Skip to main content

Brilliant-online-magazine-August-2022

Page 1

2022AUGUST INSIDE: August is about experts in their fields and TG's Children are definitely experts at Playing is Learning for Life. Let's take a look at the rest of the experts inside.➸ Experts in their Fields IssueThe ➸ Harper is a great assistant to Kerrie Whiteman Photo: Jo Lyons Photography Read The Pack Leader

Haru Hana is launching the "happy moments" OZKIZ Korean kids wear. SHOP NOW

With Father’s Day just around the corner in Australia (September 5th for those who may have forgotten!) we turn our focus and pay our respects to all the wonderful dads out there, placing them firmly in the spotlight on their special day! Dad’s role in the family dynamic is, of course, integral to providing a sense of safety and security, a grounding point and sound moral compass. Fathers, as with mothers, are role models to their children and carry a huge responsibility as to how their children see and make sense of the world, while promoting the growth of self-worth, love, tenderness, humour, compassion and strength. A father’s impact on the lives of his children is, undoubtedly, profound. However, the traditional definition of fatherhood has changed dramatically in recent years and we take a deeper dive into this to look how changing attitudes and broader acceptance in society has reshaped the role of the patriarch. We also catch up with local dad Jacob Young, founder of Dinki Co, who shares his joy at society embracing inclusivity and celebrating each other's differences instead of fearing them. It’s also National Dog Day Down Under this month and we’re not forgetting our furry companions as we have ✦ Welcome to August’s edition of Brilliant-Online. several Brilliant stories paying tribute to men’s best friend. Elsewhere, we catch up with five local fantastic creative experts who showcase their wonderful skills as part of the Wauchope Creative Hub and also look forward to the return of Motofest to the Wauchope Showground after several years absence due to COVID-19. While on that topic, we take a holistic view on where we are at in the world right now with the pandemic and how it continues to shape our lives.

FOLLOW US Brilliant@AdBrilliant@BrilliantOnlineInternational@brilliantonlineinternationalOnlineMagazine CONTACT US NSWP.O.brilliant-online.comeditor@brilliant-online.comBox9339,PortMacquarie,2444,Australia ADVERTISING ENQUIRIES HQ Australia +61 412 137 621 Singapore +65 96 817 045 North America +1 (647) 239 3231 Subscribe to Brilliant ➹ Ben Tirebuck ✦ Contact Chrissy ✦ +61 412 137 chrissyjones@brilliant-online.com621Brilliant-online.com Advertise brilliantly in focusingSeptemberonMade in Australia Products and Services Request Ad Package

There is so much more to get stuck into and we genuinely hope you enjoy each and every one of this month’s Brilliant stories.

ABOUT BRILLIANT Brilliant-Online makes people and businesses famous. It is an empowering read for progressive individuals and dynamic businesses pushing for a better world in the digital era. Born witty, Brilliant unveils an online magazine featuring a variety of digital interactive content that makes it similar to the magical Daily Prophet newspaper from Harry Potter.

3EDITOR'S NOTE NOTE FROM OUR EDITOR

4 6 42 1 ➸IN THIS ISSUE Children are play experts Are you in a stalemate with your accountant? The run into spring is on Prestige Electrical Data Services Making Homes Smarter on the Mid North Coast 4 problems with cashflow Hard-to-find Antiques and Collectibles David Lazarus, aka Tom "Cruise Director" of the Rhythmboat, invites you to party Meet the Stars! They're shining Brilliantly! Safeguard Your Car’s Painted Surfaces with Paint Protection Film Your Local Radio Experts John O’Callaghan and Nik James They’re back! The 2022 Wauchope and Hinterland Business Awards Brilliant NATIONAL DOG MONTH 8 12 14 18 20 22 26 30 33 34 38 Harper is a great assistant to Kerrie Whiteman Ozkiz "knee bang" From Haru Hana Note from our editor 1 2 3 Listen to a Rare Earth Story from Mount Ridley Mines Limited Venture(ASX:MRD)Minerals Limited is Getting Closer to the Julimar look-alike Noel Ong, CEO of Samso on how he creates compelling ASX stories Brilliant made in Australia Give a Dog a Job Vera is Dogtor-on-Call Men's Best Friends strike a pose with Jo Lyons Brilliant INVESTMENT Brilliant BUSINESS 50 52 54 56 44 45 46 48

5 102 94 Brilliant HEALTH 66 88 60 Save the date - Motofest is back Blues night at Kundabung with Simon Kinny-Lewis Fab 5 creative experts New Band Alert…Group Therapy Seeing the Hungry Ghosts Festival in a different light What's on in August & September 2022 on the Mid North Coast 68 72 74 77 78 82 The Aussie making history in Muay Thai The Woof-derful World of Dogs in Sport! AURORA Light Show dazzled visitors! Spot the SS Marloo Shipwreck The Tale of Modern Day Fatherhood Two wonderful children and another on the way! A Look at a Book Where’s the world at with COVID-19 right now? disAbility Maternity Care on collaborative care with the ‘experts’ Brilliant COMMUNITY Brilliant FATHER'S DAY Brilliant SPORTS Brilliant TRAVEL 90 92 104 106 96 98 100 62 64 AUGUST 2022

6 Experts in the field David Storok PRESTIGE Electrical & Data Services ➸

7 ✦ ✴ BUSINESSES Brilliant BRILLIANT BUSINESS

✦

PRESTIGE ELECTRICAL DATA SERVICES MAKING HOMES SMARTER ON THE MID NORTH COAST "Homes are taking on an intelligence of their own", David Storok, PRESTIGE Electrical & Data Services. So how does one go about having a Smart Home? Ask David Storok and his team. They are Smart Home Automation Experts. With 18 years of experience in electrical and structured data cabling, these highly qualified professionals are at the top of their game when it comes to Smart Homes. Smart Home automatic systems monitor and/or control home attributes such as lighting, climate, entertainment systems, and appliances. It may also include home security such as access control and alarm PRESTIGEsystems.

Electrical Data Services are a PIXIE accredited SMART HOME AUTOMATION installer. PIXIE devices, distributed by SAL, are a versatile and affordable range of digital switches, dimmers and LED strips that are designed for easy installation by an electrician and simple operation by the consumer.

SMART HOMES ➹ Electrical Data Services

k Experts in the field

DAVID STOROK PRESTIGE

3. Convenience Schedule everything. Automating your home can bring peace of mind and enhance your living.

4. Control ‘Talk’ to your house, from anywhere, with any device and you can even choose from four popular voice assistants which best suit you. Simple and Smart PIXIE uses Bluetooth® Mesh so you can enjoy the simple convenience of a connected home. This complete suite of Bluetooth Mesh smart home products allows them to ‘talk’ to each other without any extra wiring or Internet / Wi-Fi connection needed.

BRILLIANT BUSINESSES

The PIXIE system is made in Australia and built to work perfectly with Australian wiring practices. It is compatible with the widest range of wall plates so you can simply swap your existing light switches for PIXIE smart ones. With Bluetooth® wireless technology, your home can be made Smart. You can create schedules, timers, scenes and more to customize your smart home to the way you want to live. Why not pause for a moment now and imagine what your home would look like when it becomes Smart? It’ll probably make you want to go home right now and enjoy your Smart living space!

9 prestigeelectrical.com.au ➹

Benefits of a Smart Home Remember these 4 Cs when you´re thinking about converting to a Smart Home.

1. Cost Smart Homes allow you to control how much energy you spend. This means cutting on unnecessary expenses and even environmentally-friendlybeingwith a more efficient use of energy.

2. Comfort You can get your home ready to receive you or your guests in the exact condition you want it to be. You can personalise your Smart Home to what comfort means for each person.

Smart technology helps everyday life➸

CHILDREN ARE PLAY EXPERTS

✦ Playing is Learning for Life at TG's Child Care

TG'S CHILD CARE

“When children pretend, they’re using their imaginations to move beyond the bounds of reality. A stick can be a magic wand. A sock can be a puppet. A small child can be a superhero.” – Fred Rogers v Child's play takes on a whole new meaning at TG's Child Care. TG's children develop independent and creative minds through playing. It's how they learn to engage in collective thinking with their peers and build relationships with each Throughother.exploring, the children identify their strengths and discover their own unique gifts. in the field

k Experts

TG's Educators are always on hand to guide them and together, the children pick up new knowledge which really sticks in the brain because they did it themselves! It's not about 'feeding' random, irrelevant, meaningless information to children. TG's Educators plan activities that are relevant to their interests, experiences and backgrounds and take into account the unique learning journey of each child.

Children are naturally curious. At TG's, the children are encouraged to explore and ask questions. They are given the space to simply wonder why something works the way it does, and through their own exploration they come to their own conclusions.

TG's outdoor areas have plenty of space for the children to engage in different physical games and you'll always hear tons of laughter and squeals!

• Build motor skills

TG's Play Experts love being outdoors and getting a good dose of exercise in their strong little bodies. They're always up for a game and if it involves quite a bit of running, jumping, tunnelling, crawling and rolling, they're in!

11BRILLIANT BUSINESSES Why play? Play is trusting the brain to do what it does best i.e. learn. Take a look at a typical day in the life of a TG's Play Expert, and you may find yourself asking if there's an adult version of TG's that you can sign up for! Here are six reasons why playing is simply the best way to learn.

• Build confidence There is something incredibly empowering about seeing a child play. Their total trust in their make believe and pretend world allows them to fully explore their gifts. When you play and let your imagination lead, nothing is impossible. A child's world is wonderfully rich, and in their world of play and imagination, they can be anything and anyone. Nothing is holding them back. What a wonderful way to build confidence, trust and selfesteem!

• Build life skills Pretend play is a way children 'play out' what they see in the world around them. It's how they are making sense of the world. It's their way of trying out 'roles' to see how it would feel and it helps them to get into the shoes of another person and imagine what they would do, say or behave. It's also how they interact with their peers and learn to negotiate, share, feel empathy for, figuring out what works and what doesn't.

• Build respect At TG's Urangan, the children go on a beach kindy every fortnight as part of their Reconciliation Action Plan (RAP). This is something the children really look forward to! Getting out into nature and just smelling the sea, feeling the soft warm sand sink below their feet... it's an environment absolutely primed for Thislearning.iswhen indigenous wisdom is shared, and something TG's Play Experts have learnt is that wherever they go, they leave only gentle footprints behind. They respect the environment and land they walk on, and make sure they take real good care of it and not leave anything behind that does not belong there.

TG's Play Experts get stronger and healthier each day when they engage in outdoor games that also foster team work and team spirit.

A lot of it has to do with what different people do in their communities, and TG's has always enjoyed either inviting

• Build curiosity

12 the local firemen over with their exciting big trucks or taking the children out and getting to know their friendly grocer in the area. It builds a sense of community and appreciation. • Build creativity Beyond some basic rules of keeping things fair and everyone safe, there are really no other rules when it comes to playing. There is no right or wrong answer or way to do it. It fully allows children to be as creative as they like, and TG's Educators observe closely how each child responds to play, what their preferences are, how they like to work, how they problem solve, what gifts they are unconsciously developing. Children learn best when the process brings joy. TG's Educators and families always celebrate their creativity milestones. At the end of the year on Graduation Day, the children present a portfolio of what they have created to their families and there is so much pride when one looks at how much each child has grown and developed. At TG's, every child is celebrated!

Educators play too! Did you know that TG's Educators love to play too? It's one of the defining characteristics of an Educator in the TG's Family! That's what makes them so much fun to be around. They fully understand what it's like to be a child, and they know what children need. When TG's Educators are not engaged in play with the children, they are also equally fun-loving when they are in their teams. What are your superpowers?➸

✦ Do you get past June 30, and spend the duration of July waiting patiently for your accountant to send through their annual checklist (like it’s tax homework)? Do you ever stop and think that your accountant is actually sitting at their desk, waiting for YOU to instruct THEM?

k Experts in the field LIZ JARVIS Better Business Decisions

• I hate to break it to you: your tax return is not a gift for your accountant. (“Yay, you got me a shoebox of receipts… again.”) Not only that, this is the annual tax return for YOUR business. This isn’t a chore - it’s a fantastic opportunity to dive deep into your numbers and measure your success, inspect your losses, and look for opportunities in the coming year. It should be a time to get curious about the inner workings of your enterprise; to take a pause from the daily doing and check in on your finances.

Bring this attitude to your next meeting with your accountant and watch the energy in the room light up!

Language is critical with this onedo you find yourself saying things like: • I have to reconcile *insert software here* for my accountant

When it comes to tax, we have so much a** about in the business game (#sorrynotsorry). And I see so many business owners miss valuable opportunities to both maximise and minimise their tax, all because they see it as a Christmas present they owe their accountant. If you feel like EOFY is more of a mid-year get-together you’d rather skip out on, here are 3 things I need you to know to radically changeand improve - your approach to ‘tax time’. Who is this all for?

ARE YOU IN A STALEMATE WITH YOUR ACCOUNTANT?

• I have to get all my receipts together for my accountant • I have to submit my Q4 BAS so I can finalise everything for my accountant.

Disclaimer: These are yuck and boring but unfortunately a legal requirement for professionals in my industry. So just a reminder, the information contained here is general in nature and you should seek financial and business advice tailored to your own personal circumstances. Which, by no small coincidence, I can help you out with. Head over to my website and book a free 30 minute chat with me: betterbusinessdecisions.com.au ➹

Indulge in some business self-care➸

Realign with your vision. Map out the coming years. Clarify what’s really important, and ensure your tax plan supports that goal. (Because believe it or not, it can!) Final thoughts In my perfect financial world, submitting your tax return as a business owner would be a simple task - because all your numbers would already be in order. You would be striding confidently towards your goals, having full knowledge of your finances, as the systems would be there to keep everything categorised and clear ongoing. The ATO would just get the card in the Ifmail.this sounds too good to be true, I’d invite you to have a FREE 30 minute chat with me. My zone of genius is connecting all the dots above to make ‘going over the numbers’ a time of joy in your business. Where we remember what’s important, and set the intention for the months and years ahead. I’m kinda like Mrs Claus, but for Tax. And when you work with me, finances get a lot more festive.

15

Stop putting the ATO first Many business owners see tax time as being like a really crap Christmas. It’s that magical time of year when we show the Tax Office everything we’ve achieved in the last 12 months, and they tell us if we’ve given them enough of the pie, or if we owe them some Ifmore.thisis how you think about Tax, you are missing the point BIG TIME. For starters, there is no ‘tax time’ (that’s right, crap Christmas just got cancelled. You’re welcome). Tax strategy should be a component of your ongoing financial strategy. It should be showing up in your regular check-ins with your numbers throughout the year, as there are opportunities to minimise tax liability across the calendar. So don’t spend another year realising you did too little, too late. Make it all about you You have my permission to indulge in some business self-care this time of year and make it all about you. Seriously. Your accountant is there to ensure you are compliant with the ATO requirements relating to your business. But they shouldn’t be driving this project - YOU SHOULD. This annual milestone is your reminder to look at the big picture in where your business has been, as well as where it should be heading.

