Puis (2023), de la cinéaste iranienne Sepideh Farsi, histoire du siège d’une ville frontalière entre Iran et Irak, au début de la guerre entre les deux pays en 1980, vu à travers les yeux d’un adolescent. Une manière d’évoquer les rêves brisés de la jeunesse iranienne, dont ceux de la 2/5

« J’accompagne des artistes racontant des histoires qui leur ont manqué lorsqu’ils étaient jeunes. Elles m’ont fait défaut aussi, à moi dont la mère est venue du Cameroun, explique Sébastien Onomo, ton calme et regard déterminé. J’aurais aimé les connaître plus jeune pour me construire différemment ou plus rapidement, plutôt que de me prendre des claques. »

La première arrive à 9 ans quand il déménage en banlieue parisienne après avoir grandi à la campagne en Normandie. « Je n’avais jusque-là pas conscience de ma négritude, je pensais même que j’étais blanc ! En voyant d’autres enfants de la même couleur de peau que moi, j’ai pris conscience de la diversité. »

Un parcours mené avec détermination

3/5

Le deuxième choc survient à 16 ans lors d’un tournage de court métrage, dans les Vosges, dans lequel Sébastien Onomo a un petit rôle. Il confie à l’un des comédiens son rêve de faire ce métier. « Ça va dur pour toi si tu es noir… », lui répond-il d’un air entendu. « Ça m’a scotché sur le moment, mais cela nourri depuis ma détermination à réussir dans le cinéma. Quand on me dit que je ne pourrai pas réussir un projet, cela décuple mon envie de le réaliser. »

Le génocide des Tutsis au Rwanda raconté pour la première fois en films d’animation

⋮ 07/03/2026

Reportage

Par Stéphane Dreyfus, envoyé spécial à Bordeaux (Gironde)

Publié le 7 mars 2026 à 10h56 Lecture : 3 min

Article réservé à nos abonnés.

Le génocide des Tutsis au Rwanda raconté pour la première fois en films d’animation

⋮ 07/03/2026

Reportage

Par Stéphane Dreyfus

Publié le 7 mars 2026 à 10h56 Lecture : 3 min

Article réservé à nos abonnés.

« Kigali Night », projet de film d’animation de Samuel Lajus Xavier Coste / Parmi les lucioles

Lors du Cartoon Movie de Bordeaux, rendez-vous professionnel du cinéma d’animation européen, deux projets de films prometteurs présentés abordent le génocide au Rwanda, de façon différente et complémentaire : le témoignage d’un ancien coopérant français et une histoire d’amitié entre deux enfants, une Tutsie et un Hutu.

« Kigali Night », projet de film d’animation de Samuel Lajus Xavier Coste / Parmi les lucioles

Qui est Sébastien Onomo, producteur de « Allah n’est pas obligé » et figure des récits africains dans l’animation ?

L’émotion était palpable dans la grande salle du palais des congrès de Bordeaux, jeudi 5 mars. Ce cénacle impersonnel n’y est pourtant pas habitué. Mais l’évocation du génocide des Tutsis au Rwanda lors de la présentation de deux projets de films d’animation a touché le cœur des participants du Cartoon Movie. Cet événement annuel, où 700 à 800 créateurs et producteurs européens viennent chercher des partenaires pour financer leurs longs-métrages animés, voit souvent passer des sujets délicats et graves, parmi les thèmes plus légers de films à destination du jeune public. 1/4 À lire aussi

Cette année, parmi les six projets mettant en scène des récits africains – une nouveauté de bon augure –, Ejo et Kigali Night semblaient particulièrement prometteurs. Le génocide des Tutsis au Rwanda a déjà fait l’objet de nombreuses fictions en prise de vue réelle et documentaires, mais c’est la première fois que le cinéma d’animation s’en empare. Les approches sont ici très différentes mais très complémentaires.

Kigali Night, tout d’abord, choisit de décentrer le regard en le portant sur les Occidentaux présents au Rwanda au début des années 1990. Samuel Lajus, réalisateur de ce film d’animation qui doit sortir en 2029, était l’un d’eux et a voulu témoigner de la période qui précède le génocide. En 1991, celui qui est aujourd’hui un documentariste reconnu n’est qu’un simple coopérant au centre culturel de Kigali.

Insouciant et fêtard, il profite pendant un an et demi du confort des expatriés français et tourne même un petit film de propagande à la gloire de l’amitié franco-rwandaise. Revenu en France, le jeune homme est sidéré quand le massacre survient en 1994.

1/4

« Ejo », projet de film d’animation de Jacek Rokosz. Jacek Rokosz / Animoon

Dans Ejo, non plus, le génocide ne sera pas montré de façon frontale, mais sera bien au cœur du récit de la survie de deux enfants lors du terrifiant massacre qui a fait 1 million de morts en cent jours. Après avoir vu les siens être assassinés sous ses yeux, Didi, une jeune fille tutsie de 12 ans qui se cache dans un village en ruines, rencontre Eric, un garçon hutu de 7 ans dont les parents ont participé aux massacres. D’abord conflictuelle, la relation entre ces deux orphelins va évoluer vers l’amitié, incarnant l’espoir d’une réconciliation entre Rwandais.

Ejo, dont la sortie est prévue en 2029, est réalisé par un cinéaste d’animation polonais, Jacek Rokosz, qui a fait le choix d’un dessin en noir et blanc à la fois brut et riche en détail pour raconter cette histoire douloureuse peu connue dans son pays. « Cette tragédie a toutefois des similitudes avec ce que la Pologne a pu traverser lors de la Seconde Guerre mondiale et durant l’époque soviétique », explique la productrice polonaise du film, Kasia Panas.

First Look At 'Cosmo Princess,' Quentin Rigaux’s 2D Sci-Fi Film

Kévin Giraud

Kévin Giraud

Feature FilmInterviews

Quentin Rigaux’s ‘Cosmo Princess’ Blends Vintage Anime And French Animation Traditions With A Sci-Fi Story

By Kévin Giraud

| 03/06/2026 8:58 am |

Sometime, somewhere in the endless cosmos, a lost astronaut and a cosmic princess collide. His hope: to return home. Hers: to escape her destiny of becoming a star. Fascinated by his tales of “Earth,” she helps him find his way back, hoping to find refuge herself.

It’s this unlikely pact that is at the heart of Cosmo Princess, Quentin Rigaux’s debut feature, brought to Cartoon Movie by Academy Award-winning Flow producer Ron Dyens (Sacrebleu), one of the highlights of this 2026 edition. A duo now embarking, much like their characters, on the epic yet perilous journey of crafting this ambitious 2D, 90-minute sci-fi animated family feature. Ahead of the pitch, Cartoon Brew spoke with Dyens about this odyssey about to lift off.

A Gobelins alum, Quentin Rigaux started his professional career in 2019 at Wizz, a French boutique studio also present at Cartoon Movie with the intriguing Flick. Seven years later, Rigaux has worked with Skydance, The Mill, Titmouse, and other internationally acclaimed studios and is now an established director at Passion Pictures Paris.

