“She was always in service to her country,” he said. “Right up until this (last) week she was performing her duties in service to her country.”
He said the Town would follow the provincial lead and have the flags at half mast for 10 days.
2 Andrew
Your news this week:
“She’s the only monarch I’ve ever known in my life,” said Lamont Mayor Kirk Perron. “And it’s going to be a darker world without her.”
3 Nursing
Proud to be IndependentanCANADIANPublication
He said the Town would observe the guidelines from the provincial government and he had also posted a message on his personal website.
7
“It’s going to be an interesting time for the Commonwealth with the Queen’sPerron,passing.”whosaid he’s a “history nerd,” added that her passing will be a very significant event in world history.
He said he personally felt the Queen was the “Quintessential monarch.”
“We were planning an event to recommemorate our Queen’s Park and with the passing of the Queen we’ll be doing something more special now.”
www.LamontLeader.com
“I hope King Charles comes in and maintains the same stability she provided.”Hesaid the Queen’s portrait has been wrapped in a shroud, but he didn’t know how long it would take to get a new portrait of the King.
“She ruled with grace and poise and dignity,” he said Sept. 10. “She had a sense of humour at times. And during turbulent times she was a rock for the country and the Commonwealth.
The Queen’s portrait will be draped with a black shroud.
Perron said there would be so many small changes with her passing such as the new anthem ‘God Save the King,’ and the creation of some new currency. He said the Town will follow all the protocols as they were outlined by the Province.Headded the Town Council would do a tribute during its Sept. 13 council meeting.TheQueen visited Lamont, and a small monument is erected along the railroad where she stopped, in 1978.
BY JOHN MATHER
Meanwhile in Bruderheim, Mayor Karl Hauch offered his thoughts on the passing of the Queen.
condolences to all members of the RoyalFlagsFamily.”attheTown will be at half mast for the mourning period of 10 days.
The passing of Queen Elizabeth II (Sept. 8, 2022) means many small changes will be coming to municipal offices and public buildings across the region.InLamont, the Town posted on its website that it would be joining members of the Commonwealth in mourning her death and “extend heartfelt
Vol. 17, No. 42, Wednesday, September 14, 2022
“It’s hard to think of another individual who had as much impact on our lives as the Queen,” he added. “It’s very fitting she worked right until the veryHeend.”said her portrait in several buildings in the town had been draped in black in accordance with custom.
Poilievre
Hauch added the town council would probably provide a tribute to the Queen at a future council meeting. He said he had been at a conference and a moment of silence had been held.
Next PM? sweeps CanadaSchool roof a disasterAlumni disbandingOPINION: Poilievre offers hope -
Queen Elizabeth II passed away on Sept. 8, but is remembered as a great monarch who visited Mundare, Chipman, Lamont and Bruderheim as part of her 1978 Royal Tour.
Queen’s passing brings changes to municipalities
FREE4
the 3,423 cast.
votes and Aitchison ended up with 22.
2 Lamont
In Sherwood Park-Fort Saskatchewan, Poilievre claimed 2,516 votes out
Poilievre claims CPC leadership while sweeping local ridings
Newly elected CPC leader Pierre Poilievre and his wife Anaida after his victory was announced.
BY JOHN MATHER
received 109 votes in the riding and Aitchison had 14.“Pierre and I have known each other for many years,” said Stubbs following his victory. “I am excited the Conservative members from every part of the country gave him such an thefrequentlythefutures.”theirstrugglingbeCanadians.”everydayrecordvalues.mentsteadfastconsistent,Poilievreendorsementoverwhelmingasleader.”Sheaddedshefindsisprincipled,articulateandinhiscommit-toConservative“Hehasalongtrackoffightingforworking“WecanexpecthimtolaserfocussedonCanadians,familiesandtheir“PierreadvocatesforprioritiesIhearmostaboutfrompeopleofLakeland.”
New Conservative leader wins 330 of 338 ridings in Canada including 68 percent of overall vote
Leader (Lamont, Alberta), Wednesday, September 14, 2022
Locally, in the Lakeland riding represented by Poilievre campaign heavy weight Shannon Stubbs, the leader cruised home with 2,275 votes out of the 2,708 cast (84 percent).Leslyn Lewis finished second in the riding with 298 votes, followed by Roman Baber with 75, Jean Charest with 58 and Scott Aitchison with 15.
In the leadership race itself, Charest finished in second place followed by Lewis, Baber and Aitchison.
of the 3,207 cast (78 percent). Lewis finished second in the riding with 439 while Charest got 129 for third place. Baber
In Battle RiverCrowfoot riding, Poilievre again steamrolled the competition taking 2,767 votes out of
In fact he only lost eight ridings nationwide (330/338), six in Quebec and two in Ontario.
Enroute to the sweeping victory on the Federal Conservative leadership vote, new leader Pierre Poilievre made a clean sweep of the Alberta ridings.
- The
Lewis again was second with 455 votes and Baber was third with 112.
Charest garnered 77
Qualifications
• Keep the supervisor informed of issues affecting departmental operations.
For further information regarding the job description and requirements please contact:
kind of figure out the next steps for how that's going to be. Obviously, it's not in any current budget and so it would be out of budget so then
• Maintain simple records such as, but not limited to, facility use, maintenance schedules, facility concerns, supplies needed, and other reports as directed by supervisor.
Black garbage bags can be seen sticking out from a heavily patched section of the leaky Andrew school roof (on the side of the village office) along with water stains. Photo: Jana Semeniuk
• Good mechanical aptitude.
when it would be made public.An Andrew Public works employee said the problem with the roof has been ongoing for at least the past couple of years. Upon a closer look at a section of damaged roof inside the building near the Village Office, black garbage bags could be seen shoved into a space near the roof.
• Shifts may include working alone. Shift work is required including evenings and weekends.
• Hours for this position will be up to 30 hrs per week.
Dennis
• Provide quality customer service to a variety of arena facility users by managing ice bookings, answering questions, assist with concerns and direct the customers to the correct person.
Hiring!We're
• Experience operating Ice Resurfacing equipment is an asset but willing to•train.Valid class 5 driver's license.
• Monitor rink and room bookings to ensure clients with reserved ice time and facility rooms adhere to the confirmed times.
This is a Seasonal position, working from October 3, 2022 - March 10, 2023
“Typicallyrepair. our agreement with EIPS is two thirds, one third,” he said. “Providing we both agree, we pay one third and they pay two thirds.”Kozakiewicz confirmed that EIPS had not yet agreed to the amount council passed a motion on.He added that the dollar amount was based on details from a report done after an inspection of Andrew’s roof in 2020.
• Current First Aid and CPR certificates will be provided by employer.
Competition will be open until 4pm September 29, 2022
Send resumes Faxsharron.sinclair@bruderheim.cato:to780·796·3037ormailto:
Two maintenance workers from Elk Island Public Schools came to examine the metal roof over Andrew School on Sept. 9 due to ongoing issues the building has had with leaks over the past couple of years. Their visit was confirmed by Andrew’s Chief Administrative Officer Adam Kozakiewicz, who felt confident a plan to fix the roof would be put into place, although he could only provide a few details.“Elk Island Public had sent two gentlemen and they're looking at putting membranes and envelopes on top of the roof and kind of re-doing and re-screwing the roof again, to make sure to prevent further damage,” he Andrewsaid.School shares their building with the Andrew Village Office, also sharing the leaky
roof.Aclosed session of the Aug. 24 Andrew Village Council meeting ended with Kozakiewicz, in open session, reading a motion that was passed for the village to commit up to $450,000 to complete the roof and sprinkler
The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 - 3
“No, they have not (agreed to fund the roof repairs),” he said. “And in fact, they're going to be meeting and discussing, I'm sure quite soon, and then they can
NOW HIRING!NOW HIRING! Email resume to: tofield@oktire.com Drop off in person: 5031 53 Ave., Tofield Working as part of the Vehicle Service’s Team you will be responsible for a variety of tasks including: • Tire Services: mounting/installation, balance & rotation, flat repairs • Lube services: draining/filling, filter checks & replacements, general inspection and recommendation • Customer Service: communicating directly to customers or Service personnel • Shop Related: general housekeeping, Health & Safest compliance, shop supply replenishment, assisting in other areas as needed Skills/Qualifications: •Previous experience/knowledge in the automotive trade prefered • Ability to multi-task and handle multiple priorities on a daily basis • Team player • Willingness to learn • Physically capable of lifting and moving items up to 50lbs+ • Current, valid drivers license TIRE & LUBE TECHNICIAN (Apprentice)
• Ensure all procedures identified in the arena operations manual are followed.
• Operate and maintain ice resurfacing equipment.