BRILLIANT BUSINESSES

Greenbourne Nursery k Experts in the field

Daniel "Chook" Fowler sitting down on the job!➸ 'CHOOK' FOWLER

Having a range of different plant and horticultural specialists on the nursery really allows us to provide detailed information to our customers on most of the issues. We all know each other’s strengths and are able to bounce questions and thoughts off each Finally,other.and I do mention it quite a lot, however we wouldn’t be as good as we are here if it wasn’t for our customers. Honestly, we learn all the time from their results and experiences. That is why horticulture is so dynamic, you will always continue to learn and improve your knowledge, be it from books, experiences or people.

DANIEL

THE RUN INTO SPRING IS ON ✦ The noise on the nursery. Another Garden chat with Chook, from Greenbourne Nursery. August is the month that leads us into that fantastic warmer weather that sees the nursery fill with both quality stock and quality people. As we prepare for the increased volume of traffic through the yard, it is reassuring to know that we have a strong team of experts here that have a great diversity of knowledge that stems from a wealth of different experiences and interests.

There have been some professional breeding programs in operation to make an amazing range of Leucadendrons available. While the flower form on its own is spectacular we now have the added benefit of spectacular foliage displays when the flowers are unavailable. The variety ‘Jolly

Jolly Joker will flower heavily from early Autumn right through into Winter. The flowers that are produced are great long term cut flowers that hold well in a vase and also dry very well. They are a favourite with florists everywhere. As mentioned, during the periods when the flowers are not available the variegated foliage of the plant will stand out in any garden bed. So, if you have a nice sunny spot in a garden bed with good drainage grab a Jolly Joker at your local nursery today. ‘Jolly Joker Leucadendron’ (Leucadendron laureolum x salignum)➸

17BRILLIANT BUSINESSES

Likemetres.most plants in the Proteaceae family it is a very efficient user of water and is classed as a low water user. It does really well in those low maintenance garden beds where there is good drainage. Over the recent wet Autumn period that we experienced here on Australia’s east coast we noticed that the plants that were situated on raised and sloped beds did exceptionally well. These plants thrive in warm, full sun environments.

Ornamental salignum)(Leucadendron‘JollyRecommendation…PlantJokerLeucadendron’laureolumx

Joker’ will grow to approximately 2 metres with a width of about 1.5

18 Culinary ‘KaffirRecommendation…HerbLime’(Citrushystrix)

The Kaffir lime can be fertilised slightly different to other citrus. While the Kaffir lime does produce fruit, it is best to encourage extra foliage development by feeding the plant high nitrogen fertilisers. The Kaffir lime will grow up to approximately 4 meters in the ground. It also does really well in a pot with a good durable potting mix. It has become a very popular plant that is normally available all year round in good nurseries.

The kaffir lime has now become a staple in most herb gardens, particularly for those people who love the interesting flavours that the Asian style meals deliver. The large, glossy, double lobed leaves are used to impart a delicious flavour into meals. Like all citrus plants they will grow best in full sun. They thrive in rich, fertile soils with good drainage. Citrus plants are very hungry and do best when regularly fertilised over the warmer months.

As a kid I remember the only herbs in Nan’s garden were parsley and more parsley. Gone are the days of our simple Australian diets of meat and three veg every night of the week. Don’t get me wrong, I have great memories of and still yearn for those meals for comfort, however we now have developed such a diverse cuisine that we are spoilt for choice. And with that choice comes a whole host of different spices and herbs that need to be available to create these meals.

‘Kaffir Lime’ (Citrus hystrix)➸

‘Kalamata Olive’ (Olea europaea)➸

19 Fruit ‘Kalamatarecommendation…treeOlive’(Oleaeuropaea)

BRILLIANT BUSINESSES

The Kalamata variety is a very popular variety used all over the world. It is dominantly used as a black olive and used for pickling rather than oil extraction. This is why it is such a good variety for the home gardener as extracting oil from the olives can be quite a process for the novice, whereas pickling olives is an uncomplicated job.

Olive trees are beautiful specimen trees in gardens. Their beautiful grey foliage and strong trunks give them majestic character. They will grow in places where other trees will fail and will thrive on neglect. A fact that not all people are aware of is that all olive trees produce both green and black fruit. The green fruit is immature, whereas the black olives are at full ripeness.

The Kalamata trees produce a nice large olive that is quite plump and fleshy with only a moderate seed in the centre. Olive trees grow great in well drained soils that don’t get heavy with water. They grow exceptionally well on heavily sloped areas where the excess water can run off. There aren’t many pests and diseases that will really bother your olive tree, meaning you will be the main beneficiary of the wonderful fruit it will produce for you. The pickling process becomes quite a simple task when you get into regular habits, and the harvest from just one mature tree will be more than enough for a small family. A tree every garden should have.

k Experts in the field

✦ Cashflow is the lifeblood of your business.

3. Arteriosclerosis Where are the blockages? Are the people who owe me money paying too slowly? If so, why? 4.Too many white cells If I’m selling products then I need inventory. But am I overstocked? I worked with one business which had purchased at least 4 years’ worth of stock because the purchasing officer A sale isn’t completed until payment has been made. j had been told the wholesalers were going to increase their prices. These are just some of the areas businesses can look at to improve their cash flow. How to start? I am offering a no obligation one hour complimentary consultation* to 4 businesses this month to look at ways to improve their cash flow* As always the advice in this article is general and you should seek advice from a professional advisor on your circumstances.

Can you improve your margins? If you discount your prices, what effect is that having on your margins? How much more do you have to sell to get the same profit? Can you collect the money owing to you sooner? Are you invoicing promptly? Are your terms of trade clear? Are there other products or services you can add? “Do you want fries with that?”

Professionals 4

JOHN CLARKE Succes Tax PROBLEMS WITH CASHFLOW

Turnover Is Vanity, Profit Is Sanity but Cash Flow Is Reality ➹ john.clarke@stptax.com

* Valued at $250.00

1. Not enough red blood cells Red blood cells are the cash coming into the business from profitable sales. 2. Haemorrhaging Am I paying the people I owe money to earlier than I need to? Am I paying cash for equipment that I should be financing over its expected period of use? Have I got the structure of my business right?

"I have the largest range of boom boxes, pedal cars. suitcases. I just purchased a huge range of camerasThere's no antique shop that has the range of records and stereos that I have. I think my art glass collection is one of the best in NSW.“

An expert in the antiques and collectibles industry When you learn to take an interest in everything and not just the things that you're interested in, know a little about everything and not just everything about one thing, Darius would consider you an expert in antiques and collectibles. “If you want to open a clock shop, become an expert in clocks. Then you will be the best in your field. If you want to be an expert in antiques and collectibles, broaden your knowledge about everything.”

DARIUS WITECKI Port Pickers

✦ Port Pickers have lots that you won’t find in any other antique store. There is a huge range encompassing just about everything.

Proprietor Darius Witecki says he could rattle off 100 items he has that no other antique shop has in this area.

HARD-TO-FIND ANTIQUES AND COLLECTIBLES

His father was an avid collector with an eye for Franklin Mint items. Growing up in Melbourne surrounded by antiques and collectibles stores, Darius was born to be a part of the field. But he admits he has a love for one type of collectible, watches. For his 14th birthday he was given an Omega Seamaster and on his 16th birthday, an Omega Speedmaster watch. He told us, "Number one, I don't believe any shop has a taxidermy rooster, a signed Chuck Norris picture, I don't believe anyone has a massive range of Diana Lady lamps. I would wager, no-one has a collection of pocket knives like we do here." in the field

j k Experts

BRILLIANT BUSINESSES

23

Now, the Omega Speedmaster is the most popular Omega watch ever made and the most desirable to the collector today. Even as a child it seems Darius had an eye for items that were future collectibles. “I knew the speedmaster was going to be a collectible," he says. "It was the first watch worn on the moon, it was the only watch that passed all of the rigorous testing to meet NASA’s standards of a watch to be worn on the moon. So I knew back then it was going to be collectible. I have bought and sold hundreds of Omega Speedmasters. And still today it is one of my favourite watches. That and the Rolex Daytona.”

j

This love of watches has evolved into a love and passion for everything in the antique and collectibles industry.

Around 15-20 years ago when Atari, Nintendo and Sega were no longer interesting, Op shops were selling them for as little as $10 - now, you can expect to pay $50 just for a controller. Darius was buying a complete set and 20 games for $10 or so and says he could find them left on the curb side outside houses in their original boxes. Today, these sets are worth $500 or above.

Collectibles… what are they? Something that is not common and is sought after, not all collectibles are worth money. People often collect purely for their own enjoyment and the good memories it brings them. “A lot of our customers collect what they grew up with as children,” comments Darius. When is a collectible not collectible? When it is no longer interesting to people. “An example of this would be a phone card," Darius explained. "People went nuts over them at one stage, now you can't even give them away. What is a phone card you say? It was like a prepaid card to make phone calls. People would go from phone booth to phone booth looking for cards, they were quite expensive back then.”

Sought after collectibles➸ Some toys are collectibles➸

“Cassette tapes are something I got into not long ago, buying them for 50 cents each about 5 years ago, even up until 3 years ago. I just sold a set of 8 AC/DC cassettes for $300.00.”

Another thing he was buying years ago was records, often paying just a dollar each for them! He stock piled them. Good move, now they are worth hundreds. Very collectible.

Moving forward, Darius believes items that are in mint condition, items with paperwork and in their original box will be a good investment for the future. Over the years where antiques have started to soften, its counterpart that has no packaging and that is well used, is going down in value compared to what it was years ago.

In the antiques world there is much to learn and plenty of invaluable advice to be shared withthe new generation of collectors Unless you are collecting what you are passionate about, do your research on what you buy and invest in. Look at trends. The problem is past history prices are hard to find to research trends if you haven't been watching the market. Darius told us, “I would recommend connecting with knowledgeable people to find more information. Buy from experienced collectors, even if you pay a little bit more for the item, the knowledge you get from these people is priceless. Collectors are going to have the mint items also.“

Sought after collectibles - are they a investment?good

High end glass is in high demand at Port Pickers➸ Some antiques belong in a museum➸

Military memorabilia, swords, coins and high-end art glass are in high demand at Port Pickers. Generally, Darius says collectibles aren’t a good investment to the novice collector, unless they are advised by an expert.

24

“ I find the hard-core collector wants everything in mint condition, unpainted, unrestored. If you want a collectible that is a good investment, put your money into something that is popular or trending and find a specimen that is in the best condition with original packaging, or an antique or two that are in really good condition. Our antiques and collectibles that are in average to poor condition are dropping in value, the counterpart is increasing in value."

Advice and appraisals

25 Darius is an investor. An investor in antiques and collectibles. He looks for items that he thinks belong in a museum. Another tip he gave us is to google items. “You will notice the rare items won't have a lot of information available," he explains. "Research forums, reviews, these are a good source of knowledge. Don’t get caught up in product sales pitches. Moorcroft - it plummeted to almost nothing and it is hot again. Watch the trends and buy when items are priced low."

Port Pickers offer advice and appraisals free on any items that are brought into their store. Darius does prefer people to make a booking with him to enable him to allocate the time to spend in the consult. If it is a special piece, he is more than happy to be available even after hours. Collectible SpotlightIndigenous Artefacts Currently Port Pickers have two indigenous artefacts, Wunda Shields, that they are preparing to deliver to a high end Brisbane gallery. The history however is incomplete, but will be restored by a recognised indigenous artist. “We personally deliver high end items anywhere in the country to ensure the item arrives safe and sound, and as described. In most circumstances where the value of the item is considerably high, the client prefers it to be personally delivered. “ Kim Ackerman, a leading Australian anthropologist, explains that shields are found within the West Australian region bounded by the Gascoyne and Murchison rivers. “ Wunda shields appear to have been traded into other areas, some moving as far as Ooldea in the south of Australia and have also been recorded in the south and east of the Kimberley. There are references to the Walmajarri and Nyikina peoples describing that the zigzags represent different river systems with the angles representing major changes in direction that these rivers take," she "Singleexplains.orpaired zigzags are said to represent creeks or rivers, or the lightning that precedes the rainy season. Multiple zigzags have been variously interpreted as marks left in the sand by tides and flood waters, and the ripples created by the wind on the surface of the sea and large bodies of freshwater.” Shield

➸ BRILLIANT BUSINESSES

Wunda

DAVID LAZARUS, AKA TOM "CRUISE DIRECTOR" OF THE RHYTHMBOAT, INVITES YOU TO PARTY

The Rhythmboat hosted around 300 cruises a year on Sydney Harbour over the years, featuring a variety of acts including one of the best ABBA Tribute Shows, the ‘Fab Four’ Beatles show, and comedian Bob Downe.

The team's creativity generated from these events on the water began the journey into the world of hosting events and parties on floating venues.

PORT CRUISES

ADVENTURE

Tom "Cruise Director" of Rhythmboat invites you to party➹

David Lazarus k

Experts in the field

✦ A born entertainer, David has the gift of a creative and imaginative mind. He wants to make your next occasion one to remember cruising the Hastings River. With a quarter of a century in the entertainment industry, he is Port Macquarie’s resident party and function expert. Some 23 years ago, he operated ‘Wizzbang Entertainment’ in Port Macquarie and was heavily involved in the community, performing at various venues each week including the Port Venture Cruise which was a dolphin spotting charter at the time which David and partner Elsa have since named their business after.

Why are David and Elsa “The Macquarie?Experts”EntertainmentinPort Lots of reasons. The vessel, the Rhythmboat, has been operating since

Portadventurecruises Book Spot the Dolphins Cruise by Port AdVenture Cruises

➹ ➸

27

The "star" of the cruise is having their "resident" dolphins who seem to be attracted to the boat and love to swim on the front of the bow wash. “That experience and with us making sure everyone is happy is very satisfying," says David. David told us he loves his job. “To go to work and see families enjoying our 2-hour river cruises on a lunch cruise and then sometimes on the same day, decorate the boat for a night-time birthday party, then the next day have a big group of seniors onboard, really gives me the satisfaction of how wonderful our boat is to present so many different types of cruises and events." Entertainment and cruises to look forward to The Rhythmboat is a floating venue, which features an outstanding atmosphere and versatility. Currently, David and Elsa are booking selected live music (duos) as well as a couple of tribute shows, a comedy cruise and an Island themed night. When they aren’t hosting the live entertainment, they conduct daily Dolphin spotting river cruises. Now, with the weather getting warmer, there is a steady stream of enquiries and bookings. So book your seat today to cruise the pristine waterway aboard The Rhythmboat and get up close and personal with their resident dolphins. Confirmed dates for August & September Sunday 14th August - Graham HowleCountry Music - afternoon Sunday 28th August - 2 Man band - featuring a Blues Brothers tributeafternoon cruiseportmacquarie.com.au

As cruise director of Rhythmboat, David ensures all passengers enjoy their time onboard He told us, “We have a very simple mission statement, customer service! It is important that every passenger on board has a good experience with us, with comfort, good catering, and a relaxed atmosphere.”