As many aspiring directors do, he crafted the one-minute teaser for Cosmo Princess during his free time, which was released on YouTube back in June and now boasts more than 500k views. Dyens, who discovered Rigaux’s project on LinkedIn by chance, was blown away by the 1980s anime-inspired aesthetics and reached out to the artist.

“What I really love about this feature is the philosophical tales that surround its mythology, which remind me of Jules Verne’s adventures as much as the poetics of The Little Prince,” shared Dyens. “Adventure as a way to tell a story has been, in my opinion, completely perverted by the search for profit. There’s nothing exciting about Musk’s mission to Mars. It’s only about finding another planet to exploit, and that’s dark. What has always appealed to me, from my first feature Long Way North to the animals’ journey in Flow, has always been adventure in its truest form and the feeling of discovery that goes with it.”

For the acclaimed producer of Sirocco and the Kingdom of the Winds and Marona’s Fantastic Tale, adventure is not only about seeking new horizons. It’s also about taking off your armor, accepting the unknown, and transforming oneself through the journey. Concepts that are at the core of Cosmo Princess, and that connected the two.

Beyond adventure, Rigaux’s space opera also brings a deeper reflection on what it means to be human (or not, in the case of the film’s main characters, Selene, a star in the making, and Albert V, a space monkey thrown into the void of space). “Those two characters are connected by the search for their true place in the universe. What makes them unique? What are their responsibilities toward their own destinies, and what does that say about us as human beings?

seems, making the film even more appealing.

All these levels of text and subtext are deeply interesting to me.” In Cosmo Princess, much like Dyens’ other projects, bad guys are never truly bad guys, and everything is not always what it

As he grew up with those shows that were just beginning to be exported worldwide, Dyens was also deeply influenced by the anime space operas of the late 1970s and the 1980s. But when he met Quentin, he quickly realized he had met his master. “This 28-year-old artist knew the tropes and codes of these shows better than I did. What’s very interesting to me is that Quentin and a younger generation of French animators have a certain kind of nostalgia for these shows, but at the same time, they’re infusing them with classic French animation, such as Paul Grimault or René Laloux’s Les Maitres du Temps, creating a new form of art. To me, it’s a great way of appealing both to a younger audience and to adults and young adults.”

- United States -

A very ambitious project, Cosmo Princess is in the early stages of development, a place that Dyens enjoys. “When we’re writing, I try to keep my mind as open as possible, without putting too many barriers or limits on what we can or will achieve. With Sacrebleu’s pedigree and the appeal of this gorgeous, lovable, and sincere story, I’m convinced that we will find trustworthy

Cartoon Brew - 06/03/2026

But when he met Quentin, he quickly realized he had met his master. “This 28-year-old artist knew the tropes and codes of these shows better than I did. What’s very interesting to me is that Quentin and a younger generation of French animators have a certain kind of nostalgia for these shows, but at the same time, they’re infusing them with classic French animation, such as Paul Grimault or René Laloux’s Les Maitres du Temps, creating a new form of art. To me, it’s a great way of appealing both to a younger audience and to adults and young adults.”

Brew - 04/03/2026

Asked about how Flow’s incredible journey had changed his career, Dyens shared both happiness and thankfulness, but also a bit of fatigue. “It has been a wonderful experience, and I’m truly happy we won the Academy Award for Flow, especially since it was me who reached out to Gints [Zilbalodis] at the very beginning. But when you have a project such as Flow that becomes a bigger-than-life odyssey, people get the feeling that your other projects diminish in a sense, which is, of course, not true.”

Dyens, who puts the same energy into each and every project Sacrebleu boards, emphasized that he defends them all equally. “But you cannot rule out the fact that people are going to compare them with Flow’s success, and that’s not a very good thing to experience. To be honest, I went through a difficult time coping with that, but I’m in a better place now, and I’m fully invested in all the stories Sacrebleu carries today.”

At Cartoon Movie, the beating heart of European feature animation, Sacrebleu is sharing this project for the first time. It’s a great place to discuss its potential and meet friends and partners before Dyens heads to Los Angeles next week, taking Quentin Rigaux’s mind-bending visuals and heartfelt story with him.

“We’re going to take our time refining this story, as we want people to have a true cinematic experience with Cosmo Princess. The film also holds deeper philosophical questions that can appeal to audiences, and its messages of acceptance and benevolence can go beyond the screen. I think it can be good for people right now.”

What Do You Think?

United States -

« Cosmo Princess » de Quentin Rgx / Quentin Rigaux : le petit projet d’animation qui monte

La rédaction

C’est un projet en cours qui suscite de l’enthousiasme partout où il passe : Cosmo Princess. Le teaser de ce film d’animation se veut porté par une ambition artistique et narrative singulière. Imaginé par le réalisateur français Quentin Rgx, alias Quentin Rigaux, diplômé des Gobelins, le projet s’impose comme l’un des plus prometteurs de l’animation européenne actuelle. Repéré en ligne après la diffusion d’un teaser devenu viral, le film est désormais produit par Ron Dyens, déjà oscarisé pour Flow. Présenté au Cartoon Movie 2026, le projet entre dans une phase clé de développement et de financement. Ce long-métrage de science-fiction en animation 2D artisanale revendique une esthétique inspirée des anime spatiaux des années 1970-1980, mêlée à la tradition française héritée de Paul Grimault et René Laloux. L’histoire met en scène la rencontre entre un astronaute perdu et une princesse cosmique, liés par une quête commune : trouver leur place dans l’univers. Au-delà de l’aventure, le récit développe une dimension philosophique, interrogeant l’identité, le destin et la condition humaine. Le film se distingue aussi par une approche nuancée de ses personnages, refusant toute opposition simpliste entre le bien et le mal. Pensé comme une œuvre familiale mais exigeante, il ambitionne de toucher à la fois un jeune public et les adultes sensibles à une narration poétique. Encore en développement, Cosmo Princess s’annonce comme une fresque spatiale ambitieuse, mêlant héritage visuel, réflexion contemporaine et souffle épique.

Actualidad

‘PEDIGREE’ (/actualidad/2690-pedigree)

EL CORAJE DE UNA BAILARINA PELUDA

Maya Adam, que fuera la primera estrella negra de Semperoper Ballet, diseñó a su imagen a la perra Lily, pero la hizo mucho más valiente que ella. La película de animación ‘Pedigree’, presentada en el Cartoon Movie, de Burdeos, busca democratizar el ballet con un equipo de combativos chuchos bailarines. Allí estuvimos…

Texto_BEGOÑA

DONAT

Burdeos, 03 de abril de 2026

En un mundo antropomórfico donde la perfección se mide por el linaje y el brillo del pelaje, una pequeña perra mestiza está a punto de demostrar que el talento no va ligado a un certificado de pureza. Durante el mes pasado, el foro profesional de cine de animación europea Cartoon Movie, celebrado en Burdeos, acogió la presentación de un nuevo proyecto cinematográfico de la reconocida productora Triggerfish que lleva por título Pedigree. La propuestase anticipa como un largometraje para todos los públicos sobre canes bailarines con una capa adulta de lectura que se inspira en las vivencias reales de su creadora, Maya Adam, la primera bailarina solista birracial en el Semperoper Ballet de Dresde.