This position will include the following duties:
Garbage bags used to control leaks from Andrew School roof
• Ensure quality ice resurfacing to accommodate various activities with hockey, figure skating and public skate, by installing, removing, marking, and maintaining the ice surface.
• Maintain and ensure safe work practices are observed for all tasks.
BY JANA SEMENIUK
“I believe they (garbage bags) were there to hold back water from seeping into the rest of the drywall,” said Kozakiewicz. “They were trying to hold it up. That's why I felt it was there.”Kozakiewicz came onboard as CAO Aug. 1 of this year and said he was not expecting the severity of the roof problem.“The roof is leaking in multiple locations,” he said. “The damage is veryCouncilorsurprising.” Benny
Dubitz said he could not comment as a councillor due to the confidential nature of the inspection report but feels troubled as a “Astaxpayer.ataxpayer, I’m very upset. You know, for a building of that age to be neglected and not looked after. There were problems straight off the initial start with it,” he said. “As a taxpayer it's veryAndrewupsetting.”School was originally built in 1957 with additions and renovations done in 1964, 1980, and 1991 according to reports on the EIPS website.Kozakiewicz said although he has not yet had a commitment from EIPS on funding the roof repairs, he is confident an agreement will be reached soon.
• Responsible for the operation and care of the ice resurfacing equipment and monitoring the operation of the refrigeration systems.
dennis.tomuschat@bruderheim.caDirectorTomuschat,ofInfrastructure
• Monitor the actions of groups and individuals using the arena facilities, i.e., public awareness of bylaws and regulations.•Plan,prioritize and organize tasks to meet daily operational needs of the facility.•Perform custodial duties, general maintenance, and repair tasks throughout the facility.
Town of Bruderheim, Box 280, Bruderheim, AB T0B 0S0
HELP WANTED Arena Attendant
EIPS wasbeenavailablesaidDirectorCommunicationsLauraMcNabbthedocumentisnotasithasnotmadepublic.Sheunabletoconfirm
CERTIFIED STAFFIN EARLY CHILDHOOD WORKINGWITHCHILDREN 12 MOTO 12 YRS. For more information please contact Allison at 780-764-2272 or email your resume to Funshine.CDC.Mundare@gmail.com
they answer the question, are there grants out there available to school boards to fund such projects as repairing the roof or replacing the roof?”
From Prime Minister Justin Trudeau, “Congratulations on being elected Leader of the Conservative Party tonight. As Parliamentarians, we must work together to deliver results for people across the country. Canadians expect – and deserve – nothing less.”Well Trudeau hasn’t really delivered anything for all Canadians, and the best thing Poilievre can do is get elected and force Trudeau and his minions to disappear into the back pages of history books.
Singh has done almost as much to divide this country as Trudeau himself.Their unholy alliance is itself very destructive to ourAndcountry.itlooks like Singh knows he’s a divisive individual skilled at spreading falsehoods when he states that it’s time Canada had a leader that tells the truth and isn’t divisive.
We acknowledge the financial support
He has also advocated firing the Governor of the Bank of Canada and defunding the Canadian Broadcasting Corporation and eliminating the Liberal cash payouts to national media.
Now it’s time for Poilievre to put on his statesman’s hat and show that he can put his vision of what Canada should look like and sell it to the main Conservative body
In conceding defeat
4 - The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 Opinion 5038 - 50 Avenue Box 1079, Lamont, AB T0B 2R0 Phone: 780-895-2780 Fax: 780-895-2705 Email: lmtleader@gmail.com Published every Wednesday at Lamont, AB Serving the Communities of Andrew, Bruderheim, Chipman, Hilliard, Lamont, Mundare, RR 4 Tofield, Star and St. Michael Subscription Rates: Local: $35.18 per year USA: $96.81 Overseas: $187.25 Call to find out about our ONLINE SUBSCRIPTIONS *Advertisements designed, set and produced by The Lamont Leader, as well as pictures, news, editorial content and other printed material are protected by copyright and may not be used without the permission of The Lamont Leader Available online at www.lamontleader.com and Facebook Circulation Aileen Bilodeau Sylvia McDonald
Jana Semeniuk Reporter
AdvertisingManagerSales of Government of Canada through Periodical
So a populist, Pierre Poilievre, has ascended to the top of the Conservative Party of Canada. It really came as no surprise, as his nearest competition was yesterday man Jean Charest whose last foray in politics had been serving as the Liberal premier of Quebec.Poilievre has riled much of the mainstream media with his support of the freedom convoy in Ottawa, a group he alone had the nerve to go and meet with.
make Canada a free, hopeful and prosperous nation once again!”
Fund (CPF) for our publishing activities.
Separation Alberta’s only option to split from Laurentian Elite
Going into his new role as leader Poilievre offers Canadians a youthful approach: an alternative to a tarnished, tattered and tax-happy Liberal government which has been steadily going downhill under sock boy Trudeau.Letthis new era of Conservatism in Canada begin.
temporary as we’ve seen so many times in our history. It seems to me that we are more like that small rodent in a cage running on that small wheel that we’re all so familiar with, expending all that energy trying to get somewhere (as with the laurentian elite) but going nowhere.There is nothing that Pierre Poiliviere can do to change this system without Ontario and Quebec signing off on constitutional reform which leaves us as a province, only one remaining option, that is to continue to fight for our independence from a bad relationship. Just my thoughts here.
BY JOHN MATHER
DearAlthoughEditor: the landslide victory for Pierre Poilievre as the new leader of the Conservative Party, gives us some measure of hope in Alberta, this may just be a mirage. We’ve seen good administrations come, and good administrations go, in federal politics.
The problem as I see it, is that the population imbalance in Eastern Canada dictates the type of federal government that gets elected, usually to the detriment of the objectives and hopes of the Western provinces. It’s a seesaw of successive and opposing parties that will continue until the electoral system is changed in this country that will unfortunately never happen.
This is why the idea of separating from this ineffective form of government is so important to our way of life in the West. The time to change the imbalance of power by constitutional reform has come, but it’s only a pipe dream as Ontario and Quebec will not relinquish the power that they hold over western Canada. We as Albertans need to force the issue of either changing the power imbalance through legislative and democratic process or outright separation from the laurentian elite and Eastern Canada.Yes,it’s time that we see a change in federal politics in Ottawa, but my fear is that this change will only be
John Mather Reporter
the
Letter to the editor
CONTINUED
Kerry Anderson Publisher
Grant Northcott
Crystal Moren Office
Andpolitic.then, take that message and sell it to the Canadian general public.
Populist Poilievre offers hope for this country
After claiming his victory crown on Sept. 10, the accolades started pouring in for Poilievre.
CONTINUED
Charest said, “You deserve a clean slate and the opportunity to unite the membership. We must end the internal mudslinging. Only Liberals benefit from a divided CPC.”
the Canada
And from that most noble of politicians, NDP leader Jagmeet Singh, “I would like to extend my congratulations to Pierre Poilievre on becoming the Leader of the Conservative Party. I know we will disagree on a lot and rarely find common ground – it’s time Canadians have leaders that tell the truth and refuse the destructive politics of Nowdivision.”thatisquite the funny statement from Singh. He props up the Liberals so they can continue to mismanage the Canadian economy and still call average Canadians names and he has the temerity to spew out a statement about truth and the destructive politics of division.
It remains to be seen whether he will run for the CPC when the next general election is called. Third place finisher, Leslyn Lewis, who should likely get a strong position in Poilievre’s shadow cabinet, said “Let’s work together to
The Lamont Leader (Lamont,
owner among our neighbours have been unsuccessful. There’s been no conflict with our surviving cats. He hasn’t been caught digging or chewing on anything. He seemed a bit too good to be true until the night he barked pretty well nonstop for an hour or so. When Hilary’s Gertie visited, there was a mix of harmony and indifference. The jury is out on this doggie visitor but he did lose points when he dared lift a leg near my peony.In the meantime, we’ve got enough projects to last as long as the good weather does, from where I sit.
was able to do it all alone except when four of us were needed to square it on the concrete pad. I happened upon an outdoor storage bench than was on sale for half price. It’ll add a bit of seating and house the drapes and mosquito netting when they’re not hanging in place. I’m not quite sure what happened with the sizing...either we made the pad too big or bought a gazebo too small or a combination of both.
Sometimes,yet.
it’s amazing how things mesh. We finally got our landscape curbing done and it looks great. However, in order to prep for that process, we had to bring back all the landscape rocks that went ‘into storage’ when our addition project began in 2018. Over the years, the grass had grown up around them and we kept finding more and more. It took several hours of hard, hard work. The largest ones were positioned in what we felt was a pleasing arrangement. The smaller, yet impossible to lift ones are sitting on plywood until the plantings are done and we see where they’re needed.