BRILLIANT BUSINESSES

Saturday 10th September - Comedy cruise - evening Sunday 11th September - Eric Grothe & the Gurus - Icehouse tribute showafternoon Saturday 24th September - Seafood Island night with live band MC Seoulevening Sunday 25th September - MC Seoulafternoon Full details on the above cruises on:

➹

➸ ABBA Tribute Show on the Rhythmboat What you can expect Good old fashioned fun and value for money when you cruise on The Rhythmboat. They specialise in some great catering options, have the only liquor license on the Hastings river, the boat has a big enclosed, inside cabin and plenty of outdoor areas as well, which makes it an all-weather Davidboat/venue.toldus, “ I have said before that you don't have to own a boat, you can come on ours and enjoy so many different entertainment options, sightseeing and many other cruise choices.”

If you are looking for somewhere to host your next function, then Port AdVenture Cruises is your next stop, just give David and Elsa a call. They have got you covered for an amazing day or night on the Hastings River aboard The Rhythm Boat - they will get your party started!

28

The Rhythm Boat is designed for versatility and is unique to the waters of Port Macquarie.

THE Port AdVenture Cruises ➹

1982 specialising in entertainment, starting as a showboat in Lismore on the Richmond River, then sailed into Sydney Harbour until last year and now it is here in Port David’sMacquarie.background has always been in entertainment, working in pubs, clubs, and venues throughout NSW. Now, his job is to utilise his experience. He said, “ Because I am so very well connected with so many entertainment shows, we now book them on our vessel knowing that our customers will come on board and be entertained in a unique venue where the scenery changes every 5 minutes.”

Storytelling is the basis of any successful sales or ablecampaignmarketingsobeingtohelpsomeonesharetheirstoryin a unique way can significantly help an individual or a business. j

Click on image to read the best dentist story ➹ Ben Tirebuck➸

30

MEET THE STARS! THEY'RE SHINING BRILLIANTLY!

Receiving positive feedback from these subjects always generates a warm glow of pride and raises a smile. Being compassionate with the person or subject is key. Engaging and understanding the real hook of the tale always forms the basis and allows me to develop things. Also, thinking a little left of centre and attempting to adopt a slightly unorthodox approach is something I have always tried to embrace, be it the subject I am focused on or the manner in which I attempt to relay it. I wouldn’t say I am necessarily rebellious but adopting the moniker of the shepherd as opposed to the sheep is something I have always done and which I believe has placed me in good stead professionally. Think outside the box and use the power of language to create unique, engaging and impactful stories. It’s something I very much hope to be able to continue doing for many years to come.

✦ Our Brilliant-Online team brings together experts from a variety of backgrounds, and it's this wealth of diversity and experience that makes for brilliant stories. We turn the spotlight and shine on our very own teamBrilliant-Onlinetofindoutwhat makes them shine and how they are contributing to making Brilliant businesses glow. Ben Tirebuck - Editor The secret to my success is purely based on my love of language and Fromstorytelling.avery early age I fell in love with words and stories and was always reading and writing. There is something so uniquely powerful about storytelling. Indeed, when you come to think about it, stories very much form the backbone of our existence and how we have evolved as a species and society. From the dawn of time stories have been created and passed down through the generations. Many fictional, many not, they have helped create and shape the world as we know it today, forming folklore, laws, religion, customs – the list literally goes on and on. Art, literature, history, music, movies, they all use language to tell stories in their own inimitable way. I have merely jumped on this bandwagon and used a natural inclination and ability towards language to create and relay stories throughout my career. Not much tops consuming or creating a good story in my opinion, and I take particular delight in being able to tell someone’s story, to bring their life journey or experience to a broader audience. Many people have wonderful stories to share but just don’t have the means or confidence to articulate them well enough to do justice and that is where I believe I can step in and help clients.

Veronica Lind - CEO For advertisers, Brilliant-Online is really the first and only one of its kind on the market currently, as an interactive, multi-media advertorial platform that puts a whole new spin on the traditional magazine / newspaper, and even going beyond what other digital formats are offering. When readers browse through Brilliant-Online, it somehow seems vaguely familiar, as if you've seen it before. You would if you know about Harry Potter's magical world.

Read July 2022 issue of the Brilliant Magazine ➹

What I'm really proud of though, is that Brilliant-Online was born in the midst of the 2020 COVID-19 pandemic and it is testament to its ability to bring worthy businesses' stories far and wide in spite of challenging times.

The Daily Prophet is pure fiction and perhaps no one would have thought further to take it out of the fictional world to make it real. I'm of the mindset of always wondering, "What if?", "How about?", "Why not?" and "How can we make this happen?" With built-in digital portals that allow the interweaving of layers of interaction to create a captivating new possible.Onlineaudioandarrayembeddingcommunicationsmulti-dimensionalmedium,andBrilliantpageswithanofQRcodes,linkstowebsitesvideos,pop-upfiles,animations,filesandpodcasts,Brilliant-hasmadetheDailyProphet

BRILLIANT BUSINESS

Veronica Lind➸

31

j

The world of technology and modern marketing strategies, sales and business development is my natural environment and it is where I can truly let my brain stretch its legs. As a multipotentialite, I never really stop and my brain needs constant challenges to keep it happy and robust. I have been an entrepreneur, technologist and international marketer, helping businesses thrive by empowering them with the tools and strategies to turn their business around.

I see myself as a Technology Magician. No rabbits in my hat but I make magic real. If I can envision it, I can make it come true.

I am in, sell without selling is my mantra and it has helped many businesses that needed that boost of confidence. Ultimately, when businesses benefit from what I do, I get that rush of adrenaline when I see their marketing strategies really take off and generate benefits, their customers stay loyal and keep returning, and businesses are really enjoying making long-lasting, meaningful engagement with their customers.

The key here is to ask, how can we as a business, stay Personable, Relevant and WhicheverAdmirable?role

I have spent over 18 years in media, communications and sales. Customers love working with me because they know I can guide them with their advertising needs in a way that goes beyond the industry's benchmark. I'm not here to tell them to place an ad here or there. That they already know. What I'm bringing in are my innate skills and experience of promoting people and businesses in a way that sincerely and inevitably attracts people to them. One can study several degrees and read a dozen books on this, but I do believe it's something that I was born with. I have always been highly involved in my community and I'm passionate about my hometown, Wauchope NSW. There's nowhere else I really want to be. This is my home and happy place and where I thrive. I have been on the committee of the Wauchope Lasiandra Festival for over 25 years, having held the position of both President and Secretary. I just love promoting the festival and bringing visitors to the town. So for every client that I meet, I treat them like I would my hometown. I believe in it, and I want it to grow and endure. How do I promote each business so that they can thrive? At the end of the day, it's all about the human connection and while we have information, knowledge, technology etc. to support what we do, I think it's paramount we don't forget that we are all 100% ecological organic humans that really crave being seen and heard and wanting to do and give our best. When I interview clients, I listen and not just hear them. I get to the core of what they need and guide them to the next level where they can feel or rekindle that spark of

I love a good chat and meeting new people. Being open and curious helps me to really listen to people's stories and identify their essence and what they need. As Sales and Operations Manager at Brilliant-Online, client satisfaction is key. When I speak to a new business, they need to know that I'm here to help their business grow as smoothly as possible.

Read about our Brilliant Women ➹ I essentially see myself as a people person, and if there was a role that I could apply for, I'd say I'm a Client Satisfaction Expert! j

32 enthusiasm they may have forgotten or perhaps were not even aware of. It's a good day for me when clients come back to me with eyes shining and feeling excited about how their business is doing. When one business grows, so does our community. We're all in it together and that's what I love about what I do, helping businesses to shine brilliantly!

Our Brilliant team is here to bring businesses the glow they need to get excited about their business, and to share their brilliant stories with the rest of the world. Does your business have a Brilliant story you'd like to be heard around the world? Speak to our Brilliant Team and let's get that spark going! Contact Us ➹

Chrissy Jones - Sales and Operations Manager

Chrissy Jones at work➸

Avery Dennison Graphics Solutions has just launched its next generation paint protection film, Supreme™ PPF Xtreme, aimed at empowering vehicle owners to safeguard their investment against the impact of extreme environmental conditions in Australia and New Zealand. This film is a virtually invisible ultra gloss, non-yellowing, and self-healing polyurethane film that enhances a car’s appearance and preserves its resale “Asvalue.materials science is in our DNA, the Avery Dennison team is driven to meet the constantly evolving needs of our customers through innovation,” said Chris Sherry, Senior Product Manager, Australia and New Zealand, Avery Dennison Graphics Solutions. “We are, therefore, proud to announce significant technological upgrades to ✦

Avery Dennison Corporation (NYSE: AVY) is a global materials science company specializing in the design and manufacture of a wide variety of labeling and functional materials. A segment of the Avery Dennison Label and Graphic Materials Group, Avery Dennison Graphics Solutions provides imaging materials and service solutions for fleet, architecture and transportation markets. graphicsap.averydennison.com ➹

Avery Dennison launches Supreme™ PPF Xtreme➸

The new Avery Dennison Supreme PPF Xtreme answers vehicle owners’ need for a highly durable film for the extreme environment in the ANZ region. our premium paint protection film, creating the new Supreme PPF Xtreme.”

The new film is available through authorised Avery Dennison Graphic Solutions distributors in Australia and New Zealand. We invite automotive businesses and installers to be an Avery Dennison [Insider] to receive priority news and alerts from the company directly at

SAFEGUARD YOUR CAR’S PAINTED SURFACES WITH PAINT PROTECTION FILM

33BRILLIANT BUSINESS

“The new Supreme PPF Xtreme will help owners safeguard the painted surfaces of their vehicles against the impact of challenging road and environmental conditions across the ANZ region.” Built on the foundation of Avery Dennison’s top-of-the-range paint protection film, the new Supreme PPF Xtreme is a step forward in performance with an extended 10-year warranty across all zones, optimised installation performance, and enhanced self-healing and stain resistance.

For more information, visit Subscribe to become an Avery Dennison ➹

L

How long have you been involved in radio, where and why?

Here at Superradio Mid North Coast I wear many hats as the days of being “just an announcer” are numbered. My duties include, Journalist… compiling the daily local news bulletins, music programmer, part-time technician, computer programming and repairs, commercial voice over with production creation and music mixing as well as station manager.

I believe I started in radio around 1963, 1964 with little appearances on my father Gary O'Callaghan's show but commenced actually working and being paid at the end of 1973 and start of 1974 as work through my school holidays, but I was approached by the stations owner who convinced me to leave school and work in radio full-time.

He is the station manager, news director, afternoon announcer and production guru. John has interviewed a huge variety of politicians, sports stars, music legends and celebrities from all walks of life but meeting Mick Fleetwood was a personal highlight along with Prime Minister Malcolm Fraser. John is a huge supporter of the Tigers in both the NRL and AFL.

What does it take to be a radio announcer? If you want to become a radio announcer then just keep plugging away at getting into the industry, join a community station, talk to other announcers, and most importantly don’t try to be them, just learn how to be yourself. ✦ FM93.5 Radio 531am began broadcasting on January 26, 2000 and reaches over 90,000 people every week. Part of the Super Radio Network, they have the Mid-North Coast covered.

YOUR LOCAL RADIO EXPERTS JOHN O’CALLAGHAN AND NIK JAMES

ive 24 hours a day, 7 days a week with Local and National News, the John Laws Show, John O’Callaghan (weekdays 12-3pm), Talkin’ Sport, Live coverage of the NRL, AFL, A-League and Super Rugby PLUS the Greatest Songs Ever Made across the Mid-North Coast.

34

With a combined total of 70 years in the radio field, your Port Macquarie based radio presenter extraordinaires are John O’Callaghan and Nik James Lipovac. Truly experts in their chosen field. About John Having worked for 45 years in the Radio Industry after starting as a 15 year old at 2UE in Sydney alongside his famous father Gary, John worked as a panel operator and production assistant before gaining his first on-air role at 2KO Newcastle. From there he continued to work as an announcer, in the newsroom and in production at 2KA Penrith, 2NZ Inverell, 2WG Wagga, 2CS in Coffs, 4AK Toowoomba, 2GZ Orange and then finally arriving in Port Macquarie on Australia Day in the year 2000!

From John I grew up with entertainers forming a large part of my early life with actors, dancers and musicians as my grandparents , great grandparents and even further back. Also, with my father in radio and my mother the radio stations receptionist, we had a parade of entertainers who were family friends drop in. Johnny O’Keefe, who went to school with my father, Kamahl, Little Pattie and many others. Coming from a large family it always was fun, exciting and never boring. It was also very natural to meet up with all these different people as that was just what life was like.

Expertise at 531…

Any formal training or are you self taught?

If you were down to your last $20 what would you do with it? I’d gather as much of my family as I could, buy a large serving of chips and sit on the jetty watching the sun go down feeding ourselves, the fish and the seagulls. Thanks John.

My career in radio has been a joint effort as you learn all about the industry and how you put it all together everyday from those you work with. You also learn from many announcers and producers from all over Australia and the world as you pull apart what it is they have done to put together their own sound.

How have you helped the community in your role?

Raising funds for rescue helicopters, cancer charities, children's hospitals, humidi cribs, volunteer rescue association vehicles, riding for the disabled. There are so many worthy causes and I think if you are in the public eye and have the chance to do some good, then that’s what you must do. Any advice for aspiring radio presenters?

It’s amazing the opportunities you get when you are in the media to help others in the community who aren’t as lucky as most of us. I’ve ridden so many different things in the name of charity from elephants, cows, camels and retired racehorses , been in demolition derbys, speedway cars, and legs of a rally car race...

BRILLIANT BUSINESS

35

John O’Callaghan at Super Radio Network➸

If you want to become a radio announcer then just keep plugging away at getting into the industry, join a community station, talk to other announcers, and most importantly don’t try to be them, just learn how to be yourself.

endsworkedmyfairspeakanddeterminedpassionatewhotaking,underdog-fighting,community-loving,extramile-overlyoptimisticindividualissomewhatstubborn,alwaysandmostdefinitelytomakeadifference...afatheroftwo!I'llspeakout,upandputmyselfforward.It'stosayI'vebeenheavilyshapedbyblue-collarbackgroundwhereI'vemybacksideofftojustmakemeet.

How long have you been involved in radio, where and why? Although I only recently hit the 25year mark in my radio career (with a few detours along the way), I first started working at 2Day-FM in 1989 following a brief stint at a Sydney Media Academy. I love to inform, entertain and enjoy music from all eras. I've taken on numerous roles including breakfast announcer, news director, sports show host, etc, at stations across NSW and even 12 months in Devonport, Tasmania. I spent almost 11 years at the old 2MC-FM/StarFM (now Triple M/Hit) and since 2017 I've been part of the Radio 531 team. I've always had a strong interest in all forms of media and communication. I think it all started when I was a kid listening to the Footy and Top 40 Countdowns on the radio and I read a lot of newspapers. Still do! (*even the online ones!) Expertise at 531…

Nik James celebrating 25 years in Radio➸

36 About Nik Having spent the best part of 25 years working in radio, Nik, aka Niko, has lived on the Mid-North Coast since 2002. His first job was as the office and promotions assistant at 2DayFM in Sydney. He then moved to 2GN Goulburn as an announcer followed by 7AD Devonport in Tasmania, then it was off to 2LT Lithgow (Blue Mountains) to take over the breakfast announcer and news director roles before shifting north to Coffs Harbour to work in brekky, sales and the Saturday Sports 2MC/StarFMShow. in Port Macquarie (now Triple M and HitFM) was his home for almost 11 years where he worked on-air and in promotions including coordinating the first 10 years of Give Me 5 for Kids. Nik has been with the Super Radio Mid North Coast team since November 2017 in sales and as the fill-in announcer. Some of his radio highlights include having lunch with Eddie McGuire in Melbourne and interviewing Russell Crowe. Niko loves the Rabbitohs but has a passion for all sports. From Niko I'm a sports-mad,

Most of the time I focus on my fulltime sales role, but also assist in putting together our weekly local sports show and I occasionally get to fill in on-air when John O'Callaghan is away. Having worked in various roles over the years I really enjoy putting all my skills to the test from community engagement to writing and voicing commercials to preparing and presenting a show.