Esta metáfora sobre la identidad mixta y la superación personal se basa en la experiencia de otredad vivida en primera persona por la artista, hoy retirada de las tablas. Como muchos proyectos creativos de esta década, el germen de su película se produjo durante el

confinamiento de 2020. Esta pausa forzada por la crisis sanitaria se convirtió en un catalizador profesional. "Cuando llegó la pandemia, muchos tuvimos ese momento de pensar si había algo que siempre habíamos querido hacer y para lo que no habíamos tenido tiempo", explica Adam.

Esa inquietud la llevó a matricularse en la Vancouver Film School, donde a los 45 años pudo dar rienda suelta a su voz hasta el momento dormida. Hija de madre india y de padre blanco, sus progenitores protagonizaron una historia de amor prohibido bajo las leyes del apartheid en Sudáfrica. "Su noviazgo fue en secreto y cuando la policía los descubrió fueron expulsados del país", relata.

Maya Adam creció en Canadá con una sensación de ser diferente que la persiguió incluso en su exitosa carrera como bailarina en la Semperoper de Dresde. Al llegar a la ciudad alemana, se encontró con un muro de homogeneidad. "Todos eran rubios o de piel clara. Yo era la única persona que destacaba por el tono de su pelo y de su color de piel. Me preguntaba cómo iba a encajar en una línea de baile donde todas eran iguales y yo estaba ahí, en el cuerpo de ballet".

Durante la promoción de su proyecto en Burdeos, la autora recordaba cómo su físico dictaba sus papeles en el escenario: "Me daban el rol de la bailarina gitana en El Cascanueces, de personajes hispanos e incluso, a menudo, de prostituta. Eran puros estereotipos. Yo también quería ser Julieta en alguna ocasión".

La hegemonía de las razas puras

La protagonista de la cinta, que ahora desarrolla Triggerfish, Lilly, es en muchos sentidos el alter ego de su autora, lo que Maya Adam habría querido ser. "Ella es mucho más valiente de lo que fui yo", confiesa. En la película, la heroína perruna lidera a un grupo de amigos desaliñados para salvar su estudio de danza, enfrentándose al esnobismo de las razas puras.

El proyecto busca alejarse de la visión oscura y competitiva asociada al ballet que películas como Black Swan (Darren Aronofsky, 2010) han proyectado. "A veces hay una simplificación excesiva

de que el baile clásico es malo o de que va a enfermar a tus hijas. También tiene su parte oscura el mundo de los negocios o la política. Es una carrera dura, como cualquier deporte de élite, pero tiene aspectos hermosos, caso de la camaradería y de la capacidad de transmitir narrativas sin palabras", defiende Adam, quien así mismo, señala el ballet como un vínculo que madres e hijas comparten tanto en la práctica como en el hábito de acudir a representaciones.

Aunque el estreno está previsto para dentro de un par de años, el desarrollo técnico ya está en marcha por parte de Triggerfish Animation Studios, un estudio de animación con sede en Ciudad del Cabo y la irlandesa Galway cuyos cortometrajes han sido nominados al Óscar y ganadores de premios BAFTA. Los directores de Pedigree serán Greig Cameron y Samantha Cutler, quien dedica su tiempo libre al ballet.

La producción planea utilizar sensores de movimiento en bailarines reales para capturar la esencia del ballet de forma fidedigna. A ese respecto, en un gesto de coherencia con el mensaje de la película, Adam tiene claro que no van a servirse de grandes estrellas consagradas para las referencias de baile: "Hay tantos jóvenes talentos que aún no han encontrado su primer contrato... Me encantaría traer a esa gente al proyecto. Si en el largometraje hablamos de dar oportunidades a los mestizos, debemos dárselas a personas que todavía no son famosas".

Con fragmentos adaptados de ballets clásicos como Don Quijote, Pedigree promete ser una celebración visual de las artes del movimiento. Pero, por encima de todo, indica su creadora, busca ser un refugio para cualquiera que se haya sentido fuera de lugar.

Anterior (/actualidad/2691-john-neumeier-liceu)

Siguiente (/actualidad/2689-la-bayadera)

Exclusive: Patrick Imbert Reveals Details About His Upcoming Animated Feature ‘Hakim’s Odyssey’

Ramin Zahed

Exclusive: Patrick Imbert Reveals Details About His Upcoming Animated Feature ‘Hakim’s Odyssey’

Ramin Zahed

César- and Annecy Cristal-winning French director Patrick Imbert is best known for his acclaimed and eclectic 2D animated features The Summit of the Gods (2021) and The Big Bad Fox and Other Tales (2017). Last week, he presented his latest project, a timely adaptation of Fabien Toulmé’s four-volume graphic novel Hakim’s Odyssey, at Cartoon Movie in Bordeaux, France.

Produced by France’s Folivari and Solab Films, the 2D feature follows the heartbreaking experiences of a Syrian refugee who flees his country’s civil war for Lebanon, Jordan and Turkey to find a safe haven. In the words of the main character Hakim, “Anyone can become a refugee. If your county falls apart, you fall apart with it, or you leave.”

Imbert was kind enough to give us the scoop on his new movie in an exclusive interview:

[ph: Ricky Middlesworth / Netflix]

Animation Magazine: Like your previous work, Hakim’s Odyssey is based on a graphic novel, although it’s quite different in terms of style and content. What drew you to this world?

[ph: Ricky Middlesworth / Netflix]

Animation Magazine: Like your previous work, Hakim’s Odyssey is based on a graphic novel, although it’s quite different in terms of style and content. What drew you to this world?

Patrick Imbert: Certainly, it was its humanistic dimension. Even though politics is not usually part of my artistic work, I’m a citizen and a father, so I feel concerned about this subject. I also believe in the cinematic potential of this story, and that as a filmmaker, I have something to contribute. I believe that one can convince through emotion — and that is, in fact, the great power of fiction.

What do you think animation can bring to this particular immigrant’s story?

I don’t think in terms of “what animation can bring” or whether a subject is good or bad for animation. The fact is, I do animation — it’s my mother language, not really a choice, and I don’t know how to do anything else. But I use it for what it is, with all the visual freedoms it offers, but also its limitations and the choices it entails. As they say, art is made of constraints.

Can you tell us anything about the visual style of the movie?

The style will be simpler and less realistic than in my previous film. It’s the principle of the comic-book format I’m adapting: because the graphic style is simple, we can focus on the essentials, namely the story and the characters. This is what makes the work very accessible to a wide audience; you simply don’t think about the style. Of course, it’s a film, intended to be projected on a large screen, and not a few square centimeters comic-book panel, so the style will still be cinematic in the compositions, the lighting, the staging, but always accessible.

What is your take on the current state of animation worldwide?