Running concurrently in the background of this activity, our brother-inlaw was andThroughassemblingsinglehandedlyourgazebo.smartplanningpacinghimselfhe
There is sufficient space to position some plant pots or some decorative pieces that have been waiting to be showcased so perhaps it’s a happy accident.ThenI found that the trees and shrubs were 75% off at Home Depot. It seemed the perfect time to try again to grow hydrangeas. The whiteturning-green variety called Limelight is supposed to be hardy to minus 40. They clearly know how to bloom because the blossoms were magnificent and huge. My task now is to dig the proper sized holes, water them in well, and pull them through the winter. This
is more complicated than may be evident. I also bought enough landscape cloth to cover the old and new flowerbeds. But until Roy can buy the rock mulch we’ll need for true weed suppression, I hesitate to lay out the cloth. I really should google which comes first: laying down the fabric and then cutting holes for plants or planting first and then laying fabric around them. To compound matters I bought a couple bags of bulbs—orange tulips and purple allium. I can’t expect them to tear their
way through fabric come spring so that needs some planning. If this fall continues long enough, we also have some major pruning to do to bring things back under control. One or more specimen trees are also needed but that will probably wait until spring.Then, to make things more interesting, a black and white stray dog seems to have moved in. He is friendly and not at all a pest. His tail wags and his eyes are that gorgeous brown. Roy’s attempts to find his
Alberta), Wednesday, September 14, 2022 - 5 ROMANCATHOLICCHURCHSERVICES Our Lady of Good Counsel, Skaro 1st, 3rd, 5th Sundays @ 9:00 am St. Michael the Archangel, St. Michael 2nd, and 4th Sundays @ 9:00 am Administrative Office: Our Lady of the Angels Parish 10004 ~ 101 St., Fort Sask. 780.998.3288 Email:www.olafortsask.caedm.caolangels.ftsask@caedm.ca LutheranBethanyChurch 20577 TWP 550 Fort. Sask. (7km East of Josephburg) Pastor780-998-1874Rev.Jeff Dul Worship Service 9:30 am Sunday School (during service) Coffee after Service Lamont Alliance Church 5007 44 st., Lamont 780-895-2879 Sunday Service 10 am J OINUSFORSERVICES SUNDAYMORNINGS@10AMPastorDarrenAndersonCheckout: www.lamontalliance.com LAMONT UNITED CHURCH 5306 - 51 Ave., Lamont, AB 780-895-2145 Rev. Deborah Brill S UNDAY S ERVICES 11:15 AM Everyone Welcome! AA Meetings Thursdays at 8:00 pm Orthodox V Parishes All services 9:30am, followed by DIVINE LITURGY 10 am unless otherwise indicated. Visit our website: www.orthodox-canada.com 780-895-2780Church Directory Ad $40/mo. C h u r c h C a l e n d a r CommunityBruderheimChurch Join us for Worship at our NEW LOCATION 4904 Queen Street (Former ATB) Sundays @ 10:30 am All are 780.796.3775welcome! Pastor Wayne Larson bruderheimcommunitychurch@shaw.caadmin. SEPTEMBER SEPTEMBERSUNDAY18 TH ~ SKARO SEPTEMBERWEDNESDAY~21ST~NISKU~ FROM WHERE I SIT:Enough Projects Top NumberNumberNumberNumberNumberNumberNumberNumberNumberNumberreasons10toadvertisein10987654321 Because if I want The Leader to cover my event or provide space for my event, I know they need revenue to pay for it! One hand washes the other. I never take without giving back. I like the idea of having an independent news agency in our area, because I don’t want to just be fed propaganda from municipalities, police and school boards just to appease me! For years there was no media in the Lamont County area, just leaching media from other areas covering events here only for advertising dollars and no vested interest. I don’t just advertise with The Leader to make sales but also to fend off competition from other businesses in the area and from other towns and cities in the area too. I know if I don’t advertise with The Leader, that my event will not be covered when it happens mostly because they don’t know about it, but also because I didn’t support them so why would I expect them to support me. The Leader is a local business, employing local people, donating to local charities, and involved with local causes. Tech giants do nothing for my family, my neighbours or my community. The Leader covers all of Lamont County. These are my friends and neighbours and we support one another. I try to buy all my printing from The Leader, or at least get a quote. They are honest and good to deal with. When I have a problem they look after it for me from printing to advertising. I budget a portion of my revenue to advertising with The Leader. It’s smart business to re-invest in promoting my business. I see other successful businesses advertising in The Leader. Great minds think alike!
We have yet to have a killing frost or the prolonged rain that accompanies the Jewish holiday in September. We haven’t had to worry about tough or damp grain. Roy has been running aeration fans to cool down grain that was registering 34 degrees on the thermometer. Again, touch wood, we haven’t had to unplug the combine or experience downtime because of some breakdown. It’s
also the first time in my recollection that I’ve been able to combine in shorts and a t-shirt from morning until quitting time. That said, we still have canola and oats to cut and combine so we haven’t broken out the bubbly
BY HAZEL ANAKA
Since Babas and Borshch ended for another year, it’s been a blur of activity around home. The combination of hot, dry weather and the fact the festival was a week later than normal meant plunging headfirst into harvest. Despite the fact that nothing had been swathed ahead of time, this so far, touch wood, has been one of the more relaxed harvests I can remember.
Farmers who have unwanted pesticides, old livestock or equine medications, or other chemicals can dispose of them at no charge during Cleanfarms collection event which takes place in Northern Alberta from Oct. 3 to 7.
There is also a disposal site in Viking at Nutrien Ag. Solutions which will accept the materials on Oct. 4.
Farmer chemicals & meds accepted for disposal
Dr. John Sunley, who has died peacefully in hospital aged 87 in Port Coquitlam, BC, was a husband, father, and grandfather who had a long medical career in Alberta, mainly at the Archer Memorial Hospital and Lamont Clinic in Lamont, Alberta.He was predeceased by his parents, Ellery and Janet Sunley, four brothers: Robert (Edna), Russell (Ellen), Purvis (Helen), and Keith Sunley, and two sisters: Belle (Fred) Butcher and
“Two things stand like stone, Kindness in another’s trouble, Courage in your own.”
Vegreville disposal site appears to be the closest, while some may want to transport their unwanted goods to the Leduc disposal site at Cargill Ag. Horizons site at 49532 Rage Rd. 262. on Oct. 7.
The waste will be accepted between 9a.m. to 4 p.m.
This is a common sight in Lamont County these days. A combine takes down the crops leaving behind stalks and a large trail of dust. The harvest is now in full swing throughout the County. Photo by Crystal Moren
HARVESTSEASON
6 - The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022
For farmers in the Beaver County area, the
In the Lamont County area, the materials can be taken to Hairy Hill to the Nutrien Ag. Solutions facility at the corner of Hwy. 29 and 45 on Thursday, Oct. 6.
Gwen (Edward) Elliott.John is survived by his wife of 63 years, Sheila Sunley (née Howie), son Sterling Sunley (Jodie), grandsons Euan and Austen Sunley, sister Jean (Garth) Strachan, brother Lyle (Gwen) Sunley and their families, and his special daughter Elizabeth (Richard) Baker and their sons Theron and Janus.John will be lovingly remembered by his family, friends, and the many men, women, and children whose lives he touched personally andHeprofessionally.wasboth a Gentle Man and a
JohnSUNLEY,Gordon
~ August 31, 2022
Gentleman, and the warmth, humility, generosity, and kindness he inacceptwouldhearing.ca),BCandChildren’shasadvance.announcedmemorialthisserviceinglifethroughoutdemonstratedhislongwillbehisendur-legacy.Whilenoformalisplannedattime,anyfuturewillbeinTheSunleyfamilysupportedtheHearingSpeechCentreof(www.childrens-whichgratefullyanydonationshismemory.
BY JOHN MATHER
Another disposal site is the Vegreville Cargill facility on Hwy 16 west which will accept materials on Oct. 5.
August 03, 1935
The portrait of Queen Elizabeth II is shrouded in a black wrap at the Lamont Hospital, Sept. 12. Portraits across the nation will have similar shrouds until the funeral is held next week.
“Notaid.only did the hospital benefit from our service but the community benefited from us too,” she said of the nurses who took part in the nursing school.
The
Four members of the Lamont Nursing School graduating class of 1965 gathered around the hospital's new logo unveiled at the Lamont Health Care Centre's 110th anniversary celebration on Sept. in the Morley Young Manor rotunda. L-R Andrea Varga, Gail Johnson, Sheila Vilcsak (Carter), and Leslie Photo:Whitehead.JanaSemeniuk nurse Elaine HlushakJana Semeniuk
Florence Nightingale Pledge.“Ithink it’s fitting to close this short history by reciting it to you,” she said. “They have been the guiding principles for all Lamont nurses.”