BRILLIANT BUSINESS

You need to be bloody determined. There are fewer and fewer positions available these days and radio school graduates are now competing with reality TV stars for on-air roles. Just be yourself, be natural, have a good knowledge of local news, info and current affairs, be able to tell short amusing stories and have a basic understanding on the music and artists you're playing. Sounds simple enough but putting it all together takes time. Any formal training or are you self taught? A bit of both. In addition to radio school, while I was waiting for my big break, I got involved in community radio and did a weekly shift. Back in the day when every kid had a cassette recorder you could have a bit of fun and practice at home. I suppose these days you can use your phone to record audio and vision... and become an instant social media star! How have you helped the community in your role?

You might also want to consider a back-up career.

I've been involved in hundreds of community events and fundraisers over many years and there's nothing quite like helping someone who needs it most.

Radio and the media in general, always has and always will be, about the local community. Supporting events via promotion and publicity, getting involved on ground level as a volunteer coordinator or emcee, Encouraging others to get behind the occasion, using your contacts to benefit others, Whatever it takes.

Best thing about your job Freedom, flexibility and fun. Any advice for aspiring radio presenters? If you don't have a passion for it you won't last long. It's addictive, it's a rollercoaster ride, it's not for everyone. There are as many people in the industry who will push you to be your best, as there are people who will tear you down. No matter where you are, learn as much as you can about all aspects of the industry, be prepared for hard work and long hours, but also enjoy the journey.

37

What does it take to be a radio announcer?

If you were down to your last $20 what would you do with it? Split it with a homeless person and then we can both enjoy a meal. Thanks Niko.

38 THEY’RE BACK! THE 2022 WAUCHOPE AND HINTERLAND BUSINESS AWARDS ✦ “After some very challenging years it's time to celebrate local business and how the contributions of local business enhance our lifestyle and opportunities in Wauchope and the Hastings Hinterland.” said Lisa McPherson, Wauchope Chamber Executive Officer. The Awards are a celebration of local business and aim to recognise the hard work and resilience of businesses in the Wauchope and Hinterland region. They are a celebration of local business and acknowledge the contributions of local operators. They bring opportunities for local business to recognise their achievements, build rapport with their team, review their business journey, and consider their future plans. Awards Categories The Business Awards program includes two types of Awards – Local Excellence Awards and NSW Business Chamber aligned Awards. Through the Local Chamber Alliance between the Wauchope Chamber of Commerce and Industry and the NSW Business Chamber, the aligned Awards entries will feed into the NSW Business Chamber Mid North Coast Regional Awards. This collaboration presents opportunities for local businesses to gain exposure and promotion to a wider audience. Winners at the regional Awards go through to the State Awards later in the year. This year 20 Award categories will be presented at the 2022 Wauchope and Hinterland Business LOCALAwards:AWARDS 1. Excellence in Accommodation and Hospitality 2. Excellence in Agriculture 3. Excellence in Creative Industries 4. Excellence in Health and 5.WellbeingExcellence in Hair and Beauty 6. Excellence in Professional Services (20 employees or less) 7. Excellence in Professional Services (21 employees or more) 8. Excellence in Retail 9. Excellence in Tourism 10. Excellence in Trades, Industry & 11.ManufacturingExcellencein Work Health and Safety NSW BUSINESS CHAMBER ALIGNED AWARDS 12. Outstanding Employee 13. Outstanding Young Business 14.Leader.Employer of Choice 15. Excellence in Sustainability 16. Outstanding Community 17.OrganisationOutstanding Start-up 18. Excellence in Micro Business 19. Excellence in Small Business 20. Business of the Year

Brilliant is in too! Brilliant-Online is proud to have entered the Wauchope Business Awards this year! We were born and grew through the challenging times of the pandemic. And our Brilliant Team helped showcase the brilliant stories of many other businesses in our communities, to not just survive but to also thrive. By blending technological wizardry and the indispensable human connection, these businesses could be seen and heard all around the world, leading to immediate engagement that is made easy with our world.businessesmakeforbrilliantcommunicationsmulti-dimensionalmedium.Allourbuilt-indigitalportalsallowmulti-layeredinteractionsandtheexperienceofconnectingandclientsawholenewWearemagicmadereal,and a trailblazer being the first to bring this experience to the world. Take a step into our magical world and experience our Brilliant magazine! Gala Dinner tickets some of our Brilliant Stars

➹ Meet

Buy

➹

39BRILLIANT BUSINESS Celebrating local business While it is important to have a positive image, it's also important to be respected within your industry. The Wauchope and Hinterland Business Awards are a great way of gaining recognition and respect among your peers. They can help you develop deeper relationships with customers, investors, suppliers, partners and the media. Winners will be announced at the Gala Dinner – Sat 27 August at Wauchope RSL Club.

CONGRATULATIONS WAUCHOPE & HINTERLAND BUSINESS

CONGRATULATIONS TO THESE BUSINESS AWARDS ENTRANTS Tell your business stories on Brilliant-Online. - Contact Chrissy Jones+61 412 137 chrissyjones@brilliant-online.com621

42 The Pack Leader.

Photo: Jo Lyons Photography ➸

43 ✦ ✴ NATIONALMONTHDOG Brilliant BRILLIANT NATIONAL DOG MONTH

Kerrie has always had a passion for working dogs but being with them on a daily basis, whether it was out in the paddocks, in the yards or on the trucks, helped her gain an understanding of how important it is to ‘Give a Dog a Job’. She told us, “ They taught me so much about how much dogs require a leader/boss. I had the opportunity 10 years ago to do my Certificate III in Dog Behaviour & Training through the NDTF (National Dog Trainers Federation) and haven’t looked back.”

Photo: Jo Lyons Photography ➸

dog Lainie, both Kelpies and both have now passed away. Now she has her third Kelpie Harper who has just turned 2yrs.

All dogs live in different situations, with different owners under different circumstances but all dogs require the same thing – Leadership.

About Kerrie Kerrie has always loved dogs, especially working dogs and specifically Kelpies. After living in the Riverina district for a short period when she was younger and helping out on a family friend's farm where they had working Kelpies, she got her first dog Scout and then about 6 years later she got her 2nd ✦ They thrive on it, it strengthens your bond and there’s nothing better than a great relationship with your best friend.

Best part of her job Helping clients understand and learn why their dog might be acting or behaving in a particular way or why they’re not doing what’s asked of them. Kerrie said, “ I get to spend the day with not only my dog but clients dogs and also meeting new dogs all the Kerrietime.”trains all breeds, she doesn’t discriminate as all dogs (no matter the breed) require the same things including leadership. She told us, “ Dogs do best when they know what’s expected of them, having rules and boundaries helps them learn manners so you can better manage them. It’s also an opportunity through the process of training to strengthen your relationship and your bond is stronger.”

This is the philosophy behind Kerrie Whiteman, The Pack Leader, a mobile dog Behaviourist and Trainer based in Beechwood on the Mid North Coast of SheNSW.believes that by providing a dog with structure and rules makes for a happy Providingdog.a dog with an environment where they have the opportunity to learn boundaries and limits helps the dog gain their full potential with a calmer state of mind.

thepackleader.net.au ➹ Kerrie Whiteman, The Pack Leader

44

GIVE A DOG A JOB

Kerrie told us, “ This can help a dog feel more secure and if done with the right energy and patience the dog becomes much more relaxed. Our dogs, after all, are like family members and I want them to be balanced and well adjusted so they fit happily into our family lives.”

Physically and mentally challenging your dog can help them maintain a balanced state of mind and strengthen the bond you have with your dog. This can only be accomplished through leadership and giving a dog those all important rules and structure.

Vera➸ BRILLIANT NATIONAL DOG MONTH Learn more ➹

45 VERA IS DOGTOR-ON-CALL

Great

✦

They seek meaningful and life-giving interactions between humans and animals, working and growing towards better, healthier communities, together. Recently Vera was involved in the Dogtors-on-Call at the Singapore General Hospital where she spent some time with the healthcare staff. This interaction has helped healthcare workers relieve stress and bring them comfort and joy. job Vera for contributing to the community! AAI.SG (Animal-Assisted Interactions) is Singapore’s first social enterprise specialising in animal-assisted interactions and interventions.

46

Every dog deserves a great life

Continuous Education and Training

For the past 11 years Jo has worked on her craft through continuous education, which includes travelling to France and New Zealand where she was trained by some of the world’s best dog photographers. She is an accredited professional photographer, operating her business, Jo Lyons Photography for the past ten years. She is also a fundraiser for various causes, one being the “ Tails of Barrington Coast”, a book project which will be out in time for Christmas. “ I’ve spent the past 12 months photographing dogs across the Manning Valley, Great Lakes and Gloucester regions and raised over $2600 for Aussie Ark.” She told us, “ This is my second book project, the first was “Teeny Tiny Dogs and their Stories” which supported “Paws for Thought” Rescue in 2019.” She loves her work Jo works with dogs. “What more could you ask for!” she said. “My background is corporate human resources and I feel blessed to now have my own business which revolves around man and woman’s best Cateringfriend!“ to all dog breeds, but she is especially drawn to rescued dogs who range from purebred to bitzer and everything in between.

Jo Lyons, Photographer➸

MEN'S BEST FRIENDS STRIKE A POSE WITH JO LYONS

Jo Lyons' journey into dog photography started back in 2011 when she discovered the poor quality of the intake photos for animals into pounds and shelters, she pondered on how many animals lost any chance they had to be noticed due to a poor photo. This led to her volunteering at some of the biggest pounds in Sydney where she spent many a weekend for eight years photographing the impounded animals so they had a beautiful portrait and would be seen… and hopefully saved. Over those years thousands of animals were photographed and the vast majority went on to have a second chance at life through being rescued or adopted. ✦

Seeing the joy in the dog as they embark on their photography experience and all the smells, sounds and textures they experience is a constant joy for Jo. “ Seeing the reaction of my clients when they see their images for the first time, and designing artwork for them to treasure and remember their dog is very fulfilling.”

Dogs are family, and their lifespan is so short compared to humans. She told us, “ My clients treasure their dogs and a beautiful portrait will ensure they will never be forgotten. It is my job to create beautiful portraits to continue their legacy and I offer the finest Australian-made products, ranging from stunning albums and print collections through to framed fine art paper, canvas and metal wall art as individual artworks, storyboards or multi-artwork collections.”

BRILLIANT NATIONAL DOG MONTH jolyonsphotography.com ➹

“ I believe every dog deserves a great life and an abundance of love, has a story to be told and deserves to be remembered through beautiful imagery and artwork. I work with families who consider their dogs as their family.”

All dogs should be photographed

47

48 "The information or opinions provided herein do not constitute investment advice, an offer or solicitation to subscribe for, purchase or sell the investment product(s) mentioned herein. It does not take into consideration, nor have any regard to your specific investment objectives, financial situation, risk profile, tax position and particular, or unique needs and constraints." Read full Disclaimer. - Samso

49 ✦ ✴ INVESTMENT Brilliant BRILLIANT INVESTMENT

50

LISTEN TO A RARE EARTH STORY FROM MOUNT RIDLEY MINES LIMITED (ASX:MRD) Always wanted to know more about REE? Guy Le Page, NonExecutive Director of Mount Ridley Mines Limited (ASX: MRD) brings insights.

Mount Ridley Mines Limited (ASX:MRD) shares a Rare Earth Story with Noel Ong, CEO of Samso➹

REE trend You may have noticed there has been an increase in the appearance of REE in Ionic Clays recently. If this is an area you are as yet unfamiliar with, one of the best ways to learn is to speak to someone who is involved in the industry and who understands what it´s all about.

✦

Guy Le Page, Non-Executive Director of Mount Ridley Mines Limited (ASX:MRD) brings a refreshing take on REE. REEs are Rare Earth Elements that have become increasingly important as our world becomes more and more technological. These elements are necessary for technological elements such as The next time you hear an exploration story, ask yourself these two questions: Does it have substance? Does it have a reasonable potential for it to come true? v

What is interesting is, the REE deposit is not Ionic Clays, and there is still much to learn about the project. The company is in a learning phase, which means the next twelve months will bring a clearer picture as they continue to drill. The project has several plus points, including the fact that it is 35km from a port, it has a highway, railway and a gas pipeline adjacent to the project. This is critical for the company as they continue to work on the technical Soaspects.isthis an early exploration project, or an early development mineral project? Wait and see, and more will be revealed.

About Guy Le Page Non-Executive Director B.A., BSc (Hons), MBA, MAusIMM, FFIN Mr Le Page is currently a Director & Corporate Adviser of RM Corporate Finance specialising in resources. He is actively involved in a range of corporate initiatives from mergers and acquisitions, initial public offerings to valuations, consulting and corporate advisory roles. Mr Le Page was Head of Research at Morgan Stockbroking Limited (Perth) prior to joining Tolhurst Noall as a Corporate Advisor in July of 1998. As Head of Research, Mr Le Page was responsible for the supervision of all Industrial and Resources Research. As a Resources Analyst, Mr Le Page published detailed research on various mineral exploration and mining companies listed on the Australian Securities Exchange. The majority of this research involved valuations of both exploration and production assets. Prior to entering the stockbroking industry, he spent 10 years as an exploration and mining geologist in Australia, Canada and the United States. His experience spans gold and base metal exploration and mining geology, and he has acted as a consultant to private and public companies. This professional experience included the production of both technical and valuation reports for resource companies.

Now this is one project you´d want to keep your eyes and ears on. Mr. Le Page talks about the history and contents of the company´s REE story.

51 cell phones, TVs, LED light bulbs and wind Thereturbines.areconstant

REE announcements being released, so keep an eye out, observe and learn. Mount Ridley REE project

BRILLIANT INVESTMENT Contact

Learn

(DMIRS) Department of Mines, Industry Regulation and Safety 1:100,000 Interpreted Bedrock Geology ➸ Mount Ridley Mines Limited : +61 8 9389 8033 +61 8 9262 3723 https://mtridleymines.com.au/(fax) more ➹

All eyes are on the Thor JV, and there is a lot of interest riding on what Chalice Mining is doing there - after all, the Thor JV is one of the company´s assets with an active exploration program, and it´s an important part of the portfolio of assets worked by Chalice Mining.