Actually, I’m not very familiar with the state of animation worldwide. I get the impression there’s never been so much of it, and therefore that’s a good thing for audiences. However, in France at least, the situation isn’t easy; animation is expensive to produce, and when funding shrinks, especially from major streaming platforms but not only, things get complicated. Anyway, let’s continue…

Louise Seynhaeve and David Coquard-Dassault helped develop the film’s graphic novel-inspired visuals.

What kind of advice would you give young animation students who are worried about the state of the industry, AI, etc.?

I would simply say: Work hard and stay open-minded. As for the rest, you’ll see…

Regarding AI, I don’t really know much about it, to be honest. It’s likely we will use it the way we have used all the other computer tools at our disposal so far. Will it replace artists? I’m not sure. At least not those who bring real added value. For the moment, and from what I have seen, AI is certainly impressive at first glance, but in practice, it’s impractical, difficult to use precisely and ultimately very disappointing. Not to mention, of course, the copyright issues it raises, the environmental concerns, and the issues of technological sovereignty.

However, if in the future it turns out that I’m wrong, please don’t blame me!

Louise Seynhaeve and David Coquard-Dassault helped develop the film’s graphic novel-inspired visuals.

- United States -

‘Kindred Spirits’ Director Tomm Moore Unveils Trailer & Art from Cartoon Saloon’s New Project at Cartoon Movie

Ramin Zahed

‘Kindred Spirits’ Director Tomm Moore Unveils

‘Kindred Spirits’ Director Tomm Moore Unveils Trailer & Art from Cartoon Saloon’s New Project at Cartoon Movie

Ramin Zahed

Trailer & Art from Cartoon Saloon’s New Project at Cartoon Movie

The European film pitching and financing event Cartoon Movie began on a high note with a session focusing on Cartoon Saloon’s new project in development Kindred Spirits. The acclaimed Irish studio’s co-founder and three-time Oscar nominated director Tomm Moore, brand-new Cartoon Saloon CEO Anthony Leo (of Aircraft Pictures fame), Folivari producer and co-founder Thibaut Ruby (The Summit of the Gods, Silly Sundays) and screenwriter Shelley Dennis (Spirit Rangers) presented the trailer — which you can watch below — and some great art from their emotionally charged new feature and revealed the storyline to a packed audience.

Ramin Zahed

the height of the Irish potato famine, where over a million people died and over a million people were displaced, somehow the Choctaw Nation had just survived the Trail of Tears and their own displacement from Mississippi to Oklahoma decided to pull together a significant amount of money to send it to relieve the plight of the Irish people.”

Set in 1847 New York, Kindred Spirits centers on Mara, a young Irish immigrant, and Tushka, a Choctaw boy far from his family, who form a magical bond and journey through epic adventures, all while being watched over by the spirit of Mara’s late brother. Penned by Shelley Dennis and Will Collins, the movie is described as a film about “grace, compassion and humanity.”

Art created for Cartoon Saloon’s 2029 feature ‘Kindred Spirits.’

Moore highlighted the deep connection and friendship between the Irish and Native American people, which goes back 150 years,” said Moore. “There are two monuments one in Ireland and one in Oklahoma celebrate the friendship between the Irish and the Choctaw people,” he said.

“Standing in front of the moment in Ireland are representatives of the Navajo and the Hope people who made a quilt to thank the Irish for their donations during the Covid-19 pandemic. I remember that online fundraiser really well, which was inundated with Irish financial contributions and messages such as ‘The Choctaw Nation in their distress helped out us Irish in ours.’ That’s what made me realize really that in the folk memory in Ireland that in 1847 during

From left, Anthony Leo, Tomm Moore, Thibaut Ruby and Shelley Dennis highlighted their movie ‘Kindred Spirits’ at Cartoon Movie.

Moore added, “In our film Kindred Spirit we are trying to celebrate that friendship and kinship. Together with our Irish and Native American friends and partners and our French friends at Folivari Studio who worked with us on Wolfwalkers who are led by Didier Bruner who believed in us from our first Cartoon Saloon Movie back in 2001, we want to create an emotional uplifting

Art created for Cartoon Saloon’s 2029 feature ‘Kindred Spirits.’

journey for our audience — a hopeful journey, a companion for life’s contemporary challenges. It’s partly a refugee life story which sadly has resonance to this day.”

Moore pointed out that the film will be suitable for all audiences who will be invited to explore the beautiful landscapes and meet the main characters who care for each other deeply and place the audiences right beside them as they battle danger and discover the deep spiritual beauty within them. “Looking back at my work over the past 35 years, I’ve managed to pull together a team of creative folks who want to make animation with their own hands. Following the legacy of our Academy Award-nominated Irish trilogy The Secret of Kells, The Song of the Sea and Wolfwalkers, I’m now looking forward to building a new trilogy, new stories, new cultural partnerships beginning with Kindred Spirits, I wanted to inspire new understanding and crosscultural appreciation everywhere.”

Kindred Spirits is one of 50 features presented at Cartoon Movie in Bordeaux this week. “This year’s selection includes several projects that thoughtfully engage with significant themes such as war, exile and migration, while addressing a wide range of audiences, from young adults to families,” said Annick Maes, general manager of Cartoon. You can learn more about the event and this year’s projects here.

- United States -

One of the most exciting sessions planned for this year’s edition of Cartoon Movie in Bordeaux in March is a “pitch hour” showcasing Cartoon Saloon’s latest feature in development. The universally loved Kilkenny, Irelandbased studio is introducing KindredSpirits, its follow-up to this year’s feature Julián, which will be arriving in theaters this year. Produced by Ailbhe McCabe and Thibaut Ruby, the movie will be directed by none other than studio co-founder and three-time Oscar-nominated Tomm Moore (TheSecretofKells,SongoftheSea, Wolfwalkers).

This article was written for the March ’26 issue of Animation Magazine (No. 357).

FEATURESTOP STORIES

This article was written for the March ’26 issue of Animation Magazine (No. 357).

KindredSpirits[CartoonSaloon]

Set in the late-19th-century New York City, the story centers on Mara, a young Irish immigrant, and Tushka, a Choctaw boy far from his family, who form a magical bond and journey through epic adventures, all while being watched over by the spirit of Mara’s late brother. Penned by Shelley Dennis and Will Collins, the movie is described as a ﬁlm about “grace, compassion and humanity.” Moore was kind enough to answer a few of our very early questions about his new movie via email:

‘Kindred Spirits’ Director Tomm Moore Shares the Supernatural Secrets of Cartoon Saloon’s New Project

By Ramin Zahed

February 27, 2026

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

By Ramin Zahed February 27, 2026

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

to this article now

Tomm Moore: I had the idea for the project during the pandemic when there was a fundraiser in Ireland for native people who were badly affected by the pandemic and there was a lot of news about the Choctaw gift to the Irish during the famine of 1845.

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

This article was written for the March ’26 issue of Animation Magazine (No. 357).

What was it about the story that grabbed your interest?

This article was written for the March ’26 issue of Animation Magazine (No. 357).

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

What was it about the story that grabbed your interest?