Retired
Hlushak said an important project taken on by early alumni member Florence Love, was to compile the biographies of each of the 594 graduates of the nursing school, recognizing their lifetime achievements.
Hlushak said the organization funded several things over the years including colour TVs for residents, bouquets of red roses gifted to each student upon graduation, gatherings at Elk Island Park, Christmas parties, and yearbooks in addition to funding higher education bursaries for graduates and direct descendants of graduates.“Morethan 17 bursaries (have been) awarded in the last 34 years,” said Hlushak. “It’s amazing that one organization with such limited funding has accomplished so much.”
Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 - 7 Saleterms: immediatelybecomestheresponsibilityofthepurchaser.Neithertheownerorauctionfirmareresponsibleforsafekeeping.warrantyorguaranteeastodescriptionorcondition.Notresponsibleforaccidentsonoroffproperty.OnceanitemissolditBuyersPremium.G.S.T.chargedwhereapplicable.Pleaseinspectallitemsbeforebidding.Allitemssellasis-where-iswithnoCashorChequew/BankReferenceifunknowntostaff.NoChargeCardsorDebit.FullSettlementdayofSale.No 1613599Street,Edmonton,AB.LicenseandBondedsince1974 AndruchowAuctionsLtd. (780)456-1210 www.andruchowauctions.com Yard Auction for James Marko Bruderheim Sat. September 24 10:00am | Viewing: Sale Morning Only. Location: 203003 Highway 45 being 1 Mile East of Bruderheim on Highway 45 @ 4 Way Stop by School. Watch for Posted Auction Sign on property. Plan to attend this sale brief & partial listing only. All items must be removed by Tuesday, Sept. 27/2022 5 P.M. , No Exceptions. Yard (Brief & Partial Listing): * 13 &14 H.P. Craftsman R. Mowers *Garden Seeder *Snapper 4 H.P. R. Tine Rototiller *24 Yard Machine Snowblower w/E. Start Approx. 7 H.P. *250 Gal. White Poly Water Tank *Various Garden Tools *3 Kids Bikes *6 Ton Come-A-Along *Gerry Cans *Tree Pruners *V.G. P&H Tools: Craftsman 800 Router & Table *Wood Clamps *Halogen Lights *Approx. 50 Plastic Posts *Fence Posts *Heavy Black Water Hose for Yard/Garden *10 Sq. New White Vinyl Siding *Kids Jeep As Is *Quant. of Shedded 1X4& 1X6 Maple & Oak Boards *Quant. of other Lumber * 2 Extension Ladders 14'-16' * 2 Lawn Sweeps* Lots of Grader Blades *Various Lengths of Steel Pipe *Old Tent Trailer *2 W. Trailer *Good 2 W. Trailer w/Box *Various Tires *Murray, Yard, Bolens R/Mowers, Parts *Tools Include Skil Saws *5 Orbital Sander & Others *Jig Saw *Delta 1 Belt & 5 Disc Sander *Rexon Chop Saw *Various Blue Water Drums *Elect. Hack Saw *Work Mates *Wood Chisels *Wood Clamps *Bolt Bins *Jackal *Shelving * Chains *1/2 Plate steel Cabinet *Scrap Iron Numerous Other Items, Etc. Antiques (Brief & Partial Listing): *Trip Hammer *J.D. Horse Breaking Plow *J.D. Harrow Cart *Various Horse Eveners *Washing Machine *Cream Separator* Cream Cans *Washboards *License Plates *Various Wooden Boxes *Nail Kegs *Lanterns *Tube Tester *Various Wooden & Steel Wheels * Grease Guns *Old Tools *Crocks *Swede & Crosscut Saws *Hand Seighs *Hand Sickles *(4) Yellow Skidoos (Not running *White World Sport Skidoo, Not Running *Large Grind Stone w/Green Stand *Small & Big Wooden Telephones *Crystal Radio *Various Pulleys *Kettles *Saw Mandrill Blades *Beer Kegs *Wooden Chairs *Lighting Rods *Old Stove Parts *Leg Vise *Drill Press & J.D.D. Wheel Wrench *Various Axes & Axe Heads *Draw Knives *Plow Shares *Black Smith Wall Mount Drill *Picture Frames *Cupboard & Hutch White *Metal Butter Churn *Well Pumps *Dippers *Copper & Alum. Boilers *Old Bottles *Kids Tobaggan & Sleds *Small C&W Shovels *Findlay C&W Heater *Round C& W. Heater *Findlay C&W Heater *Round C&W Heater *Plus Numerous Other Items Winter comingis…Get your changed!tires Locally Owned, Community Minded, Family Run Follow us on Facebook! 10% off for September!BOOKNOW!780-992-1449 11213-88 AVE., FT. SASK. Lamont School of Nursing Alumni Association disbanding after 91 years
BY JANA SEMENIUK
“The purpose of the association (was) to promote the unity and good feelings among the alumni and advance the interest of the profession of nursing,” she said.
Hlushak graduated from the Lamont nursing school class of 1969 and worked her entire nursing career in Lamont before retiring in 1997. After retirement, she continued to serve the community by teaching first
“Being a part of the community and helping it grow. I don’t think people realize it or think about it in that way.”
“The Love Book version 2.0 was completed with the assistance of Shirley Harold, Audrey Shultz, Fran Weber, Pat Kottke and Trudy Harrold,” said Hlushak. “This record of service of the 594 grads is staggering.”Meanwhile, Hlushak said that in July, all records of the Alumni Association were donated to the Alberta Provincial Archives, as well as some memorabilia donated to the Royal AlbertaHlushakMuseum.finished her speech by reciting the
“Everyone is well into their 70s. For the most part we are already active in other things in the community together.”During her speech at the Sept. 1 event, Hlushak explained that although the first graduate of the nursing school was in 1915, the alumni did not organize themselves until May 1931.
1
Retired Lamont nurse Elaine Hlushak discussed the many accomplishments of the Lamont Hospital School Alumni Association over its 91-year history while giving a speech at the Lamont Health Care Centre’s 110th anniversary celebration Sep. 1.
The Alumni Association voted at their June annual meeting to disband the organization as of June 2023 due to declining membership. The Lamont School of Nursing was closed in “We’ve1972.outlived our purpose,” Hlushak said in a later interview.
Photo
from a neighbour in 1924 when she was seven years“Theold.lady was a friend of my grandmother’s,” said Shaw. “She knew how much my mother loved growing things, so she gave her this Christmas Cactus.”
“My daughter moved to a smaller house and couldn’t keep the cactus, so she gave it back to me and it’s been here (at the Mundare Senior’s DropIn Centre) ever since,” said Shaw. “It’s been here about 10 years.”
4848
Elaine Shaw passed away at the age of 100 in 2017.Meanwhile, strict instructions sit near the plant that warn against watering, even though the thick branches appear dry and cracking.
“It likes to be root bound,” explained Shaw. “We only water it four times a year. It prefers to be kept dry and out of direct sunlight, although if it starts to look droopy,
NOTICE OF RCMP POLICING TOWN HALL FORUM
On September 21, 2022 at 7:00 p.m. the Fort Saskatchewan RCMP Detachment will be hosting a Policing Town Hall Forum to discuss crime, policing priorities and the police service within the town of Lamont and Lamont County. There will be a presentation displaying crime statistics, annual priorities and crime prevention initiatives. Discussion and questions to follow.
8 - The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 780-895-2780 LEADER THE LAMONT • Promote in 4 different publications for the price of 1! •Nearly 20,000 readers between print & online • BOGO! Book an ad (quarter page or larger) in Fall, and run a 2nd ad in your paper of choice either the week before or the week after FOR FREE!
Senior’s Club President Judy Shaw, 79, said her late mother, Elaine Shaw, received the treasured plant as a gift
The Forum will be held at the Lamont Recreation Centre Meeting Room, – 49th Street, Lamont Alberta. and refreshments provided.
Book of World Records does not have an official record for the oldest Christmas Cactus, several families around the world have shared online their own stories of heirloom Christmas Cactuses spanning upwards of 200 years old.
Coffee
At the age of 84, Elaine Shaw moved to a lodge and passed the cactus down to Judy who passed it to her own daughter Diana.
was given.