VENTURE MINERALS LIMITED IS GETTING CLOSER TO THE JULIMAR LOOK-ALIKE

Announcement: 13th July 2022 ➹ And especially focus on the identified area. One could say it´s an area where some extension may have happened. This is fairly observant from the magnetic image where this distinct bend is. We are at a very early stage here so we´re not talking about any definite discoveries. However, this coincidence with the geophysics is enough to make one sit up and pay attention. The announcement may not have done full justice to this. It would be surprising...and even disappointing, if no discoveries came up geochemically. It´s worth listening to Andrew Radonjic, Managing Director of Venture Minerals. This is a conversation that addresses issues investors would be interested in, given the "tough" times currently on the market.

52

✦ We learn about the chosen targets of Chalice Mining Limited (ASX: CHN) and get interesting news on (ASX:VMS)´sMineralsVentureLimitedThor JV. Venture Minerals Limited (ASX:VMS) is getting closer to the Julimar look-alike with Noel Ong from Samso➹

Take note of the recent announcement that was published on 13th July. Listen to Julimar´s Twin Brother- The Thor Project ➹

Listen to Coffee with Samso Tune in to Rooster Talks

Samso is a renowned resource to learn about insights into the companies and business trends that matter. They have a track record of developing successful business concepts in the Australasia region, and provide bespoke research and counsel to businesses seeking to raise capital and procuring projects for ASX listings. The Red Seagull Storytelling is key to getting people to sit up and notice your business. Noel is able to see what both sides need - from the company's end and what investors are interested in. So it's all about creating content and building a story that allows business leaders to fully share their company's story accurately straight from the horse's mouth, and one that attracts investors and makes them want to engage. Immediately if possible.

✦ Noel Ong, CEO of Samso is an expert at Red Seagulls. If you haven't seen one, you will with Noel. Now, what on earth is a Red Seagull? That's precisely the point. If you do actually see one, it'll pique your interest. Noel Ong, CEO of Samso excels at the Red Seagull strategy. He tells compelling stories by engaging business leaders to reveal insights that are relevant, timely and beneficial to the investment community.

54 NOEL ONG, CEO OF SAMSO ON HOW HE CREATES COMPELLING ASX STORIES

3. Strong international investor and media network relationships.

• Samso’s Proactive Partnership sees 100,000 unique visits every day; 1.9 million page impressions per month from Twitter alone; and more than 10,000 corporate IPs identified every day.

• Across Samso's media distribution partners, company stories are shared across all of their social platforms with each video on YouTube watched over 21,000 times.

4. Samso creates content to save companies the extra cost of third party creators.

• Further distribution through media partners reaches more than 630,000 audiences every month.

1. Samso is highly experienced in 6 business sectors.

7. Magnified distribution across Media Partners' channels - Proactive Investors, Mining HQ and BrilliantOnline Interactive Magazine and investing firms like Denham Capital. Noel begins crafting every single Red Seagull story by creating the story on Coffee with Samso, Rooster Talk or Samso Insights or Mining HQ podcasts. Then, with Samso´s distribution partners and channels, the Red Seagull gets distributed. This generates a wide outreach that keeps viewers engaged, aware, understanding and actively investing.

Facts

6. Noel´s relaxed conversations drive definite results.

2. Samso fully understands the requirements of the ASX - and its limitations.

Why the Red Seagull strategy works Here are 7 reasons why:

55

Samso's Red Seagull strategy basically creates digestible, manageable bitesized stories that enable companies to show their passion and explain why their projects are worthy of investment and also allow investors to visualise the opportunities offered by these companies and participate in them.

5. Wide and enthusiastic following for Coffee with Samso, Rooster Talk and Samso Insights.

BRILLIANT INVESTMENT

Amazing Red Seagull

He's an industry veteran and a geologist with over 30 years under his belt (or hat!) and a strong background in capital markets, corporate finance and the mineral resource sector. He was the founder and managing director of ASX publicly-listed company Siburan Resources Limited from 2009-2017 and has also been involved in several other ASX listings, providing advice, procuring projects and helping to raise capital.

Noel with his dog Samso➸ to Coffee with Samso Tune in to Rooster Talks

Listen

➹ ➹

56 • Triple M radio has 650,000 listeners and Mining HQ broadcasts 43 weeks of the year and reaches out to 100,000 audiences per broadcast.

"Brilliant-Online opens up exciting new aspects for more effective engagement with both our clients and a broader audience of investment communities. It gives us a multi-dimensional digital canvas on which to portray an extended scope of our industry insights right across the investment landscape.

The man with the hat Noel never goes anywhere without his trademark hat. Based in Perth, Western Australia, Noel travels across Australia to record the interviews, and he knows really well by now which coffee places are most conducive to opening up a casual but deeply insightful chat.

We're amazed how results jumped 90x for our client Venture Minerals in just one month!" - Noel Ong

58 Dv ADVERTISE BRILLIANTLY

59 vD ✦ Contact Chrissy ✦ +61 412 137 chrissyjones@brilliant-online.com621Brilliant-online.com Advertise brilliantly in September focusing on Made in Australia Products and Services Request Ad Package

60

61 ✦ ✴ HEALTH Brilliant BRILLIANT HEALTH

WHERE’S THE WORLD AT WITH COVID-19 RIGHT NOW?

B

62

eing able to conregate again, cross borders and embark on international travel was a huge relief to many who felt the claustrophobia brought about by enforced lockdowns a little too much. Likewise access to general pubic spaces and a semblemce of routine. However, we shouldn’t be caught off guard or allow complacency to creep in. COVID-19 mighn’t be dominating the front pages of the newpapers or the nightly TV news headlines but don’t be fooled, it is still very much out there. We have witnessed numerous variants emerge such as Omicron, BA.2.12.1, BA.4 and BA.5, with the latter considered the most infectious and transmissible identified so far, ✦ Thankfully, after two hard COVID-beseiged years, the majority of the world’s population have managed to get back to a level of normality in their daily lives. responsible for driving the latest wave of infections globally. BA.5 has three key mutations in its spike protein that make it both better at evading immunity and causing reinfection. CNN reported on July 18 that the BA.5 subvariant is causing almost two out of every three new COVID-19 infections in the US. Likewise the World Health Organization states that about half of all coronavirus cases globally are now caused by this variant. Going by the statistics published on the Worldometer coronavrius page on Aug 9, a total of 590,377,658 cases of COVID-19 have been tracked and logged worldwide since the outbreak. Estimates suggest this figure is much higher due to unreliable data and numerous countries not detecting or recording accurate tallies. Without a shadow of a doubt, that figure will be higher still by the time you read this, higher furthermore if you recheck tomorrow, and so on. As of the same date there have been close to 6.5 million COVID-related deaths globally. The United States has by far the highest number of infected cases and attributed deaths at 94,024,925 and 1,059,210 respectively. India is in second place with roughly half the numbers of the USA. France is the hardest hit of the European nations with approximately Check Covid-19 updates by location➸ Check Covid-19 updates by location ➹

Thecom.au.COVID

63 34,079,658 cases and 152,711 deaths. Australia stands in 14th place in the chart with 9,684,642 cases and 12,439 Thedeaths.exact origins of COVID-19 are still debated by some but recent studies published in the journal Science point to the wet markets of Wuhan, China where irresponsible management of the wildlife trade suggests the virus jumped from animals to humans and – well, you know the rest and how the story Thereforeunfolds.the fact that China sits in 109th place in the Worldometer tally with just 231,665 cases and 5,226 recorded deaths seems unfathomable given it is the most populous nation on earth. It certainly lends creedence to the critics who argue the data is unreliable as, clearly, it is not painting a true picture of the situation. The irony is not lost that the country that tried to hide the outbreak, then fabricate the truth, is now on “Zero-COVID” watchsevere lockdowns have been enforced on many of China’s major cities and it is one of the very few countries where restrictions remain in place and travel and certain trade is banned, which is seriously hampering its economy. China has also struggled with its vaccine policy as Beijing chooses to rely on ineffective locally manufactured jabs and refuses to approve and import foreign made products. Elsewhere, throughout much of the world, successful vaccination campaigns mean that, even though new cases of COVID-19 are increasing again, the number of deaths are not, in relative terms. As of Aug 5 close to 85% of the population of Australia had been vaccinated, around 21.7 million people. Soon at-risk children as young as six months will be able to receive a jab after the nation’s expert vaccine advisory body gave the Moderna vaccine the green light, reports news.

New Normal New Lifestyle➸

situation really does depend on where you are based or where you may be headed. Be aware of the rules and precautions enforced and respect them, be it locally or elsewhere. Practice exemplary personal hygiene. We’re not quite through the woods yet but for now, without being complacent, many of us are just relieved that the worst does seem to be over and we can get on with our lives again with a semblence of normality. Let’s hope it continues to stay that way.

BRILLIANT HEALTH

DISABILITY MATERNITY CARE ON COLLABORATIVE CARE WITH THE ‘EXPERTS’

People with disabilities, whether parents or not, are the experts of themselves, their needs and how they see different supports fitting in with their lives. As providers, especially if we work in health, we might be experts in understanding the maternity system and the many aspects of this. But this is where out expertise lies, not in knowing what lived experience of parenting with a disability is. At disAbility Maternity Care, we believe in amplifying the voices of parents with disabilities, so that their lived experiences are heard. Sometimes, it’s not obvious in what is being said – it’s in the subtext or understanding the meaning behind the words that we need to be listening to. We feature a range of parents voices on our website, and will be releasing our new podcast in the coming months. creatively

Mothering

Collaboration means working together. Put simply, we need to listen to the voices of those we are supporting. If we don’t listen to them, find out what their needs are as they see them, or how they see their disability affecting their parenting, then how can we effectively work together to help them transition successfully as parents? ✦ Last month, we talked about collaborative care, and our upcoming workshop on Collaborative Care to support Parents with disabilities. Whilst it is not only imperative that organisations collaborate with each other to support these parents better, it is crucial that providers collaborate with parents with disabilities themselves. And, in this collaboration, each participant recognise's the expertise each brings to the partnership.

64

when you have a disability➹

If you would like to find out more about parenting with a disability, navigating the maternity system, or increasing increasing your skills and knowledge to provide inclusive care, visit us at www.disabilitymaternitycare.com

* Provide information at my level of understanding, and if you’re not sure, check in with me to get feedback.

* Don’t assume what I can and can’t do because of my disability – ask me first.

* Give me time to think about questions, and to answer them (this is especially important if I have an intellectual disability).

* Ask me what strategies I think will work to get around parenting challenges as I see them – I probably have some great ideas as I’ve been doing this for a while – often my whole life.

65

* But most of all, LISTEN TO ME. If you are a parent with a disability, and would like to tell your story, please contact us admin@disabilitymaternitycare.comat

Connect with us here.

BRILLIANT HEALTH

Top tips collaboratingfor with the experts These top tips are taken from the words of parents with disabilities. If you are a provider, think about the ways you can incorporate these into your work:

6 Simple Steps by disAbility Maternity Care➸

* Don’t assume I identify as having a disability – I might see myself as non-disabled and want to be seen this way.

* Talk to me, not my carer or person with me at the appointment.

* Ask me what I think will be the challenges in becoming a parent – I will know what these are, because I know best what I can and can’t do.

66

67 ✦ ✴ COMMUNITY Brilliant BRILLIANT COMMUNITY

Roads We Ride | The

➹

68

Wauchope is NSW's first Motorcycle Friendly Town and is very proud of their commitment to motorbike riders and to the wonderful business and community that have supported the initiative over the past six Theyears.event has been an amazing achievement by some very dedicated volunteer committee members to help put Wauchope on the map, not just within Australia but also internationally. The Motorcycle Friendly Town of Wauchope is fortunate to be the starting point of one of the best motorbike rides in Australia, the Oxley Highway between Wauchope and fellow Motorcycle Friendly Town, Walcha. ✦ September will see the return of Motofest to Wauchope Showground. The event was held for three years pre-COVID and an online event was held in 2020. On Saturday 17th September it returns again, promising to be bigger and better than ever. Often regarded as one of the most spectacular riding roads in NSW, not only due to the 163kms of twists and turns changing to wide open runs, but also the amazing views and picturesque temperate rainforest, the Oxley Highway is in Wauchope’s backyard. Motofest is "all about motorcycles" And the September event will be no different. There will be plenty of opportunities to see motorbikes on display and in action. It is a very popular ‘Show 'n Shine’ event, one of the most hotly contested in Australia.

SAVE THE DATE - MOTOFEST IS BACK

There are nine categories this year including Best British, American, European, Japanese, Rat Bike, Classic, Paint, Sidecar/Trike and Custom. The bikes will be on display all day with the winning bikes displayed in a 'Meet and Greet' around 1pm. Come and check them out and talk to the owners for some very interesting information and no doubt a few good stories about their pride and joys.

Feature Group - 'The Lady Riders' The Motofest organising committee put out a call out for lady riders to join in on the grand parade ride-in held as part of the opening ceremony at around 10am. Old Pacific Highway

69 Riders will be in attendance from all over the state for this part of the show, there will be bikes of all brands and Acolours.proud display of the women in motorcycling who are excited to show their rides and catch-up with each other and share stories of their bikes and their adventures, it will make a spectacular addition to the parade. There will also be a Peoples Choice competition for the Lady Riders. Anyone who attends Motofest can vote for their favourite bike and The winning bike will receive a custom, handcrafted trophy and one lucky voter will win a ride in a sidecar thanks to Epic Rides and Tours. Motorbike Gymkhana Skill and precision mixed with a bit of fun and excitement, the gymkhana is a great spectacle taking in four events. The first is a slow skill event where each rider must complete the course in the slowest time possible without putting their feet on the Theground.second event is a barrel roll. Again, a precision event with the challenge of having to roll an empty beer keg within your own lane. If the barrel goes outside the lane, you are out of the game. The third is the ball and cone. This is a rider and pillion event and requires riders to gather tennis balls off the top of cones along the track. A great example of teamwork for the rider and pillion. The fourth and final Gymkhana event is called 'Wildlife Rescue'. This one is always a crowd pleaser requiring the rider to carefully navigate the track dodging the local wildlife (stuffed toy animals) while the pillion scoops them up with a net. Four skilled and fun events to delight participants and spectators alike.

Introducing friends to Motofest 2022 Motofest welcomes the involvement this year from members of Port Macquarie Classic Motorcycle Club who will be displaying some motorbike treasures and will share their history and love of their bikes. The bikes will be individually displayed throughout the day with an interview of the owner giving a little background into what makes their bike unique. There are some awesome stories behind these bikes and we look forward to hearing all about them. Tattoo Show Always very popular with the crowd, there will be eight categories including best arm and leg, most realistic, best motorbike related and most tattoos overall. At past events the Tattoo Show was a sight to be seen and the quality of the tattoos was, and will be, very high and very hotly contested. Again, the winners of each category will receive a custom, handcrafted trophy by our local artisan Guy from G.C.W Trading. Trade and Market Stalls plus fun for the kids Plenty of trade and market stalls will be on site with displays of motorcycle accessories, clothing, safety and much more including motorbike shops from Coffs Harbour to Port Macquarie and, of course, Wauchope’s very own RSM Motorcycles.