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

What was it about the story that grabbed your interest?

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

What stage is the movie at right now?

What was it about the story that grabbed your interest?

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

What stage is the movie at right now?

What was it about the story that grabbed your interest?

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

What stage is the movie at right now?

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

What was it about the story that grabbed your interest?

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

What stage is the movie at right now?

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

Your movies are the perfect antidote for our insane world right now. Why do you think KindredSpirits is an ideal story for Cartoon Saloon to tell?

What was it about the story that grabbed your interest?

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

What was it about the story that grabbed your interest?

What stage is the movie at right now?

Your movies are the perfect antidote for our insane world right now. Why do you think KindredSpirits is an ideal story for Cartoon Saloon to tell?

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents.

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

What stage is the movie at right now?

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents.

Your movies are the perfect antidote for our insane world right now. Why do you think KindredSpirits is an ideal story for Cartoon Saloon to tell?

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

What stage is Julián in, and when do you think we’ll be able to see it in theaters?

What stage is the movie at right now?

Your movies are the perfect antidote for our insane world right now. Why do you think KindredSpirits is an ideal story for Cartoon Saloon to tell?

AnimationMagazine:Congrats on the new movie! We’re all very excited about it. Can you tell us a bit about the origins of the project?

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

What stage is the movie at right now?

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents.

Julián is almost complete! Watch out for it in cinemas soon!

What stage is Julián in, and when do you think we’ll be able to see it in theaters?

Your movies are the perfect antidote for our insane world right now. Why do you think KindredSpirits is an ideal story for Cartoon Saloon to tell?

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents.

Julián is almost complete! Watch out for it in cinemas soon!

We are working on the script with our Choctaw writer Shelley Dennis and our Irish long-term collaborator Will Collins as well as progressing the visual development with art director Maya Merigeau.

What stage is Julián in, and when do you think we’ll be able to see it in theaters?

What is your take on the stage of global animation today?

Julián is almost complete! Watch out for it in cinemas soon!

What stage is Julián in, and when do you think we’ll be able to see it in theaters?

What was it about the story that grabbed your interest?

Your movies are the perfect antidote for our insane world right now. Why do you think KindredSpirits is an ideal story for Cartoon Saloon to tell?

What is your take on the stage of global animation today?

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents.

Your movies are the perfect antidote for our insane world right now. Why do you think KindredSpirits is an ideal story for Cartoon Saloon to tell?

What was it about the story that grabbed your interest?

Julián is almost complete! Watch out for it in cinemas soon!

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents. stage is Julián in, and when do you think we’ll be able to see it in theaters?

It’s an exciting time with studios experimenting more with different looks after many years where there was an almost standardized look to the majority of mainstream animation. Now since Spider-Verse there’s been an explosion of different looking styles and approaches which I really appreciate.

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

What is your take on the stage of global animation today?

Julián is almost complete! Watch out for it in cinemas soon!

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents.

- United States -

I think it speaks to our better nature as humans and our ability to see the commonality across cultures and even continents.

What stage is Julián in, and when do you think we’ll be able to see it in theaters?

The fact that such a seemingly unlikely community saw commonality with the Irish story and were moved to help is very inspiring and certainly a story with a lot of relevance for today.

What is your take on the stage of global animation today?

Julián is almost complete! Watch out for it in cinemas soon!

Cartoon Saloon Reveals Trailer for ‘Kindred Spirits’ Feature

Kévin Giraud

Cartoon Saloon Reveals Trailer for ‘Kindred Spirits’

Feature Film

Feature

Kévin Giraud

Watch The First Teaser For Cartoon Saloon’s Irish-First Nations Trailblazing Adventure ‘Kindred Spirits’ (EXCLUSIVE)

Feature Film

By Kévin Giraud |

03/04/2026 7:39 am |

Watch The First Teaser For Cartoon Saloon’s Irish-First Nations Trailblazing Adventure ‘Kindred Spirits’ (EXCLUSIVE)

By Kévin Giraud

| 03/04/2026 7:39 am |

Once upon a time, during the Great Famine in Ireland, a deep bond was created between the island nation and the First Nations across the United States and Canada, who donated money to help the Irish people during their time of tremendous need. More than 160 years later, as the pandemic hit nations across the globe hard, and the First Nations even harder, this connection still held across time and space, through the spirits of these benevolent ancestors on both sides of the Atlantic.

It was during the pandemic, as he witnessed this effort, that Cartoon Saloon co-founder and Academy Award-nominated director Tomm Moore first conceived the idea of Kindred Spirits Today, he officially unveiled the first images from his new feature in development in front of a packed Cartoon Movie screening room, where he shared the stage with new Cartoon Saloon CEO Anthony Leo, script writer and Choctaw artist Shelley Dennis, and longtime Folivari co-producer Thibaut Ruby.

Ahead of the pitch, Cartoon Brew spoke with Moore and Ruby and shared an exclusive extended trailer of their project, currently in development.

It was during the pandemic, as he witnessed this effort, that Cartoon Saloon co-founder and Academy Award-nominated director Tomm Moore first conceived the idea of Kindred Spirits. Today, he officially unveiled the first images from his new feature in development in front of a packed Cartoon Movie screening room, where he shared the stage with new Cartoon Saloon CEO Anthony Leo, script writer and Choctaw artist Shelley Dennis, and longtime Folivari co-producer Thibaut Ruby.

Ahead of the pitch, Cartoon Brew spoke with Moore and Ruby and shared an exclusive extended trailer of their project, currently in development.

Kindred Spirits tells the tale of two children dealt a very bad hand. Mara, an Irish refugee child alone in New York in 1847, meets Tushka, a Choctaw Nation son far from the warmth of his family. When their paths align, the two journey across America through epic adventures and magical encounters, watched over by Mara’s brother Dan, who cannot accept his own passing into the spirit realm. Together, they search for people to call family and a place to call home.

Kindred Spirits tells the tale of two children dealt a very bad hand. Mara, an Irish refugee child alone in New York in 1847, meets Tushka, a Choctaw Nation son far from the warmth of his family.

When their paths align, the two journey across America through epic adventures and magical encounters, watched over by Mara’s brother Dan, who cannot accept his own passing into the spirit realm. Together, they search for people to call family and a place to call home.

“I knew about the bond between Irish and Choctaw nations, but I’d forgotten about it,” said Moore. “During the pandemic, I saw how deeply it was still engraved in folk memory in Ireland. In fact, as we researched the film, we discovered that not only the Choctaw but also other First Nations sent help during the Great Famine back then. That was the start of our journey.”

Both co-producer and director of this new feature, Moore underlined that he is now very comfortable wearing those two hats, even calling it a blessing. “I find it hard to direct a movie where I didn’t have some input as a producer as well. I’m also very lucky to be a producer among great producers, so there are plenty of talented people to lean on.”