Shaw added that no one knows how old the cactus was at the time it
Children 3-7 years 5:30 - 6:15 pm New Dancers 8-88! 6:30 - 7:30 pm Experienced Dancers 7:30 - 8:30 pm $95 per 10 week session, no pre-reg required! LOTS OF FUN - NO PARTNER REQUIRED! BRING FLAT SHOES, WATER & TWO LEFT FEET! Linda Mills C.C.I 780.232.9704 CLOGGING CLASSES (American Folk Dancing) Lamont Arena Foyer Tuesdays starting on Sept 27, 2022 Christmas Cactus could be oldest resident at drop in centre A 100- year old Christmas Cactus has lived at the Mundare Senior's Drop-In Centre for the past 10 years. Photo: Jana Semeniuk
I’ll put a little water in it.”Shaw said she has given out several cuttings of the cactus over the years, adding that it still regularly blooms each Nov. and sheds its leaves revealing new ones.While the Guinness
The oldest thing at the Mundare Senior’s DropIn Centre is a Christmas Cactus sitting near a wall, just out of direct sunlight and approximately 100 years old.
BY JANA SEMENIUK
The Mundare station of Lamont County Emergency Service Department responded to this tractor trailer rollover on Highway 16 at Range Rd. 160, Sept. 11. Both the driver and passenger were able to self extricate with only minor injuries. The highway was shut down for several hours with traffic re-routed to a county road while the mess was cleaned up. Photo supplied
“We are going to buy groceries with this money (and) whatever we're short on that we
Zyla, said the perogy making activity went exactly as ersperogy-makingforbecausewere“Andto,”out“Everythingplanned.turnedthewaywewanteditshesaidsmiling.they(volunteers)happytocometheyknewitwasgoodcause.”Zylaaddedthatmorefundrais-arebeingplanned
and anyone wanting to help out can contact her at the Senior’s Centre.
Lamont County Food Bank receives $500 donation from Mundare Senior’s Centre
Food Bank Chair Jody Zachoda said the donation came at a great time.
The Lamont County Food Bank accepted a donation check for $500 from the Mundare Seniors’ Drop-In Centre on Sept. 7.
The donation came from a perogy making fundraiser the centre did in Aug. to raise funds for the food bank, resulting in 120 dozen perogies made by 22 volunteers.
don't get in donations,” she said. “So, you know, soup and soup crackers right now are things that we give out with every hamper and we're kind of short on, so I'll probably be buying a lot of soup. And the winter months are coming so soup is Treasurerimportant.”for the Senior’s Centre, Lois
The Senior’s Centre was spurned into action from an article read by Zyla in the Lamont Leader (Food Bank Feeling the Crunch of Inflation – July 27) where the food bank was asking for help.
The County of Lamont Food Bank received a $500 donation check from the Mundare Senior's Drop-In Centre Sept. 7. Front Row L-R: Gloria Balla, Jody Zachoda, Jody Conley, Sam Wasylenchuk, Lois Zyla, Judy Shaw. Second row LR: Bob Gratton, Joseph Prystash, Ugenia Panych, Marrien Chudyk, Gerry Hill.
BY JANA SEMENIUK
The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 - 9 Timed Online Auction for Dave and Pat Woodworth. PH-(780) 331-3436. Removal: Sept 20th–24th.9AM–5PM. No Exceptions. Preview: Sept 17th and 18th 1-7PM.Starts Closing Sept 19th. Register & view with Live Auction World. Directions: 3246 Lakeview Dr., Calling Lake. 59 Km North of Athabasca on Hwy 813, turn left on Calling Lake Dr. for 6 Km. Payment ON DAY ONLY Online or on sale site, Very Poor Internet. Please Bring CASH, Sept 20th, 9-5pm. Register online with Live Auction World. 5% Internet Fee OR View online with Global Auction Guide for more detailsUNRESERVEDTractor•2012 N Holland Boomer 3050, 50hp FWA tractor c/w FEL, 3pth, 2 hyd, PTO. Powershift. 1393hrs • Attachments • Ford 906 3 pt auger c/w bits • Quick tach trailer mover • Farm King 8' angle blade • pallet forks • Recreation • 2007 Club Car Precedent gas golf cart, VG • 2011 Polaris IQ 600 LXT 136" Track snowmobile, 1300km • 6x8' fish shack • Water dinghy’s and tubes • Vehicles and Trailers • 1994 GMC Sonoma club cab, 4 wd, A/T/C, recent work orders, 166,500 km • 14’ Alum. Fishing Boat c/w Trailer, 30 HP Johnson • 1979 Ford F 250 Super cab c/w canopy. 400 auto, needs brake work • 1977 Ford Cougar Brougham 2 dr., 351 auto • 2006 Titan 14'gooseneck 5th wheel dump trailer c/w ramps. used Approx 2000km • S/A 12' flat deck trailer • S/A 8' tilt deck trailer c/w 300gal poly water tank • Lawn and garden • Craftsman DLT 3000 42" 16.5hp Honda mower • Craftsman 10/30 snowblower • Honda 3000w inverter, only 20hrs use • Large Professional Gridle propane BBQ • Walk behind rototiller • Stihl weedeater • Stihl back pack blowers • Chain saws • Gas hedge trimmer • Simonize gas pres. washer • Karcher elec. Pres. washer • Kodiak 2" gas water pump • Gas plate tamper • Stihl gas powered cut off saw • Hotsy elec. steamer/washer • Pallets of landscape bricks • Chain link fencing • HD décor. 60"gate • Concrete eagle, rabbit + many more lawn orn. • Bear carving and fishing bear • Wooden water wheel • Wooden bridge • Bird baths • Wind mills • Flower cart • Mini wooden wheeled wagon • Tools and Misc.• Table saw, mitre saw, tile saw • Air tank • 2 sections of scaffolds • Styro insul. • Qty of scrap steel • Come-alongs • Fence stretcher • Large qty of fluids and sprays • Approx. 30-100amp new stab lock breakers • Deck screws • Oxy/acet. outfit c/w cart • Makita chop saw • Gear pullers • Grease guns • Herman nelson heater • Bolt bins • Sears 295 A/C welder • Magnaforce 5 hp 60-gal air comp. • Air tools • Clamps • Welding tables • Floor jack • ATV jack • 2 drill presses • Impacts • Drills • Grinders, Belt sander, Reciprocating saw • 2 sets of rubber ramps • Toyo pedal car • Hilti T 40 elec. jack hammer • 3/4" torque wrench • Mastercraft rolling toolbox c/w tools • Antique Champion spark plug cabinet • Air staplers • Elec. and air paint sprayers • rolling stands • pipe bender • booster packs • Rockwell rotary saw • Gun cases • Bostich air nailer • 2-2000#quad winches • 2 new 10x 16.5 tires • Bolt cutters • Louisville f/g ladders 8-12' • 6 new sheets of Lexan • Elec. wood splitter • Lots of new elec. supplies • 3 post drivers • 2 heavy duty wood tables • Tarps • & Much More Timed Online Auction for Marty and Doreen Derouin. Bids Close Sept 20th. Directions: From Redwater, 4 Miles South to Heartland Dr., 3 Miles West to RR 222 and ½ Mile South 56509 Preview: One Day, Sept 18th, 1-6 PM. Starts Closing Sept 20th. For Info PH-(780) 446-7520. Register & view with Live Auction World. 5% Internet Fee 2012 Ford F150 4x4, Very Clean • Older 14’ Holiday Trailer• Some Antiques • Tools • Lights • Neon Signs • Wood Shed • Glassware • China Cabinets • Wood Barrel • Recycle Bins • Lamps • Tables • Appliances • Pictures • Magazines • Yard Sprayer • 350 Lots • Preview is Recommended • View online with Global Auction Guide for more details Fall Machinery Consignment Auction Hwy #16 East, Alberta - Online Auctions Toll Free 1-855-783-0556 Allen B. Olson Auction Service Ltd. Rimbey Office - 403-843-2747 - Toll Free - 1-855-783-0556 Hwy #16 East Office - 780-208-2508 Rimbey & Hwy #16 East, Alberta - License No. 165690 Email: abolson@telusplanet.net - Website: www.allenolsonauction.com Selling equipment to all four Western provinces and the Northern USA. Listings are now being accepted for our Fall Machinery Consignment Auctions at our Hwy #16 East Locations H #16 E S Y O 28 N 1 Location: Hwy #16 & Rge Rd 185 (1 Mile East of Hwy 834) - South Side of the Road Phone: (780) 208-2508 Office Aaron Olson - (403) 913-9644 Norm Hill - (780) 903-6199 - Terry Skiftun (780) 632-1774 We are now accepting Listings for this Sale. Any items prelisted by September 28th will be included in our Sales Posters, Newspaper & Radio Advertising, Web Page, Social Media and extensive mailing lists. Whether you have one piece or a complete line of Machinery give Aaron a call at (403) 913-9644 or Allen at (403) 783-0556 to discuss the best option for you to realize top dollars.