BRILLIANT COMMUNITY

70 Plus a giant inflatable obstacle course will delight the kids and face painting and spray on tattoos will be free for the youngsters on the day. There will also be a display from Reptile Solutions with reptile encounters and talks throughout the day. Maybe have the chance to get a photo with a snake if you're game! With plenty of food and coffee options including our local Lions Club BBQ and a great assortment of food trucks, coffee, ice cream and desserts, there will be something for everyone to keep you fueled up for a busy day. Local brewer Black Duck Brewery will be there to provide some refreshment options and a place to come together and share some stories and catch-up over a cool drink. From the Motofest Team It's a big day in the Wauchope calendar and we look forward to meeting everyone and sharing the passion for motorcycles and our Motorcycle Friendly Town. At our last event in 2019 the top three reasons for coming to Wauchope for Motofest were to check out the bikes, eat out at local cafes and meet the Wauchope locals. We encourage everyone to come along and share in this day celebrating all things Motorcycle. No need to pre-book tickets, just turn up on the day and pay at the gate. The best part - it's only $10 to get in and kids under 18 are free. The organising committee would like to take this opportunity to thank our major supporters: AMA (Australian Motorcyclist Association), Wauchope Chamber of Commerce and Industry, Port Macquarie Hastings Council, Destination NSW, Shannons Insurance, TAFE NSW, Hastings Co-operative and all of the local businesses of Wauchope who give us both financial support and encouragement.

Reviews...

BLUES NIGHT AT KUNDABUNG WITH SIMON KINNY-LEWIS

v Kingsnake (Official Music Video) - The Simon Kinny - Lewis Band➹

• “Kinny-Lewis is a virtuoso guitarist. Blistering speakers with chromatic runs, modal flights of fancy and arpeggiated passing chords SKL has a deep trick bag." - Blues Blast Magazine USA 2022

Simon has topped The Australian Blues and Roots Airplay Charts with four #1 albums.

About Simon Australian Blues Guitar phenom Simon Kinny-Lewis has performed/ recorded with the cream of the blues crop including Robben Ford, Chris Cain, Josh Smith, Kirk Fletcher and many more. Not only recognised as a virtuoso guitarist but also as an impressive singer and songwriter, Simon’s approach has been described as a musical intersection in which tradition, modern tendencies and personal style are enriched by pure emotional release. Heading north from Sydney later this month is Simon Kinny-Lewis. The Original Sound lounge is backing this artist for this month’s feature act. Pam Hata, the founder of the Original Sound Lounge, will be the opening act on the night.

72

Crawling

✦

His latest “King Biscuit” (2022), produced by Guitar legend Robben Ford and Grammy award-winning engineer Casey Wasner, is receiving great international recognition in the highest ranks of the Blues scene. • “A great accomplishment for both Robben Ford and Simon Kinny-Lewis”

73 • “Absolutely wonderful playing, you can hear the smiles on their faces as they bust through this set. Great on all fronts”. - Josh Smith - leading US blues guitarist • “Simon has a great command on the guitar and vocals along with wonderful songs, teaming up with my friend Robben Ford to make a great, contemporary blues record.” - Kirk Fletcher - leading US blues guitarist. • 5-time Grammy Winner Steve Lukather (Guitarist from Toto, Michael Jackson) commenting on Simon’s 2016 album ‘Street Blues’: “Great man. Your voice has a little Bonamassa in it...which is cool. Love the tune too. KILLER solo!” Book tickets for the show Blues night at Kundabung with Simon Kinny-Lewis The show will be held at Kundabung Hall, on August 27th, and doors open at 7:00 pm. Tickets are $25.00 Event info here: events/431006025720814https://www.facebook.com/ Get tickets now ➹ BRILLIANT COMMUNITY

Francessca O'Donnell - expert Mosaic Artist➸ theouttherecollective.com ➹

74

Francessca has also worked with pebbles, sea glass, wood and Indriftwood.herrustic studio on the edge of the small country town of Beechwood, Francessca shares her creative talent teaching the art of mosaic to many. Creating visual art and mosaics makes her heart sing - she truly loves it!

@outtheredesignandmosaic@outtheredesignandmosaic his month we feature the Fabulous 5 of Francessca, Chris, Kim, Janelle and Olivia - all different and all fabulous!

FAB 5 CREATIVE EXPERTS T

Francessca O’Donnell - expert mosaic artist Francessca is addicted to mosaic! Her work covers mosaics in both 2D and 3D forms, jewellery, painting, etchings and sculpture. She loves to explore and experiment, try new materials, new ideas and play with different materials, colours and textures. There is always something different at Wauchope Creative Hub, home to over 25 local artisans under one roof. Her inspiration for designs is largely from nature, exploring shapes and forms that intertwine and flow with colour the driving force. Other themes she has explored are the curves of the human form and ancient symbols and shapes from Chinese, Maori, Mexican and Mayan mythology and the earth and its many Exploringlayers. various materials has added texture and a certain tactile quality to many of the pieces that draws people in to want to touch and explore the surfaces. The use of both flat and textured finishes and use of glass and reflective tiles also add a fascinating new dimension with the play of light and shadow.

✦

*

Chris Pearce - expert Fibre Artist➸ Kim Last - expert Macrame Artist➸

Janelle has been quilting for over 21 years and, as a member of Wauchope Patchwork Quilters, shares that love and her years of skill and experience with old and new members.

75

* Kim Last - expert Macrame Artist Kim is a graphic designer with more than 25 years of experience. Creativity feeds her soul, and she enjoys expressing herself through many mediums. Kim discovered macrame when she wanted to make a piece for her own home and she fell in love with this beautiful art form. She now draws on her design knowledge to create an array of macrame pieces and prides herself in producing unique, quality items. Kim likes to share her skills and knowledge with others, and has a range of tutorials available to help others learn the beautiful art of macrame. You can find Kim’s designs on Etsy Followwww.etsy.com/au/shop/KILAcreateatKimonInstagram@kilacreate

* Chris Pearce - expert Fibre Artist Chris has been working with textiles her whole life, following in the footsteps of her mother and grandmother who both loved knitting, felting, crochet and sewing. She makes OOAK (one of a kind) felted creations and designs her own knitted and crocheted apparel, using mostly natural fibres, to cater for newborns up to adult with styles to suit Chriseveryone.haswon many awards at our Wauchope Show, as well as at Comboyne show where she was awarded the Australian Wool Board award in 2019. Chris loves working with natural fibres; fleece from all breeds of sheep (but especially our Australian Merino), silk, bamboo, alpaca. She has even included fibre from a Labradoodle in a special made to order item where a customer wanted some of her beloved dog's coat incorporated into the felt piece. Sharing the skill of felting is something Chris is passionate about. Seeing the pleasure on the face of a student when their article comes to life from a handful of sheep's fleece is very rewarding! Felting is hard physical work and takes considerable hours to achieve a finished product but the results are very satisfying. Interested students can see when classes at Wauchope Creative Hub are available through Eventbrite website.

* Janelle Thomas - expert quilter

Janelle won Viewers Choice 2011 at Wauchope Patchwork Quilt show, and on many occasions took out 1st and 2nd places at the Wauchope Show.

BRILLIANT COMMUNITY

Janelle says she loves all aspects of quilting, adding that "there are no limits to what you can make" from placemats, runners, bags, notebook covers to large traditional bed quilts; the fabrics, colours and design options are endless!

Janelle Thomas - expert Quilter➸ Olivia Allen - expert Resin Artist➸

76 She has spent hours making quilts donated to Palliative Care, Bundaleer Nursing Home, Wauchope RSL Subbranch, Veterans and Salam Children's Home in Bali, donated placemats at Christmas time to Meals on Wheels, the Salvation Army, Hastings Court… the list goes on as she is very generous with her time and beautiful Janellecreations.has a colourful range of quilted items for sale at Wauchope Creative Hub and you might even catch her in The Hub for a chat - she loves to talk about everything quilting!

Wauchope Patchwork & Quilters Inc. are having a quilt show 9 to 11 September 2022 Plus a Raffle, tickets available at the Quilt Show also Thursdays at the IGA in Hastings Street Wauchope.

* Olivia Allen - expert resin artist Olivia is the designer and creator of Liv By The Sea, a line of individually handcrafted, beach themed resin Sheproducts.hasa love of creativity in all forms and, combining this creative side with her love for our beautiful beaches, has created "Liv By The Sea". Her range is designed to capture the beauty of the Port Macquarie shorelines.

The beach is Olivia’s go to for relaxation and inspiration. She has the mantra that no matter where you are from, it is nice to have a piece of the beach in your home.

She spends any spare time she has wandering the local coastline, absorbing and being in awe of the stunning colours in the water, the textures in the sand and rocks, the ebb and flow of the rockpools along with the myriad of treasures and interesting creatures to be seen. Olivia’s unique homewares create a talking point and bring the sense of calm that comes from a visit to the beach into your home or office. She told us, “It is my hope that my products will allow customers a moment of mindfulness and trigger happy memories of being relaxed, having fun and being in nature.”

NEW BAND ALERT… GROUP THERAPY

Cam: Being a part of Group Therapy is very enjoyable. Jamming and writing songs together with a bunch of mates is a good time. It’s even better playing live for people and seeing them dance and love something you all made.

Rohan: The ‘Group TherapyTM’ experience is one of cosmically orgasmic proportions, so epic and intense that one might find themselves a completely new person afterwards. Rory: Participation in the enlightenment of Group Therapy is a bewildering and beautiful experience, contributing to the therapeutic evangelisation of the future for rock music.

Nick: Group Therapy is the first ever true rock ‘n’ roll experience.

Band members: Cameron Alford – Vocalist Rohan Gibson – Electric guitar

Tell us a bit about what you love about being in Group Therapy?

77BRILLIANT COMMUNITY

The five piece band members are all still at school and making waves on the youth Incorporatingscene. elements of alternative rock, funk, punk and hard rock, their eclectic sound is gaining them new local fans and seeing them as regulars on the live music circuit – playing at Hot Tropics, More Often Than Not and recently Port Macquarie’s FormedArtwalk. in 2021, their love of music forged a strong bond between the band mates which has seen them perfect their funk inspired sound through songwriting sessions at their managers studio V-Rock which is above Planet X.

✦ Hailing from Port Macquarie, Group Therapy are crammed full of melancholic riff making, anthemic choruses and wildly sung melodies.

Josh: Group Therapy is an experience like no other. An experience that could make anyone moist to the core. Check out their next gig ➹

Group Therapy - Senior Band RockFest 2021➹

Rory Bush - Bass guitar and Keyboard Nick Horder - Drums Josh Gleeson - Electric guitar

Food offerings to the spirits during the Hungry Ghosts Festival➸

Mark this date - August 12, 2022. That's when the Chinese celebrate this most unusual festivalthe Hungry Ghosts Festival! If you've never heard of it, you may be intrigued by what exactly it is. The Mexicans have their famous Día de Muertos with their trademark colourful skulls. And the Chinese have their Hungry Ghosts Festival. It's one of the most important traditional festivals celebrated in China and by Chinese all over Asia. You may know it by its Chinese name, the Zhongyuan (Chinese: 中原) Festival. It falls on the 15th day of the seventh month of the lunar calendar, and this year, it's on August 12th in 2022. The entire month itself really ✦ No, don't call the Ghostbusters! It's just the Hungry Ghosts Festival! lasts from July 29th to August 26th. During this period, the spirits roam the realm of the living and people prepare rituals and food offerings to honour their ancestors and appease these spirits that are roaming around. If you're squeamish and perhaps have seen one too many horror movies, rest assured. This is nothing to be terrified of. Perhaps after reading this you'll see this festival in a very different light. Spirits roaming free The Chinese believe that during this month, the gates of the underworld open up and the spirits come out to play. They are free to roam, 'enjoy' themselves, perhaps visit the people they love and miss, or go to places they used to frequent. By the end of the month, the spirits return again to the Thisunderworld.isnotastory to scare adults, much less little children, and it's not so important if you believe in the underworld or not. Just the idea of the souls of people who have passed on and can actually return, albeit briefly, from wherever they are for a visit, is actually rather moving if you think about it. And if these are simply our ancestors swinging by for a visit, then there's really nothing to fear now, is there? Horror movies are made to scare and entertain and if they didn't do their job you'd vote them down on the Rotten Tomatoes website.

78

SEEING THE HUNGRY GHOSTS FESTIVAL IN A DIFFERENT LIGHT

79BRILLIANT COMMUNITY

2. Share the good food What's a celebration without good food? The Chinese are famous for their culinary delights, and you can be

The Hungry Ghosts Festival is a time for the living to pay respects to their ancestors, to remember fondly loved ones who have passed on, and to remember to be kind to wandering spirits who may not have anyone to mourn them or miss them. It is also a sobering reminder that we who are living, are also beings.ephemeral v

1. Speak to those who have passed on No no, we're not talking about dusting off that ouija board you have in the closet. Many of us may have photographs of family members and loved ones who have passed on in our living spaces. Remembering loved ones who have gone is not always, or only, about grief. It's also about celebrating who they were and what they have taught us during the precious time we've shared with Thisthem.is a time to fondly remember them, perhaps think about a message you'd want to tell them, and come up with your own little prayer to these loved ones, and trust that from wherever they are, they are also sending us their blessings.

sure that there isn't a single Chinese festival that doesn't involve food of some kind! And the important thing about good food is that when it is shared, it tastes even better! The Chinese prepare food offerings to the spirits three times a day. The Chinese believe their ancestors will visit their homes and partake of the meals offered to them. You may have seen these offerings being set up. Three bowls of rice with three accompanying sets of chopsticks and why not include three cups of wine too to finish off the meal? There is no limit to what you wish to put out as offerings - meat, fruits and sweet things. Perhaps you may have a pet that has passed on and you can put out some of their favourite doggy or kitty treats on a dish. After all, a pet is very often treated as a member of the Iffamily.youreally want to go the extra mile and prepare something special for your ancestors, why not try this traditional P'ng Kueh recipe from My Blue Tea?

*Note: If you're dining in a Chinese restaurant or invited over for a meal at a friend's place, never stick your chopsticks standing up straight in the middle of your rice bowl. That is actually a 'secret code' for the spirits to indicate they are welcome to eat

Right now we can enjoy a full life and partake in all the joys that life bestows on us. Why not share some of what we have with the spirits? How to celebrate

80 here! So unless you generously wish to share your rice with them, otherwise, place your chopsticks on the little piece of chopstick rest, or on the table if there isn't one.