For Folivari, which has been co-producing with Cartoon Saloon from the start, it felt natural to board this new and exciting project. “It’s true, we have a long history with the studio,” added Ruby. “But we’ve always cherished stories about outcasts, from Ernest & Celestine (a mouse and a bear living together) to The Big Bad Fox (a fox who raises chickens). Meeting these two new characters, who have to find out how to become a family, is definitely the kind of theme we’re interested in.”

Depending on talent availability, the two renowned studios aim for a 50/50 work split, as they did for the teaser trailer shared here. “Maya lives in Paris, and Tomm came for two weeks to work in Paris as well,” recalled Ruby. “A lot of the backgrounds were done here by Maya, and the rest was handled by the wonderful Cartoon Saloon team in Kilkenny, Ireland. They’re amazing.”

who have to find out how to become a family, is definitely the kind of theme we’re interested in.”

Cartoon Brew - 04/03/2026

Beyond working with existing teams, Cartoon Saloon brought Native American artists on board for the project, finding ways to incorporate visuals from each nation and tribe. “As the characters journey across America, the landscape is affected by the artworks of that area,” explained Moore. “It was very important for us, and very interesting, to work with artists such as Waylon Whitedeer, a Choctaw visual artist, and Morgan Thompson, a Cherokee storyboard artist, as well as people we had already worked with, like Maya Merigeau. Until now, we had made a lot of Irish material. Adapting to a different style to bring in Native American influences was a new challenge.”

The team also aims to bring Choctaw musicians into the mix, along with Native American sounds that will create, just like the visuals, a blend of the two cultures. Bruno Coulais, longtime Cartoon Saloon composer, helms the soundtrack of this upcoming project, with traditional Irish music band Kíla returning as well after Wolfwalkers.

Opening the impressive Cartoon Movie 2026 slate, which boasts no fewer than 50 projects in the works, Cartoon Saloon and Folivari are still developing the story and fine-tuning the financing and production scheme for Kindred Spirits. The teams are currently looking for potential European coproducers, international sales agents, broadcasters, and regional distributors.

“I’m really curious about how our story resonates, especially in America,” underlined Ruby. “I think for a lot of kids today, most migrants aren’t white, but it’s good to show them that it could be anybody. You can be a young white European girl in the U.S. and still be an immigrant. To be on the immigrant side, to be the one that doesn’t matter, is a powerful aspect of this story.”

“For me, this movie is a departure,” concluded Moore. “It’s the start of a new cycle where I’m looking at the Irish diaspora elsewhere in the world and trying to find other stories that are yet to be told. This one is connected to a very vivid recent history in Ireland, and I think it’s a powerful tale to tell nowadays.”

What Do You Think?

Tomm Moore’s ‘Kindred Spirits’ among Cartoon Movie 2026 line-up

BY EMILIO MAYORGA | 2 MARCH 2026

SOURCE: COURTESY OF CARTOON SALOON ‘KINDRED SPIRITS’

Kindred Spirits, an upcomingproject from three-time Irish Oscar nominee Tomm Moore, is one of the animation projects selected for Cartoon Movie 2026, the two-day pitching and co-production event for animated feature projects.

Moore’s credits include 2010’s The Secret Of Kells, 2015’s Song Of The Sea, and 2021’s Wolfwalkers, all nominated for the best animated feature Oscar.

Set in 1847 New York, Kindred Spirits followsan Irish refugee girl and a displaced Choctaw boy who form an unlikely bond. Presently in development and being produced via Moore’s Kilkenny-based Cartoon Saloon, Kindred Spirits joins the 12 projects at concept stage, 30 in development, seven in production and one sneak preview that will be showcased to potential international partners at the event taking place in Bordeaux in south-west France, from March 3-5.

Hungarian ﬁlmmakers Tibor

€20,000 Eurimages Co-production Development

• Financiers respond to UK producers’ indie tax credit concerns: “It’s a

- United Kingdom-

Tomm Moore's 'Kindred Spirits' Selected or artoon Movie 2026

The upcoming animated lm rom the three-time scar nominee is among the projects chosen or the prestigious pitching and co-production event.

Mar.2,2026at3:07pm

The upcoming animated lm rom the three-time scar nominee is among the projects chosen or the prestigious pitching and co-production event.

Gotstoryupdates? Submityourupdateshere.›

Mar.2,2026at3:07pm

Gotstoryupdates? Submityourupdateshere.›

iscurrentlyindevelopmentandisbeingproducedthroughMoore'sKilkennybasedstudio,CartoonSaloon.

KindredSpirits,anupcominganimatediflmfromthree-timeIrishOscar nomineeTommMoore,hasbeenselectedasoneoftheprojectstobefeatured atCartoonMovie2026,thetwo-daypitchingandco-productioneventfor animatedfeatureiflms.Setin1847NewYork,theiflmfollowsanIrishrefugee girlandadisplacedChoctawboywhoformanunlikelybond.KindredSpirits

WHYITMATTERS

TommMooreisahighlyacclaimedanimatorwhosepreviousiflms,including hTeSecretofKells,SongoftheSea,andWolfwalkers,haveallbeennominated fortheAcademyAwardforBestAnimatedFeature.HisselectionforCartoon Movie2026furthercementshisreputationasoneoftheleadingvoicesin contemporaryanimationandhighlightsthecontinuedgrowthand importanceoftheCartoonMovieeventasaplatformforshowcasingthebest upcominganimatedprojects.

THEDETAILS

KindredSpiritsissetin1847NewYorkandfollowsanIrishrefugeegirlanda displacedChoctawboywhoformanunlikelybond.hTeiflmiscurrentlyin developmentandisbeingproducedthroughTommMoore'sKilkenny-based studio,CartoonSaloon.KindredSpiritsisoneof12projectsattheconcept stage,30indevelopment,seveninproduction,andonecompletediflmthat willbefeaturedatCartoonMovie2026.

KindredSpiritsiscurrentlyindevelopment.

THEPLAYERS

TommMoore

Athree-timeIrishOscarnomineeandacclaimedanimator,whose previousiflmsincludehTeSecretofKells,SongoftheSea,and Wolfwalkers.

CartoonSaloon

TommMoore'sKilkenny-basedanimationstudio,whichisproducing KindredSpirits.

PARMARC -MARDI16DÉCEMBRE2025

KindredSpirits:les1èresimagesdu nouveauTommMoore

PARMARC -MARDI16DÉCEMBRE2025

ACTUALITÉS

KindredSpirits:les1èresimagesdu nouveauTommMoore

PARMARC -MARDI16DÉCEMBRE2025

Kindred Spirits(qu’onpeuttraduirepar«Âmes Soeurs»)estréaliséparMooreetsonstudio CartoonSaloon,écritparShelleyDennis etWillCollins etestaveclaparticipationdustudio françaisFolivari.

TommMoore,réalisateurdeBrendan&leSecretdeKells,LeChantdelaMeret LePeuple

Kindred Spirits(qu’onpeuttraduirepar«Âmes Soeurs»)estréaliséparMooreetsonstudio CartoonSaloon,écritparShelleyDennis etWillCollins etestaveclaparticipationdustudio françaisFolivari.