and they have only grown about four to five feetThetall.”world’s tallest sunflower is in the Guinness Book of World Records as grown in
BY JANA SEMENIUK
because that’s where it gets the most sun,” he said.Orlando’s neighbours were equally surprised to see the enormous
flower.“They were flabbergasted,” he said. “I’ve got a neighbour who has about 20 of them planted
Lamont resident L.D. Orlando stands near his 12-foot sunflower. Jana Semeniuk
“I just wanted to see it. It was something to do,” heOthersaid. sunflower seeds planted at the same time and in the same area as the giant flower have amazingly only grown to between three and four feet.“I planted them there
10 - The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 • Shop floors • Garage floors • Patios • ConcreteSidewalksWork Hummingbird Landscaping and Concrete Ltd. Call Ernest 780-632-1792Rudy PAYING HIGHEST PRICES To arrange a free, discreet in-home visit call Kellie at 1-778-257-9019 WANTEDDEADORALIVE Bonded since 1967 Paying Cash For Coin Collections, Silver & Gold Coins, Royal Can. Mint Sets. Also Buying Gold Jewelry We purchase rolls, bags or boxes of silver coins are once again touring the area! Canadian Prairie Pickers $$ $ $$ $ September 16, 2022 Doreen Pickett of Lamont turns 85! H APPY B IRTHDAY ! MOM & GRANDMA With Love & Hugs from FabulousEnjoyKatelynSteve,Sandra,Garrett,&BraedenaYear! Orlando’s Giant Bloom - “It’s like Jack and the Beanstalk”
feet.“This thing is huge!” he stated emphatically. “It’s like Jack and the Beanstalk!”Orlando said he has never planted sunflower seeds before and wanted to see what would happen if he planted a few in his yard.
When Lamont resident L.D. Orlando, 82, planted a few sunflower seeds near his house this past June, he had no idea what would happen, and no way of knowing one of the sunflowers would grow beyond the roof of his home to more than 12
Germany by gardener Hans-Peter Schiffer who in 2015 grew a 30 foot and one inch sunflower.
Photo:
The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 - 11 EXTRA! ADVERTISE 41newspaperslowprice $15 per col. inch (further discounted at 1/4, 1/2, fp) Common Sizes 2x2 $60 2x3 $90 2x4 $120 1/8 pg $180 1/4 pg $280 1/2 pg $485 3/4 pg $650 Full page $725 Over 30 municipalities Covering 3 full counties Over 15,000 readers Over 340 years combined as the key news media in each region DEAL LEADER THE LAMONT Serving Lamont county Contact Us Today:
12 - The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 CONSTRUCTIONCUSTOMWORKBOOKKEEPINGCONCRETE EAVESTROUGHINGDAYCAREELECTRICAL PRINTERPAPERBRIGHTSTOCKLANDSCAPINGHOTELSOFFICESUPPLIESCARDSTOCKSOLDATTHELAMONTLEADERDID YOUTHATKNOW T HE L AMONT L WEEKLYNEWSPAPERFLIERSWILLINSERTYOUREADER&POSTERSINTOTHE? TOWNSTODISTRIBUTEINYOUCANCHOOSEWHICHINSIDETHENEWSPAPERITARRIVESRIGHT-NOTASJUNKMAILINTHEMAILBOX! STARTSATJUST 7 CENTSEACH ! 780.895.2780 I & M Tax and Bookkeeping Services Farms & Businesses ~ Excellent rates & bundled discounts 4703, 51 Lamont,StreetABT0B2R0 Phone:(780) 579-3883 Fax: (780) LmTaxServicesLamont@yahoo.com579-3884 Maria Stamati C BARHIPMAN&GRILL Call Us: 780-363-3822 HOT COLDCOOLFOODTUNESBEER CATERING Tom’s Catering Tom tomhcatering@gmail.comServingHrehoretsLamontArea780.918.7406tomscatering.ca CONSTRUCTIONWHITE’S located in Chipman KEVIN WHITE 780.991.2172COMMERCIAL&RESIDENTIALCONSTRUCTION , ICFBLACKBASEMENTS , SIDING , WINDOWS , DOORS , RENO ’ S , DRYWALL , INTERIORFINISHING , PAINTING , SHINGLES , METALROOF , CONCRETEWORK kjnwhite@mcsnet.ca~LANDSCAPING&YARDMAINTENANCE~CUSTOMBALING~TRENCHING~BOBCAT~DUMPTRUCK~CUSTOMMETALRENO’S~HANDYMANJOBS~BRUSHCUTTING~MOWINGTrevorMikolajczykWE HAVE THE PERSON FOR THE JOB ~ 24/7 780-975-8343 mk98ltd@gmail.com BM Services Local Family Owned ~Honest & R eliable Service - Snow Removal - 24/7 Roadside Assistance - Full Landscape Renovations - Lawncare: grass cutting, maintenance - Skidsteer Services - Pen & Barn Clean Up - Dump Trailer Hauling/ Deliveries - Towing, Boosting, Winching Services - Demolition/ Dump Runs - Water Hauling - Bucket Truck Services - Tree Cutting & Removal 780-603-9954ROADSIDEASSISTANCE bmservices01@outl ook.com SERVICEHOUR24 FREE ESTIMATESFREE ESTIMATES Roofing, Windows & Capping mtallas_05@hotmail.comMarvinTallas780-984-6742 RESIDENTIAL • COMMERCIAL • RURAL Specializing in Seamless Eavestrough Installation Alu-Rex Leaf Guards • Downpipe • Soffit & Fascia Gutter Cleaning & Repair • Roof Top Snow Removal PO BOX 546 LAMONT, AB T0B 2R0 Mike ( c e l l ) 7 8 0 - 4 9 9 - 3 7 7 9 SERVINGLOCALCUSTOMERSLOCALCOMPANY SUNSHINESERVICESEQUIPMENTINC. SNOW REMOVAL ROTOTILLINGSTUMPGRINDINGTREESERVICESLANDSCAPINGSERVICESFIREWOOD Residential •Commercial •Industrial Trenching services available qualitygroupinc@outlook.com780-910-9748 ENGRAVING ~ Laser Engraving ~ Awards ~ Customized Gifts7 8 0 7 1 9 0 5 9 7 imaginationengraving@yahoo.ca Main Street, Lamont DIRECTORYBUSINESS1”AD~$45/MONTH2”AD~$90/MONTH ADVERTISE TODAY. CALL 780.895.2780 OR EMAIL lmtleader@gmail.com ADVERTISE IN THE BUSINESS DIRECTORY FOR ONLY $90 PER780.895.2780MONTH!!
The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 - 13 MECHANICAL T i t a n R e p a i r S h o p Best Prices. Best CVIP780-579-4400ServicesTitanRepairShop@yahoo.comLicensed471551St.Lamont,AB. FOR ALL YOUR AUTOMOTIVE NEEDS 5003 - 50 Street, Mundare, AB 780-764-3936DeanBosvikJavan Vandelannoite Mon Fri 8am 5pm PLUMBING PROFESSIONALREALESTATEROOFING TRUCKINGTOWINGSEPTICMotor Vehicle Accidents, Fatal Accidents, Wills, & More Elizabeth J. Tatchyn, B.A., LL.B BARRISTER & SOLICITOR By appointment only at Smith Insurance Service, Main Street Lamont etatchyn@biamonte.com * Speaks Ukrainian * Edmonton: 780-425-5800 REGULAR 24/7 TOWING PLUS equipment, sheds, antique/classic vehicles, RVs, and more!! 780-998-7668 Don’t think Towing –Think Titan! J M P P l u m b i n g & H e a t i n g L t d . Furnace & Hot Water Tank Replacement Plumbing - New Home Construction Air Conditioning - Gas Fitting - Gas Fire Places Garage Heaters - Service & Repair - Sheet Metal J o h n P a n e k Boxjmpplumbing@live.ca780-999-206584,Lamont,ABT0B2R0 Area Sales Rep Lamont, AB.HrehoretsTom780.918.7406 Serving Lamont & Area Reflecting Life Well-Lived Serving Lamont and Area Since 1977 Wednesday 1:30 –5:00 pm by 780-895-2055AppointmentRonaldW.Poitras Barrister & Solicitor LEGAL ISSUES? Shannon Kowal Broker For all your real estate needs Office ~ 780-764-4007 Cell ~ 780-920-3076 www.kowalrealty.ca 5004 50MundareStreet, “THEYDONTCALLUSTHE BEST, FOR NOTHING” Elk Island Septic Cleaning.com (Div of Stadnick Contracting (2011) Ltd.) Is now available for septic cleaning Contact Brett : 587-991-0398 Servicing most of Lamont & Strathcona County Scott’s Septic 780-298-5480Service NEWSEPTICPUMPSINSTALLEDSEPTICTANKSCLEANEDSEPTICSYSTEMSDESIGNED&INSTALLED DIRECTORYBUSINESS1”AD~$45/MONTH2”AD~$90/MONTH ADVERTISE TODAY. CALL 780.895.2780 OR EMAIL lmtleader@gmail.com MONUMENTS Thank You for Supporting Local! LAWNCARE (780) jjsyardservices@gmail.com226-4772 FULLYFULLY INSUREDINSURED ~ BASEDIN LAMONT SERVING URBAN & RURAL NOW BOOKING FOR ~ FALLAERATION ~ FALLFERTILIZER ~ FLOWERBEDCLEANOUT ~ SODEDGING ~ EAVESTOUGHCLEANING~PRESSUREWASHING ~ EXTERIORWINDOWCLEANING~DUMPRUNS ~ TREETRIMMING & REMOVAL ~ STUMPGRINDING ~ BOBCATSERVICES ~ NOWBOOKINGFORSNOWREMOVAL NOW BOOKING A DDITIONAL S ERVICES F ALL C LEAN U PS SERVICESOFFEREDINCLUDE T HE L AMONT L EADEROFFERS P R I N T I N G & C U S T O M P R I N T I N G A T C O M P E T E T I V E P R I C I N G : fliers - event posters - business cards - customized stamps prescription pads - voting ballots and many other options GREATPRICESWITHOUTTHEDRIVE ! C ALL C RYSTAL 780.895.2780 lmtleader@gmail.com
HEALTH
Other medical conditions causing TROUBLE WALKING or DRESSING? The Disability Tax Credit allows for $3,000 yearly tax credit and $30,000 lump sum refund. Take advantage of this offer. Apply NOW; quickest refund Nationwide: Expert help.