4. Live entertainment This is a typical sight during this month. There will be special live performances, typically some form of Chinese opera, or singers belting out old favourites. You are welcome to watch if you wish, but bear in mind that you do not rush to take a seat in the first and second rows of the performance. These seats are reserved for the spirits, as they are the special guests during this time. Burning incense and candles as offerings to spirits➸

Now this is the really interesting bit and for those who grew up with the culture you won't be too surprised and may not even realise how strange this really looks to people who don't know anything about it! You may have seen people outdoors, burning either incense, joss papers, red candles or sometimes different objects made of paper. Before you start having an attack of eco-anxiety, there are metal containers that are placed strategically around for people to burn their offerings. So nobody is going to start a fire by burning offerings anywhere. Even culture has to move with the times, and you'll see people burning paper effigies such as mansions, luxury cars, and even smartphones! These are meant to be offerings or gifts for the spirits and burning them is a way for the spirits to receive them on their end. We are very tickled by the idea of burning smartphone effigies, because we wonder if it means spirits will make contact from the other side, the smart way! We hope they have optic fibre working well where they are! At the end of the day, it's the thought that counts. So don't worry if you're not comfortable burning offerings. Perhaps even just lighting a white candle at home and spending a quiet time in contemplation is offering enough.

3. Burning offerings

There are enough monsters under the bed, so why not use this festival as a time to nurture compassion and gratitude?

The Hungry Ghosts Festival can have its beautiful side too and it's not all about scary spirits who seem literally hell bent on messing with the living. Popular movies have put spirits and the after life in a rather negative light, and the person writing this article also has an expiry date at some point and would rather not think that what's coming after is all doom and gloom! And really, what if spirits are not really 'hungry' for food but 'hungry' to experience the reminder of what their past lives were like and to see again the people they miss? If you are 'hungry' for some food for thought on the realm of the spirits, watch Japanese director Hirokazu Kore-eda's 1998 masterpiece After Life (also known as Wonderful Life ワンダフルライフ Wandafuru Raifu) where spirits are asked to choose one single precious memory to take with them as they pass into the next world.

81

Live entertainment during the Hungry Ghost Festival on 1:39'➹ 5. Lead them gently home This is our favourite - it's the gentlest way of celebrating this festival. Some people in Chinese communities around the world would write the names of their loved ones who have passed on on paper lanterns with a candle inside. These lanterns are left to float down the river as a gentle guide for spirits to find their way back to the spiritual realm. It serves to also carry away bad luck, and dispel ill fortune. Think of it as a sort of GPS for the spirits. Yes, they've had their time during this month to visit and enjoy, and as all good things come to an end, we can also gently guide them and show them the lighted path back home. If you can't find one of these paper lanterns where you live, why not fold a little paper boat and let it float away? Find your own meaningful way of celebrating the festival. A new narrative Many talk about the superstitions to avoid during this period of the year. That makes for highly interesting conversations, but it also presents this festival as a somewhat dreaded or frightening one. Could we give especially to our children, a kinder, more human narrative of this festival?

BRILLIANT COMMUNITY

"I'm going to keep you inside me, forever. I can't bear to be forgotten by any more people." - After Life (1998) dir. Hirokazu Kore-eda. Perhaps that's all spirits (or living humans) want. Not to be forgotten. That's what the Hungry Ghosts Festival is for. It's to feed beautiful memories of loved ones who have gone physically but are very much alive inside of us in what they have taught us. So how are you going to be celebrating the Hungry Ghosts Festival this year?

Trailsevents.andTails➸

WHAT'S ON IN AUGUST & SEPTEMBER 2022 ON THE MID NORTH COAST

Sunday 21st August 7:00 am - 11:30 am Lot 196 Pembrooke Road, Telegraph Point, New South Wales, www.trailsandtails.com.au/2441

COMMUNITY EVENTS Trails and Tails You know dogs are man's best friend, and they hate missing out on jumping in the car and heading to a new place to sniff and explore with their best friend on the trails. So join a race where you can bring them along in the beautiful Cairncross State Forest near Port Macquarie on the Mid North Coast of NSW.

Australian Surf Championships Annual Event Come down to Town Beach and watch the very best in Australia compete for a title in the Australian Surf Championships.

82

Running Until Monday 22nd August 7:30 AM - 4:00 PM Town Beach, Port Macquarie, New South Wales, 2444 Outdoor Cinema - Encanto Watch Encanto under the Stars! Get ready to sing and dance along to this Disney favourite for a magical event at the FIRST outdoor cinema premier. Entry is FREE and bookings are not required. Bring a rug, chair, snacks and family and friends. More info: 02 65 88 7201 Saturday 20th August From 6:00 PM ✦ Community events, Arts, Culture and Entertainment, Markets, Business

83 Westport Foreshore, Port Macquarie NSW, Australia 2444 Let's Talk About Anxiety in The Hastings This informative local forum boasts an excellent range of speakers, from Senior Clinical Psychologist Dr Rocco Crino, a widely respected authority on anxiety disorders, to our person of lived-experience and peer support worker Paul Leonard. Learn more about anxiety, social anxiety, and register for this free event by WayAhead Mental Health Association. Thursday 25th August From 5:30 PM Rydges 1 Hay St, Port Macquarie NSW 2444 BRILLIANT COMMUNITY Register Here ➹ Check out events at Port Macquarie Library film-club/au/event/the-mystery-of-henri-pick-8755-10:00amfilmWednesdayhttps://mnclibrary.org.au/events/31stAugust-Thismonth’s‘TheMysteryofHenriPick’PortLibraryMeetingRoomPhPortMacquarieLibrary:026581Registerhttps://mnclibrary.org. High Tea and Fabulous Fashion Parade Ditto invites you to a High Tea and Fabulous Fashion Parade. Enquire at Sea Salt Cafe. Saturday 3rd September 2:00 PM to 5:00 PM Port Macquarie Race Club, 283 Oxley Highway Port Macquarie, NSW, Australia 2444 The AMA Moto Fest Wauchope Sat 17th September From 9:00 am Wauchope Showgrounds, 93a Oxley Wauchope,Hwy. NSW, Australia 2446 Moto Fest is A Celebration of all things Motorcycle and with Wauchope being A Motorcycle Friendly Town you should join in on the fun. There will be activities and entertainment at this family friendly event including the Motorcycle Show N Shine, Tattoo Show, Trade Stalls and Kids activities. Admission Adults $10 / Kids Under 18 Free. For more info, go to www.motofest.com.au

Natalie Davis at Flow Bar 31 David Street, Old Bar

Wednesday 24 August Big Day Out 12:00pm to 3:00pm

Simon Kinny Lewis Band live at The Kundabung Hall

Saturday 27 August 6.30pm

Come

84 ARTS, ENTERTAINMENTCULTURE, Saturday 20th August

Natalie is a singer songwriter, based in Hunter NSW. She is a flexible contemporary performer allowing interests in jazz, folk, and rhythm and blues to weave their way into her style.

Book Tickets ➹

Saturday

Port Adventure Cruises Rhythmboat, Town Wharf (end of Clarence Street, Port cruiseportmacquarie.com.auBookMacquarie)onlinewww. or Ph: 0434 199

Sunday 28 August Blues Brothers Duo 2:00pm to 5:00pm Port Adventure Cruises Rhythmboat, Town Wharf (end of Clarence Street, Port Macquarie) Book online cruiseportmacquarie.com.auwww.or Ph: 0434 393 199 27 August 7pm

Port

Seniors

Saturday 27 August International Play Music on the Porch Day Friday 2nd September

Sunday 21st August Blues Brothers Duo 2:00pm to 5:00pm Adventure Cruises Rhythmboat, Town Wharf (end of Clarence Street, Port com.auBookMacquarie)onlinewww.cruiseportmacquarie.orPh:0434393199

TC Cassidy VIP Pre Album Launch

393

Dave Graney and Clare Moore - duo with www.trybooking.com/events/landingTicketsWauchope7:30pmguitars/vibes/keys/melodicadoors8pmshowCommunityArtsHall

Two time golden guitar nominee, TC Cassidy returns to country music after almost 30 years. TC Cassidy's anticipated new album is due for release on the 16th of September. and be a part of this special 'VIP' Album Pre Launch at Bago

Saturday 3rd September Paint and Sip PLUS wine tasting Crafteas at the beautiful Bago Maze and Winery (near Wauchope) for fun filled and creative day Startout!the day with a wine tasting experience with the friendly and knowledgeable staff at Bago. Next it's time to let the creative juices Crafteas experienced and friendly painting tutor, will guide participants through step-by-step how to paint this fun and bright Highland Cow. The painting fun will continue for approximately 3 hours. During this time, participants will be provided with delicious grazing boards to nibble away on whilst painting. 11:00 am - 3:00 pm Bago Maze and Winery 197 Lambs Road, Herons Creek, New South Wales, 2443 More info: 167610:00Killabakhcountrycrafteas.com.au/http://www.DayintheCountryamto03:00pmComboyneRd,Killabakh NSW The2429heart

JoinexperienceCountry

of Killabakh's close knit community is its heritage hall and each year the community gets together to raise much needed funds for its maintenance and improvements by presenting "A Day in the Country". This is not only a great fundraiser but also a unique opportunity for people to experience Country Life. The family friendly day out includes a huge variety of quality markets stalls - plants, local produce, a stunning choice of craft, gourmet food, books, clothes, jewellery, collectibles and gifts; novelties and quirkiness no exception!

Sunday 11th September Good Morning Vietnam Music from the Vietnam war era Glasshouse7.30pm Port Macquarie, 3042 Clarence St, Port Macquarie, Australia

BRILLIANT COMMUNITY

85 Tavern, and hear TC perform her album and more with her band.......be the first to grab your signed copy of 'Travelling Heart' prior to release date. Bago Wauchope,Tavern,New South Wales, 2446 www.eventbrite.comTickets

Countryflow!

86 MONTHLY MARKETS SUPPORT LOCAL Bring your family and join the markets trail, you will discover the finest from our regions local businesses, farmers and artisans. EVERY TUESDAY Real Food Local Produce Markets 12.00pm to 6.00pm Port Central Hay Street Forecourt, Port https://portcentralshopping.com.auMacquarie EVERY THURSDAY Kendall Bazaar and The Meeting Place 9am to 12pm Kendall Community Centre 19 Comboyne Street, Kendall EVERY SUNDAY Port Macquarie Art Society Market Bazaar 8.00am to 1.00pm Hamilton House 198 Hastings River Drive, Port http://www.pmas.org.auMacquarie FIRST SATURDAY Kempsey Riverside Markets 9.00am to Eden12.00pmSt,Kempsey NSW SherwoodUnitingUnitinghttps://macleayvalleychamber.com.au2440ChurchMarkets8amto11amChurchCnr.OxleyHighway&Rd,PortMacquarie FIRST SUNDAY Grown and Gathered Community Markets 9.00am to 12.00pm 1493 Pappinbarra Road, http://www.hallidayspointlions.org.auHeadHallidaysBlackheadKendall12pmKendallgrownandgatheredcommunitymarkethttps://www.facebook.com/PappinbarraCommunityMarkets9amtoShowground.KendallLionsClubCarBootMarketPointShoppingVillageBlack7.00am-12.00pm SECOND SATURDAY The Foreshore Markets 8.00am to Westport1.00pm Park Cnr Buller & Park Streets, Port https://www.visitnsw.com2422178.00am-12.00pmGloucesterjohnsrivercommunityhallwww.facebook.com/JohnsJohns12.00pmJohnswww.marketplaceevents.com.auMacquarieRiverMarkets8.00amtoRiverCommunityHall54-56RiverRd,John’sRiverFarmersMarketDenisonSt,GloucesterNSW THIRD SATURDAY Forster Farmers Market 8am712pmLittle St, Forster, NSW, 2428, https://barringtoncoast.com.auAustralia SECOND SUNDAY Forster Town Market 8am -1pm Oyster Parade, Forster NSW https://barringtoncoast.com.au2428 THIRD SUNDAY Laurieton Riverwalk Markets 8.00am to Cnr.1.00pmTunis & Short Street, www.riverwalkmarkets.com.auLaurieton FOURTH SATURDAY Wauchope Farmers’ Markets 8.00am to Wauchope12.00pmShowground High Street, www.wauchopefarmersmarket.com.Wauchope au Tuncurry Markets 8am to 1pm John Wright Park, https://barringtoncoast.com.auTuncurry FOURTH SUNDAY The Local 8.00am -1.00pm Maritime Museum William Street Port www.marketplaceevents.com.auMacquarie LAST SUNDAY OF EACH MONTH Pacific Palms Market 9am to 1pm Pacific Palms Community Centre, The Lakes ElizabethWayBeach, NSW https://barringtoncoast.com.au2428

87 BUSINESS EVENTS Wauchope and Hinterland Business Award Gala Dinner 2022 Saturday 27th August 2022 From 6:00 PM Wauchope RSL HinterlandbybusinessThePh:www.wauchopechamber.com.auClub0422210824votesarein!CelebratelocalandshowyoursupportattendingtheWauchopeandBusinessAwardsGala Dinner. Micro Business ForumCoffee Connects Thursday 8th September From 10:00 AM Little Turkey, 1/18 Park St, Port Macquarie NSW 2444 Second Thursday of every month. Get to know other business owners at the Micro Business Forum Coffee org.au/eventshttps://www.microbusinessforum.Connect. AMSA - Australian Malaysian Singaporean Association In conversation with Sam Lim MP, Federal Member for Tangey Tuesday 23rd August From 3:30 PM Online RegisterEventnow for our upcoming Conversation with Sam Lim MP Register Here ➹ Federal Member for Tangney in Western Australia, in collaboration with Asian Australian Alliance. BRILLIANT COMMUNITY

88

89 ✦ ✴ SPORTS Brilliant BRILLIANT SPORTS

✦ Aussie born and bred, Celest Muriel Hansen is now making huge strides in the world of Muay Thai.

THE AUSSIE MAKING HISTORY IN MUAY THAI

Having already made history in the drive for equality in the sport and with a professional contract now in her sights, the future is bright and full of opportunity for this talented and determined Onfighter.August 13th Celest headed into the ring at Lumpinee Muay Thai Stadium in Bangkok, Thailand for the biggest fight of her career so far. However, despite the magnitude of the occasion, the Aussie fighter displayed no nerves or doubts. She is, after all, a trailblazer who has already been a part of history at the famed home of Muay Thai.

90

Hailing from Sydney, Celest is now based in Phuket where she religiously hones her craft. The August 13th fight pitted her against Thailand’s Phetsinin Sor Phuangthong in the women’s atomweight quarterfinal as part of the Fairtex Fight Road To ONE Thailand tournament. She was one of only two foreign female fighters selected for the Celestcompetition.wonthe fight with a devastating second-round technical knockout and now advances to the semifinal contest in her division. Should she win the division Celest will receive a six-fight contract with ONE Championship worth US$100,000. Singapore-based ONE Championship is Asia’s largest sports media property featuring bouts in mixed martial arts, submission grappling, kickboxing and Muay Thai –some say Asia’s equivalent to the UFC although with aspirations to be even bigger. The 28-year-old took up the sport six years ago and moved to Phuket in 2017. She trained at the now defunct Kaewphitak Muay Thai gym, devouring fights every Friday and Sunday evening until she had won the Patong Stadium Belt and the PK1 51kg World Championship belt.