Kindred Spirits(qu’onpeuttraduirepar«Âmes Soeurs»)estréaliséparMooreetsonstudio

CartoonSaloon,écritparShelleyDennis etWillCollins etestaveclaparticipationdustudio françaisFolivari.

19/12/2025, 17:02

TommMoore,réalisateurdeBrendan&leSecretdeKells,LeChantdelaMeret LePeuple Loup revientavec unnouveaulong-métragedontonaàlafois letitreetles premièresimages.

19/12/2025, 17:02

Lepitchditceci: «Uneenfantréfugiéeirlandaise,seuleàNewYorken1847.UnfilsChacta [un peupleduSud desEtatsUnis,installéentreleMississipietlaLouisiane] loin delachaleurdesa famille.Lorsqueleurscheminssecroisent,MaraetTushkavivrontdesaventuresépiquesetdes rencontresmagiques,sousleregard bienveillantdeDan,lefrèredeMara,quirefused’accepterson proprepassagedanslemondedesesprits.Ensemble,ilscherchentunecommunautéoùsesentirchez eux,un foyer.Explorantlelien historiqueunissantlesnationsirlandaiseetChacta,KindredSpirits estun filmempreintdegrâce,decompassionetd’humanité.» ACTUALITÉS

Loup revientavec unnouveaulong-métragedontonaàlafois letitreetles premièresimages.

«Uneenfantréfugiéeirlandaise,seuleàNewYorken1847.UnfilsChacta [un peupleduSud desEtatsUnis,installéentreleMississipietlaLouisiane] loin delachaleurdesa famille.Lorsqueleurscheminssecroisent,MaraetTushkavivrontdesaventuresépiquesetdes rencontresmagiques,sousleregard bienveillantdeDan,lefrèredeMara,quirefused’accepterson proprepassagedanslemondedesesprits.Ensemble,ilscherchentunecommunautéoùsesentirchez eux,un foyer.Explorantlelien historiqueunissantlesnationsirlandaiseetChacta,KindredSpirits estun filmempreintdegrâce,decompassionetd’humanité.»

Kindred Spirits : les 1ères images du nouveau Tomm Moore – CloneWeb at the link in our bio!!!

View all 82 comments

Kindred Spirits : les 1ères images du nouveau Tomm Moore – CloneWeb

https://www.cloneweb.net/kindred-spirits-les-1eres-images-du-nouveau-tomm-moore/ 1/10 TommMoore,réalisateurdeBrendan&leSecretdeKells,LeChantdelaMeret LePeuple Loup revientavec unnouveaulong-métragedontonaàlafois letitreetles premièresimages.

Add a comment

https://www.cloneweb.net/kindred-spirits-les-1eres-images-du-nouveau-tomm-moore/ 1/10

Le film est basé sur une histoire vraie : en 1847, les Indiens Chacta (ou Choctaw) envoient en Irlande la somme de 170 dollars d’époque pour aider la population en proie à une catastrophique famine. On estime que la somme correspondrait à plusieurs milliers de dollars d’aujourd’hui. Une statue pour commémorer cet acte existe en Irlande dans le Comté de Cork.

19/12/2025, 17:02

Kindred Spirit sera présenté à Bordeaux au Cartoon Movie 2026. Le studio Cartoon Saloon développe en parallèle un autre prjet : Julian, réalisé par Louise Bagnall d’après le bouquin de Jessica Love. Le dernier court-métrage du studio, , lui, fait le tour des festivals. Une bandeannonce est visible ici

Kindred Spirits : les 1ères images du nouveau Tomm Moore – CloneWeb

'Until Death Unites Us': A Dark Animation Comedy from Poland (In Fo... https://www.zippyframes.com/shorts/until-death-unites-us-cee-animatio...

'Until

Death Unites Us': A Dark Animation Comedy from Poland (In Focus: CEE Animation 2025)

'Until Death Unites Us': A Dark Animation Comedy from Poland (In Focus: CEE Animation 2025)

Vassilis Kroustallis

Vassilis Kroustallis

Vassilis Kroustallis

Talking about death is never a family-friendly issue (even if it refers to families). Yet Polish animation director Nawojka Wierzbowska (her previous short film was the comically poignant 'I am not here anymore'), co-director Natalia Krawczuk (Ping Pong, Fences) and producer Zuzanna Maszka (GS Animation) got the coveted Feature Animation prize at the 2025 CEE Animation Forum with their 'Until Death Unites Us' project - "for the courageous, fresh and authentic approach to traditionally heavy and taboo topics - explored through the disarming power of humor and universally relatable characters'.

The Polish animation project will attend the next CARTOON Movie and pitch their project there to several European and international animation players. The story is based upon the previous short 'I am not here anymore'; Lady Death is bored with her job; one day, she mistakenly turns a dead Grandfather into a "Stuck Soul" that needs to stay in bodily function until they complete their mission in life. She has no option other than to stay on Earth and help him.

Story and Characters

Nawojka Wierzbowska: The Lady Death character was secondary in the short. So even if the same set of characters (Lady Death, Grandpa, Mama Vita, and the Dog) is transferred, the narrative spine is entirely new. I love the idea of creating an entirely new universe from scratch — the Afterlifes. It is the first time I am working on a story that takes place partly in an unreal world, and I truly enjoy inventing and defining all its rules and little details.

"But I am giving them [the short's previously secondary characters] now more traits, more flaws, and greater complexity in their relationships with one another. Watching them evolve in this new story feels a bit like witnessing the growth of your own child".

Two-director collaboration & the Animation Aesthetics

Nawojka Wierzbowska: I believe that certain stages of the filmmaking process, like the screenplay, benefit greatly from having two people involved. Shortly after deciding to expand the short into a feature, I invited Natalia to co-write the script with me. Since she also has experience as an animator and director, I felt that our collaboration could be equally valuable in the storyboard and

'Until Death Unites Us': A Dark Animation Comedy from Poland (In Fo... https://www.zippyframes.com/shorts/until-death-unites-us-cee-animatio...

1 van 4 29/01/2026, 16:02 animatic phases. I am convinced that working on these stages together will allow us to pay closer attention to detail and come up with more inventive and humorous elements.

1 van 4 29/01/2026, 16:02

Natalia Krawczuk: Part of the film takes place on Earth, and part of it in the Afterlife. Our main concern now is defining what both worlds will look like. The afterlife should be sterile and quite dark, with no natural light available. At the same time, Earth will be colourful, cosy, and also a bit messy and chaotic. So, depending on where the action of the film takes place, its look will be different. We’re now searching for the main rule to establish this difference. Whether it will be the difference in the way it will be drawn - like digital painting vs. plain vector drawings, or maybe even in the way it will be built – 2D vs 3D is still to be decided. We want the backgrounds to reflect how our main character feels in each of the environments; therefore, it is important to find the right look for it.

of Until

'Until

the

Feature Film Production Future:

At the same time, we are very open to exploring possibilities in Germany, given its strong regional funding system, as well as throughout the CEE region — including the Czech Republic, Slovakia, Latvia, Lithuania, and Hungary, all of which could match the project creatively and financially. We don’t have confirmed partners yet; however, once we secure Polish financing for the development phase, our next step will be to start formal conversations with potential co-producers who could join us already at this early stage.