ALBERTA FEED GRAIN:
Why suffer employment/licensing loss? Travel/business opportunities? Be embarrassed? Think: Criminal Pardon. US entry waiver. Record purge. File destruction. Free consultation. 1-800-3472540. www.pioneerwest.com.MemberPioneeryourMoney?credit?GETondmortgages.ca.866-405-1228getdone.considered.LENDER.PRIVATEwww.accesslegalmjf.com.MORTGAGEAllrealestatetypesNocreditchecksDealdirectwithlenderandquickapproval.Tollfree1-www.firstandsec-BACKONTRACK!BadBills?Unemployed?NeedWeLend!Ifyouownownhome-youqualify.AcceptanceCorp.BBB.1-877-987-1420.HummingbirdLandscape&ConcreteLTD,concretework-shopfloors,garagefloors,patios,sidewalks.CallErnestRudy780-632-1792Outsidestorageforcampingtrail-ersandmotorhomes.Limitedconcretepads,mostlygrassbases.ResidentialacreagebetweenLamont&Bruderheim.780-940-2984Roy'sHandymanServices.Flooring,Trimwork,basementfinishing,decks,fences,kitchencabinetinstallsandcarpentrywork.Call780-232-3097
SERVICES
2 bedroom mobile home with addition. Stove, fridge, washer and dryer. Close to Lamont. $1200/ month rent, $1200 damage deposit. No smoking of any kind, small pet allowed. Phone 780-721-9571. Now available.
Viking School Parent Council Annual General Meeting and General Meeting
FEED AND SEED
29 year old male with Down Syndrome. The candidate must have a minimum 5 years or more experience working with persons with disabilities. Apply to rickzen1986@gmail.com with resume, references, Mixedcertificates/checks.grainandpotato operation is hiring farm workers to grade and sort potatoes, equipment operators and Class 1 & 3 truck drivers, to begin early September. Located SouthWest of Smoky Lake. Email resumes to anchorffarms@gmail.com. Call 780.656.0507 for more information.
**CallService,Mikeshanes.stucco@gmail.com&DaveRVInc.Storage,Parts.ustoday!780-415-5015Orvisitourwebsite:www.mdrv.caLocatedjust11kmsnorthofTofieldonHighway834**
CRIMINALSERVICESRECORD?
Heated, Mixed, Tough, Light, Bugs, Spring Thrashed....Barley, Wheat, Oats, Peas, Flax, Canola. "On Farm Pickup". Westcan Feed & Grain 1-877-250-5252.FORRENT
One bedroom basement suite for rent available October 1st. $650 utilities included. Call or text 780-717-6783.
Wednesday, September 28 at 5:30 p.m. in the Home Ec room at the school
Full1-844-453-5372.HELPWANTEDtimelive-incaregiver
for a
KEY COMPOSITE IND., Dave Sheilds Estate, w/Guest Consignors ONLINE TIMED AUCTION. Starting Sept 22, 2022 @ 9AM, Closing Sept 27, 2022 @ 9 AM. Industrial Tool & Equip. Dispersal, Saddle Making Tools, Leather Sewing Machines, 2005 53' Dry Van, Flat Deck Trailers, Generators, AT Forklift, SUV & Trucks, ATV's, Lumber, Tools, Equipment & more.
HELP WANTED Class 1 Oilfield Driver. 3 years experience necessary. Fax resume, safety tickets, and CDA to: 780-662-3368 or email: rwwhlt@mcsnet.caFREETOGIVE AWAY Free floral three seater couch and chair in excellent condition. Located in Lamont. Call 780579-2523 if you are interested! REAL ESTATE 1/4 section farmland for sale. 130 acres currently cultivated, located close to the town of Mundare. Call 780-990-7361 for details
Classifieds Affordable Advertising with LEADER THE LAMONT 3 papers for the price of 1! The CLASSIFIEDADRATES $10.75+gst first 25 additional39¢wordseachword PICTURE BOLD $10.00 $5.00 LAMONT LEADER Ph. Email:780-895-2780lmtleader@gmail.com COMING EVENTS ANNOUNCEMENTSAUCTIONSCOMINGEVENTS FEED AND SEED FOR RENT FOR SALE FOR HELPHEALTHSALEWANTED HELP WANTED FREE TO GIVEAWAY REALSERVICESESTATE SERVICESTRAVELWANTED
Helen 780-888-6800TantonAUCTIONS
COMING EVENTS
in
Shane’s Stucco & Drywall Service Shane Hollar Stucco (Traditional & Acrylic), Drywall, Stone, Textured Ceilings, Tile and Spray Painting 780-3364832
14 - The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022
Professional Residential & Commercial cleaning. Over 20 years experience. Excellent references. I am in the Holden area. Call or text me 780-221-7744.tfnp
Buying Oats, Barley, Wheat, Canola, Peas, Screenings, Mixed Grains. Dry, Wet, Heated, or Spring Thresh. Prompt Payment. In House Trucks, In House Excreta Cleaning. Vac Rental. 1WE888-483-8789.BUYDAMAGED
Carpet and Upholstery cleaning - residential and commercial. Truck mount unit, sewer backup, and flood cleaning. Auto and RV Cleaning. Call John and Sheri at Fancy Shine Auto and Carpet Care at SNOWBIRDS!780-384-3087TRAVELWinter
REPLACEMENT.
Everyone welcome!
Office and paper supplies for sale at The Tofield Mercury, Weekly Review, Lamont Leader offices. If we don't have it, we can probably order it for you. Don't forget to ask about custom printing - we can do almost anything either in-house or working with our print shop.
Viking:7290
GET UP TO $50,000 from the Government of Canada. Do you or someone you know have any of these conditions: ADHD, Anxiety, Arthritis, Asthma, Cancer, COPD, Depression, Diabetes, Difficulty Walking, Fibromyalgia, Irritable Bowels, Overweight, Trouble Dressing...and Hundreds more. ALL Ages & Medical Conditions qualify. CALL THE BENEFITS PROGRAM 1-800-211-3550 or send a text message with Name and Mailing Address to 403-9803605 for your FREE benefits HIP/KNEEpackage.
FOR SALE
Chokecherries are ready! Garden Vegetable are here! Pickling Cucumbers, Beets, Potatoes, Carrots, Order your fall Potatoes now! Off Highway 13 Turn North on RR 122 go North for 3 Miles.
Fresh roasting chickens – range in weight from 6-10 lbs. Home grown-farm fresh. Call or text Val Quattek 587-256-5402. Available September 19.
Large, quiet, non-smoking 2 bedroom apartment in Killam. For viewing, call Chuck at 780-263-
Drywall Taping/Texturing 35+ Years. No Job too small Experienced drywall taper/texturer here to help you with any job big or small. Don't want to do it yourself, give me a call! Based in Killam but willing to travel Hand taper by trade but have experience with boxes, roller/flusher, taping tube. No bazooka exp. Have own tools (10-12" boxes, pump, angle box, roller, flusher, hand tools, etc.) Also do ceiling texture. Non- drinker, just want to work. Willing to work with existing taping crew. Call 780385- 2106 or 780-385-1251.
Penticton, BC. Special long stay rates through April 2023. Bachelor & 1 bedroom kitchen suites from $35/night! Utilities/cable included. 250-864-3521.worldRoyalcoinNumismatistcoins,nuggets,silverBUYERSGOLD,ity.com/snowbirds.488-0907ed.AprilWeekly/available&OSOYOOS,m/snowbirds.0907www.roadsidehospitality.co250-488-BC.Furnished1,23bedroombeachsidecondosnow!DiscountedMonthlyratesthrough2023.Utilities/cableinclud-Starting@$36/night250-www.roadsidehospital-WANTEDSILVER&PLATINUMpurchasingallgold&bullion,jewelry,coins,dust,scrap,pre-1968bulksilver,sterling+++purchasingentirecollections&accumulations,CanadianMintcoins,collections,old$$$.+++37p
Surprise come and go 80th birthday party for Frances Gotobed Sunday Sept 18 from 1PM-4PM at the Viking Legion (5427-50ST). No gifts please. (This ad is going to mysteriously disappear from her paper.)
WHITE SPRUCE TREES: 5’ average $50. Installation ONLY $19. Includes: hole augered, Wurzel Dip enzyme injection, bark mulch application, staking. Minimum order 20. One-time fuel charge: $125-175. Crystal Springs. 403-820-0961. Quality guaranteed.
Boston Terrier puppies for salelooking for their forever homes, in a fenced yard for safety. Non registered breeder for 30 years. 2 Vaccinations, dewormed, health guarantee. Sharon 780.365.2217
Sue's Cleaning Service
37p
Sunshine Villa Autumn Pie Social, Saturday, Sept 24, 2022 from 2:00 to 4:00 p.m. 5834 51st Street, Tofield. Admission $5. Pie, coffee, tea, etc! Silent Auction at the Social. All proceeds to the Residents Association Fund. Thank you for your support of Seniors!
ANNOUNCEMENTS
FOR SALE
GRAIN -
1-800-371-6963.www.montgomeryauctions.com;SeeCOMINGEVENTS
Special homes/ retirement special. Must sell due to health reasons. Pups and older dogs from top quality lines, American Cocker Spaniels and English Springer Spaniels available. Some over four years old. See them www.puppylovekennels.caat Phone 780-662-3196 or 780-662-0410 for an appointment. $500.00 and up. Serious calls only. These canines are NOT for breeding purposes.
The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022 - 15 780-449-5622 | www.hillrealty.canhill01@telus.net
• W4-18-54-18-NW, 2 parcel farm 158.48 acres 130 ± acres of grain cultivation 3 bedroom house. Property has gas, power, well, septic with aerial discharge, Dug out and a shop. Price: $850,000
• Range Road 203 between Highway 15 and TWP Rd 552, 6.77 acre lot near Bruderheim. Good building site. Price: $160,000
Lauren HillSteven HillNorman Hill
LAMONT COUNTY•
•$125,000W4-18-53-24-SW Plan 0826481 Block 2 Lot 1 5.02 acres yard site in Lamont County. Utilities at the property line. Price $49,000
TWO HILLS RECREATIONCOUNTYLAND on of for a building site. $325,000
the North Saskatchewan River. HWY 29 and RR 123 50± acres
• W4-20-55-27-SE Plan 1023701 Block 1 Lot 1A Lamont County. 138.09 acres in the Lamont Heartland for industrial use. Located North of Highway 15 on Range Road 202. Price: $4,400,000
• Office Building 5015 - 50 Street Chipman. 946 sq ft building with reception area, office area and washrooms. Price:
Modern 15,000 sq ShopftIndustrial built on 42.8 acres in Lamont County adjacent to town of Lamont. There is an approximately 15 acres of gravelled yard with partial chain link fencing located at 195043 HWY 29 Lamont County. Price: $3,175,000
• W4-12-55-27 NW 146 acres with 1/2-mile frontage
• W4-18-53-26-SE N ½ Lamont County 80 acres property with a 60‘ by 40’ shop and the remainder of the land currently in hay. Price: $235,000
cultivation power at property Nicely treed lot
Price:
COUNTY • SW Part of NW –23 –53 –23 –W4 40.55 acres North of Highway 16 on Range Road 232 in proposed medium industrial zoning with CP rail line at the border of the property. Price: $7,200,000 • Parts of SW and SE-7-53-22 W4 located at HWY 21 and Lakeland Drive 63.62 acres of development land with HWY 21 exposure. The property is within the Bremner and local Employment Area ACP with expected future use of industrial. Price: $6,000,000 • 0.82 acre Lot located in Griffin Industrial Park in Sherwood Park. Land use designation in medium industrial Price: $399,000
There were lots of kids clambering over the bouncy castle set up on the Lamont County office grounds Sept. 11 as the Friends of the Lamont Fire Department held their annual Heroes in the Sky event Sept. 11. The event with a variety of demonstrations raised $3,000. Below: Lamont County firefighters use specialized extraction tools to remove the back door of a pick up truck in a simulated rescue during the Heroes in the Sky Fundraiser event in Lamont, Sept. 11. HEROESINTHE SKYEVENT RAISES $3,000 FOR LAMONT FIRE DEPT.
STRATHCONA
be completed
Dry weather has impacted Alberta this year and trees may be showing symptoms of drought. See a tip sheet from Agricultural Services here: services/agricultural-resourcesdepartments/agricultural-lamontcounty.ca/
Alberta Seniors & has asked those to complete questionnaire or https://esdc-consultations.canada.ca/ageism-consultation should by September 30, and more information is as https://www.canada.ca/en/employment-social-development/corporate/seniors/forum/consultation-ageism.htmlbelow:LamontCounty'sassessor
Cleanfarms offers a collection program every three years for unwanted/obsolete pesticide and livestock medications. The next collection is scheduled for the Northern half of the province (north of Red Deer) & Peace region fall 2022.
Eligible materials:
See: british-columbiahttps://cleanfarms.ca/materials/unwanted-pesticides-animal-meds/#alberta-
Council and Committee of the Whole Meetings
Pesticides: old, obsolete, or otherwise unwanted pesticides (anything with a Pest Control Product Number on the label)
and Watering
share their stories related to consultation on ageism:
Lamont County joins cities and departments across Canada to honour and remember those who sacrificed their lives in service to their communities during Firefighter’s National Memorial Day (learn more: Septembernationalmemorialda.htmlthe_government_ofcanadaestablishesfirefighterssafety-canada/news/2017/08/canada.ca/en/public-).25is
Drought
Please Note – inFocus is also available for viewing online at: www.lamontcounty.ca/communications (for those wanting to view the weekly submission as full-sized PDF and to access hyperlinks)(forthosewantingtoview theweeklysubmissionasfull sizedPDFandtoaccesshyperlinks).
Responses
Alberta – North: October 3 to 7, with 20 single-day events. The next collection is scheduled for the Southern half of the province (south of Red Deer) fall 2024.
Preparation
(Accurate Assessment Group Ltd.), is starting inspections during September and into early October on the west side of Lamont (Township/Ranges:County55-20, 56-20, 57-20 & 53-19 to He57-19).(Kris)will be driving a white GMC truck with Lamont County branding.
Place – All items need to be placed in a sealable or spill-proof container. Return – Check to find when this program is taking place in your area then return items to your local collection site
Police & Peace Officers’ Nat.
Housing - Community Partnerships and Programs
16 - The Lamont Leader (Lamont, Alberta), Wednesday, September 14, 2022
interested
an online
The next Regular Council Meeting is on Tuesday, September 27, starting at 9 a.m. The public is welcome to attend at the Lamont County Administration Building or virtually through Microsoft Teams (link): lamontcounty.ca/governance/agendas-minutes. Mask wearing is at personal discretion. If you would like to speak or present at a meeting, please contact Legislative Services
Animal health medications (anything with a Drug Identification Number on the label).
FCSS Call for Volunteers Rail Safety Week Proclaimed Assessment Inspections
Memorial Day
Unwanted Pesticide and Livestock Medication Collectionon
Lamont County has proclaimed September 19-25, 2022 as Rail Safety -safety-week-2022-sept-19-25lamontcounty.ca/news/post/railWeek.
Police and Peace Officers’ National Memorial Day to honour and remember those who sacrificed their lives in service to their communities. (Learn more: 1.htmllois.justice.gc.ca/eng/regulations/SI-98-97/page-https://laws-.)
Firefighters’ National Memorial Day – Sept. 11g y p
Ageism Consultation Request – Complete by September 30
GatherSteps:– Collect your unwanted agricultural pesticides and obsolete animal health medications.