'Until Death Unites Us': A Dark Animation Comedy from Poland (In Fo... https://www.zippyframes.com/shorts/until-death-unites-us-cee-animatio... feels

2 van 4

https://www.zippyframes.com/shorts/until-death-unites-us-cee-animatio...

Pitching of Until Death Unites Us at the 2025 CEE Animation Forum (photo credit: Petra Sucha)

Feature Film Production Future:

2 van 4

Zuzanna Maszka: We see this project as a European co-production. We are currently considering France as a key potential partner — not only because our authors have strong artistic links to French culture and education, but also due to France’s long-standing tradition of supporting adult animation.

29/01/2026, 16:02

The CEE Animation Forum 2025 Experience

2 van 4 29/01/2026, 16:02

29/01/2026, 16:02

Pitching of Until Death Unites Us at the 2025 CEE Animation Forum (photo credit: Petra Sucha)

The CEE Animation Forum 2025 Experience

Pitching of Until Death Unites Us at the 2025 CEE Animation Forum (photo credit: Petra Sucha)

The CEE Animation Forum 2025 Experience

Zuzanna Maszka: The CEE Animation Forum was an incredibly valuable experience for us. The feedback we received — both from the jury and from the audience — was overwhelmingly positive, which is extremely encouraging at such an early stage of development. The jury's recognition, along with the award itself, gives us confidence that the film has genuine potential for success and international visibility. Being selected directly for Cartoon Movie is absolutely mind-blowing for us; presenting the project there as “in concept” feels like the perfect timing. We hope it will open doors to finding our ideal co-production partner — or several.

Pitching

Death Unites Us at

2025 CEE Animation Forum (photo credit: Petra Sucha)

Death Unites Us': A Dark Animation Comedy from Poland (In Fo...

Pitching of Until Death Unites Us at the 2025 CEE Animation Forum (photo credit: Petra Sucha)

'Until Death Unites Us': A Dark Animation Comedy from Poland (In Fo... https://www.zippyframes.com/shorts/until-death-unites-us-cee-animatio...

Pitching of Until Death Unites Us at the 2025 CEE Animation Forum (photo credit: Petra Sucha)

'Until Death Unites Us': A Dark Animation Comedy from Poland (In Fo... https://www.zippyframes.com/shorts/until-death-unites-us-cee-animatio...

Pitching of Until Death Unites Us at the 2025 CEE Animation Forum (photo credit: Petra Sucha)

'Until Death Unites Us': A Dark Animation Comedy from Poland (In Fo... https://www.zippyframes.com/shorts/until-death-unites-us-cee-animatio...

CALL FOR PROJECTS & PARTICIPANTS REGISTRATION ARE OPEN FOR CARTOON MOVIE 2026

You have an animated feature ﬁlm in the making and you want to seize the opportunity to pitch it in front of your peers? We are pleased to announce that Cartoon Movie is back in Bordeaux (France) from 3 to 5 March 2026! The project submissions and participant registrations are now open!

Do you have an animated feature ﬁlm project?

SubmitittoCartoonMovieby12November2025(23:59)! If selected, you will have the opportunity to pitch it to more than 800 professionals from the animation industry, including around 250 buyers, to ﬁnd co-producers, ﬁnancing, distributors and sales agents.

Online project submission 1.Preparealltherequiredelements as listed on our website.

Johannes Wolters

opportunity to pitch it to more than 800 professionals from the animation industry, including around 250 buyers, to ﬁnd co-producers, ﬁnancing, distributors and sales agents.

2.Whenyouareready,goto My Cartoon and login or create an account. Click on „My Projects > Cartoon Movie > Submit your project“

Online project submission

3.Startﬁllingintheonlineform:

1.Preparealltherequiredelements as listed on our website

Please, make sure you have all the information on hand so you can complete the form all at once. To do this, you can view the entire form in PDF format. You will receive a complete summary by email once it is completed.

CLICK HERE TO SUBMIT YOUR PROJECT

For professionals in the animation industry working on feature-length ﬁlms, Cartoon Movie is the place to be! You can:

�� Discover the latest in animated feature ﬁlms, with around 55selectedprojects

�� Meet over800participants,includingproducers,authors,distributors,salesagents, broadcasters,publishersandplatforms from more than 40 countries

�� Network in a relaxed and friendly atmosphere

�� Findbusinesspartners and/or joinnewprojects

…and much more!

Cartoon Movie 2026 • Discover the winner of the Eurimages Co-development Award!

The jury highly appreciates the originality of this ﬁlm’s storytelling, inspired by the director’s experience working with children and their curiosity about the natural world. The jury loves the joyful humor and fantasy of this project as well as its innovative

Wolters

Since its first edition in 1999, 510 films have been financially supported by Cartoon Movie with a total budget of €3.4 billion. Organised by CARTOON, Cartoon Movie is an annual forum aimed at strengthening the production and distribution of animated feature films in Europe. The event has the support of Creative Europe – MEDIA, CNC (Centre national du cinéma et de l’image animée), Région Nouvelle-Aquitaine, Bordeaux Métropole, Magelis, Creatvie industries hub in Angoulême and France Télévisions.

CARTOON – European Association of Animation Film is an international non-proﬁt association based in Brussels that organises Cartoon Movie, together with Cartoon Forum, a co-production forum for animated TV series, and the training seminars

CartoonNext, Cartoon Springboard, and Cartoon Business.

# Eurimages, Fabian & Fred, Pure Shore

SCHREIBE EINEN KOMMENTAR

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert

KOMMENTAR*

LIST OF MEDIA INCLUDED

• ABC (ES)

• Animation Magazine (US)

• Animation World Network (US)

• Audiovisual 451 (ES)

• Catsuka (FR)

• Cineuropa (EU)

• Cinema & Video International (IT)

• Cinergie (BE)

• CNC (FR)

• CTVM (CA)

• Car toon Brew (US)

• CloneWeb (FR)

• Ecran Total (FR)

• European Animation Journal (EU)

• Europa Distribution (EU)

• Nordisk Film & TvFond (CZ)

• FILMHU (HU)

• Indac (DE)

• Kidscreen (CA)

• La Car toucherie (FR)

• La Croix (FR)

• Le Film Français (FR)

• La Radio du Cinéma (FR)

• La Nazionale (IT)

• Mikrofilm (NO)

• National Today (US)

• Pictanovo (FR)

• Playback (CA)

• Quotidiano nazionale (IT)

• Radix (ES)

• Rubik Audiovisual (ES)

• RDVCanada (CA)

• Screen Daily (UK)

• Swiss Info (CH)

• Susy Q (ES)

• Sud Ouest (FR)

• TelefilmCanada (CA)

• Tempo Libero (IT)

• TeGustaMuchoElCine (ES)

• The Animation Journal (EU)

• WorldScreen (US)

• Variety (US)