However, despite her rapid rise, opportunities for women were few and far between outside of local contests and official rankings were nonexistent. This was especially the case at Lumpinee where women were banned from competing and even sitting ringside. Celest recalls being part of the corner team for a male fighter a few years ago and seeing signs stating no women were allowed to enter or even touch the ring. “I had a security guard approach me and ask me to move away,” she says. Celest saw it as a challenge, stating that one day she would fight at the acclaimed venue, an assertion that was met with much derision at the time.

However, once the rules were reversed in November 2021 and women were permitted to compete, Celest made history when she became the first ever female athlete to set foot in the ring at Lumpinee to fight Kullanat Ornok. She may not have won the fight that evening but the result was somewhat secondary in comparison to the significance and enormity of the occasion. Being part of the first ever female bout at such a hallowed venue was a far bigger win. “We have come such a very long way. This was so much more than just a fight,” Celest told AFP at the “Whentime.Isaid I wanted to be the first woman to fight at Lumpinee Stadium people laughed at me and said that was never going to happen,” she recalls. Focused and determined, Celest achieved her goal and proved a lot of people wrong. Now ranked as the WBC Muay Thai Light Flyweight world number one, the future is bright and there is clearly still much more to come from this talented, driven young fighter who has done much to change attitudes and open up opportunities for women in the sport. She passed her most recent test at Lumpinee Stadium and she is full of confidence with what is to come next, as she should be. After all, she has already made history there once before.

91BRILLIANT SPORTS

Man’s best friend kicking a footie around, swimming laps of the pool, swinging a golf club or serving an Oface?course not! However, dig a little deeper and there are more than the fair share of sports-related activitives that our furry buddies can get involved in. The majority of dogs are full of beans with boundless energy levels and that is something that needs to be addressed. They absolutely need to burn off that pent up energy which often means more than just a brief walk around the block or in the local park. Maybe you could consider introducing your beloved pooch to some of the Thefollowing!most obvious commercial sport that springs to mind is greyhound racing. Established over 100 years ago, typically dogs will race around an oval track chasing what they believe is a hare or rabbit but what is actually an artificial lure, most often a mechanical form of windsock. It is a sport that is hugely popular in the USA, UK and Australia where it has become a key component of the betting and gambling industry. Australia is home to the world’s largest commerical greyhound racing industry which saw $7 billion placed in bets in 2019/20 alone. Animal rights and welfare groups are highly critical of the sport though, especially the fact that so many of the dogs are left abandoned after they retire from the track. Adoption movements spearheaded by kennel owners have subsequently become more prevalent in recent years to help the retired dogs find homes – recent ✦ On first glance the words “dog” and “sport” do not really seem to sit comfortably in the same sentence.

92

Sled dog racing➸

figures showing adoption rates of over 95% in the United States alone suggest they are on their way to achieving their Takegoals.away the oval course and add some snow and you have sled dog racing! This winter sport sees timed competitions where a team of dogs pull a sled manned by a driver around a designated course with the quickest team declared the winner. Races include sprints which can be anywhere from four to 100 miles, mid-distance which is between 100 to 300 miles and long-distance where anywhere between 300 to over 1,000 miles are covered. Typically categories include four-dog, six-dog, eight-dog and 10dog teams.

Sled dog racing is especially popular in the Arctic regions of the United States, Canada, Russia, Greenland and some European countries. It was a entered as a demonstration sport at the 1932, 1952 and 1994 Winter Olympics although it never did receive official event recognition or status. Surf’s Up! Maybe when the Beach Boys sang the iconic lyrics “Let’s go surfing now everybody’s learning how” in their 1962 hit Surfin’ Safari they were also referring to dogs when they said everybody! Regardless, dog surfing is very much a thing, starting way before the Wilson brothers formed their legendary group.

THE WOOF-DERFUL WORLD OF DOGS IN SPORT!

On the pull! Still in the water we have what is known as Dock Diving or Dock Jumping. This sees the dog jump from an elevated height into a pool or body or water with the goal to achieve the furthest distance. The jump distance is measured from the lateral midpoint of the end of the dock to the point at which the base of the dog’s tail breaks the water’s surface. Think of it as a derivative of long jump, with water instead of sand, and you’re on the right track! Since originating in 1997, annual competitions have sprung up in the likes of the USA, UK, Australia, Germany and PullingAustria.sports have increased in popularity in recent years whereby dogs and humans combine to engage in the likes of Canicross (cross country running with dogs), Bikejoring (cycling with dogs) and Skijoring (skiing with dogs). Canicross is especially popular in the UK and across Europe where regular events are held. Distances vary, anywhere from a mile up to 28 miles or Elsewhere,more. there is “Disc Dog”, otherwise known as Dog Frisbee - and there are no points for guessing how this works! Owners and dogs combine whereby the former throws the frisbee for his or her furry friend to catch in their mouth. Competitions are staged globally with categories including long distance, freestyle and toss and fetch. It is a hugely popular sport, mainly due to its simplicity and accessibility, and dog disc clubs can be found all across the world, including in Australia. Finally we have what is known as “Dog Agility”. This sport sees a handler assist an unleashed dog through an obstacle course race which is judged by both time and accuracy. Handlers are not permitted to interact by touch and can only use their voice or gestures to help the dog navigate the course which emcompasses tunnels, jumps, hurdles and various other obstacles. It is a complex sport that requires intensive, disciplined training to achieve an exceptional understanding between the handler and the dog. So there you have it, a brief but hopefully engaging and entertaining insight into the wild, sometimes weird but always wonderful world of dogs in sport! Maybe, after all, it isn’t such a stretch to imagine our furry friends one day kicking a footie around, swimming laps of the pool, etc...

The Loews Coronado Bay Resort Surf Dog Competition at Imperial Beach in California is considered the biggest event of its kind. In June 2012 the competition saw over 50 dogs participate and also three Guinness World Records broken, including a new record of 18 dogs on a surfboard, the most ever Closerphotographed!tohome

93

BRILLIANT SPORTS

we have the Noosa Surfing Dog Championship, an annual event founded in 2012 and organised by online retailer VetShopAustralia. It is an invitational event in which eight to 10 dog-human-combo teams use stand-up paddle boards to win the Best Wave Award which is judged on skill, coordination between dog and person, and entertainment value. This year’s event took place on March 5 at First Point in Noosa with Team Freddy claiming the trophy.

Originating in Hawaii and California back in the 1920s, dog surfing has grown in popularity over the years whereby competitions and exhibitions now feature regularly in various coastal areas of the United States. Dogs are actually trained to surf the ocean’s waves on either surfboards, bodyboards, skimboards or windsurf boards, either alone or joined by a human companion.

The doggy version of the long jump!➸

94 Etienne Regin with his daughter Victoria ➸

95 ✦ ✴ FATHER'S DAY Brilliant BRILLIANT FATHER'S DAY

➹

Technology has crept into every corner of our lives to dominate whereby people now tend to spend more time staring into a screen than talking to other human beings; words like “bad” and “sick” now denote positive rather than negative sentiment and attention spans have decreased dramatically to the point that a worrying number of people consume their news in bite-size portions in less than 280 characters! What hasn’t changed in popular consensus is how important the role of the father is in the family dynamic, integral in providing a sense of safety and security, a grounding point and sound moral compass. Fathers, as with mothers, are role models to their children and carry a huge responsibility ✦ So much has changed in the world in the past few decades. as to how their children see and make sense of the world while promoting the growth of self-worth, love, tenderness, humour, compassion and strength. A father’s impact on the lives of his children is, undoubtedly, profound. That’s not to suggest there hasn’t been change and what now constitutes our perception of the traditional nuclear family differs even when compared to a decade ago. The father as breadwinner at the office all day while the stay-athome-mother cooked, cleaned and tucked the children up in bed each evening is very much a thing of the past. As opportunities have evolved and progressed for women in the corporate world so has the ability for the traditional role dynamic of parenting to shift.

Conversely, being a father nowadays looks and feels very different to how it was 20, 30 or 40 years ago. Dads have always come in all different manner of shapes and sizes but, as society and attitudes have progressed, so has the definition of fatherhood and being a dad. Now, fathers can be single or married, step-parents, adoptive; with gay marriage becoming legalised in many parts of the world, adoption is now a viable choice for LGBTQ parents.

96

THE TALE OF MODERN DAY FATHERHOOD

Modern Fatherhood with Etienne & Victoria

Pop Culture Papas Aristotle’s mimesis suggested that art imitates life so it is no great surprise to see this shifting dynamic of what consitutes a modern day father reflected in a variety of pop culture concepts such as movies and TV. This

Work from home and enjoy your family➸ is arguably best illustrated in the hugely popular mockumentary-style family sitcom “Modern Family”. Heralded for its positive portrayal of LGBTQ families on TV, two of the central characters in the show are gay married couple Cameron and Mitchell, who adopt a daughter. They demonstrate the normal challenges and frustrations that any couple encounter when raising a child (the tantrums, the choosing one parent favourably over another to curry favour then switching, etc) but also showcase how modern day fatherhood has developed to incorporate values and prejudices that same-sex couples have to contend with or are perhaps more atuned to such as acceptance, tolerance, difference, inclusivity. Of course, that isn’t to suggest that the traditional malefemale parent dynamic is remiss of these values but it does demonstrate how the very definition of fatherhood has evolved and grown into something much broader, accepting and, ultimately, Therewonderful!aremany other TV shows and movies that explore this dynamic but a couple worthy of note are: the “The Bravest Knight”, an animated fairy tale about a gay dad recounting his adventures to his adopted daughter; the 1996 film “The Birdcage” where the late Robin Williams and Nathan Lane play a gay couple about to meet the conservative parents of their son’s new fiancé; 2018’s “Ideal Home” where Steve Coogan and Paul Rudd play a gay couple who suddenly find themselves raising a young boy when a long lost grandson arrives on their doorstep; and Swedish film “Patrik, Age 1.5” where a gay couple decide to adopt and believe they will soon be welcoming a toddler only to find out their new addition to the family is actually a teenager of 15, not 1.5, and, worse still, a homophobe! Stay home! In recent years we have seen an uptake in the number of fathers who opt to stay at home so as to spend more time with their children. As a flexible working dynamic takes us increasingly from the boardroom into the living room, it is now much more commonplace and socially acceptable for one or both parents to work from home or combine a hybrid home-office approach, something that COVID-19 only exacerbated of course. As previously alluded to, the changing role of women in the workplace has had a profound effect on the role of dads and how they now integrate into the family. Nowadays it is far more common to see the woman chasing career progression while the man stays at home, be he working or otherwise.

97

BRILLIANT FATHER'S DAY

Also, post-childbirth, it is no longer just the mother who takes maternity leave as paternity leave has become far more accessible to fathers in recent years –indeed in the United States, the amount of parental leave is the same for men and women. As a result of more dads being home they are inceasingly becoming more entrenched in routine family duties –changing nappies, doing the laundry, cooking meals, running the kids from A to B and general housekeeping chores are no longer consigned merely to mothers as dads step up to the plate. The popular American tag “soccer mom” now very much has an equivalent of “soccer dad”! We must also pay heed to the fact that as society and attitudes have evolved, so has the behavioural role of a father. Traditionally, dads were widely construed as the disciplinarian of the family, the stern one who would dish out the punishment when a child misbehaved. Remember the phrase that many mothers would often threaten their naughty children with back in the day, “Just wait until your father gets home”? That dynamic has changed and men in general now exhibit are a far more sensitive side, particularly evident with their children where the values of understanding, nurturing and care are fundamental. As widespread society and attitudes continue to evolve so do we as people in the way we behave, which extends to parenting. The role of a father is a complex and evolving concept - it arguably always has been and always will be. This Father’s Day we at Brilliant salute all the wonderful dads out there, no matter their shape or size, status, sexual orientation, etc. And to all the dads that are no longer with us we send genuine respect via a moment of pause and reflection.

TWO WONDERFUL CHILDREN AND ANOTHER ON THE WAY!

✦

Jacob Young has a daughter Courtney who is 9 years old and a son Benjamin who is 7. The founder of Dinki Co, he believes that we are in the midst of a time that represents great change and thinks most would agree. He loves that society, in general, is moving towards a more inclusive attitude and finally realising that we should celebrate each other's differences instead of fearing them. Jacob told us, “I am stoked that my children will grow up in a world where they will be freer to act in a way that is representative of who they are at a core level than any generation before them. The fact that most men participate more around the home and in raising the children is a welcome change to the era of our parents and grandparents too. Happy Father's

Day!Jacob

Young with partner Katie, daughter Courtney and son Benjamin➸

98

v

"I am proud to contribute to a world where my son and daughter can both have the same advantages in life regardless of their age, sex or identity. I believe that being a modern dad means being more open-minded and inclusive than our predecessors and really cultivating children to feel comfortable being who they feel they are. I also think that breaking the cycles of the past is bigger today than ever.”

"I think some of our parents (in trying to help us) instead left us with a feeling of being unsure by "warning us" of all the things that can go wrong. I intend to highlight everything that can go right instead. I want to trust the children's judgment so that they learn to trust their own judgment too.

Courtney and Benjamin at Timezone Arcade➸

99 to his full potential at school but I am not concerned about his longterm progress. Like his sister, he is extremely intelligent and I am often astounded by the fact that I am privileged enough to have the opportunity to help cultivate amazing humans. He is really so curious about everyday things and often peppers me with questions about why things are or how they work.

BRILLIANT FATHER'S DAY

Jacob´s wish for his children “All that I wish for my kids is that they head into their late teenage years and early adulthood with a good sense of who they are at a core level. I want them to be confident in the choices they make and back themselves regardless of outside noise.

"I think involving them in decisionmaking processes from an early age and teaching actions and consequences is important, but it should be handled with care so as not to intimidate them out of the great things that all of us as human beings are capable of."

About his children

“My beautiful fiancee and I are also expecting another addition to the family in February 2023," Jacob told us, proudly. "I couldn't be happier with the news and am so looking forward to meeting the new bundle of joy.“

“Courtney is so caring and really enjoys spending time together at Timezone or the movies or even just chilling out around the home together," said Jacob. "She is very artistic and can really draw, colour, and paint exceptionally well. She loves listening to music when we drive and around the house. She enjoys catching up with friends and family and is very social. She also applies herself to learning new things at school. “Benjamin has the most gentle and beautiful soul. He loves to cuddle on the couch while watching the telly. He can be frustrating from time to time as he is really picky with food and does not always apply himself

Aladdin’s cave occupying the lower floors of the historic 11-storey Dymocks Building: hundreds of thousands of the latest books in every imaginable category, a reading nook furnished with comfortable armchairs, a popular gallery cafeteria and a gift shop that’s a must-trawl for unique presents, cards and Here'swrapping.moreabout this fascinating property BOOK REVIEWS The Story of Russia by Orlando Figes What do men talk about when they get together at the pub, around the cards table or anywhere else together in a group? Sport, of course, but also conquests, I think: conflicts, wars, current affairs surrounding competing interests, whether individuals, ideas or nations.

Retailers across nearly every category struggled during COVID. However, one sector thrived: the retail book market grew 15% in a 12-month period between 2020 and 2021, at the peak of the pandemic. It’s understandable that, confined indoors, Australians took to reading in big numbers. Yet that trend is not dwindling as we emerge from our home cocoons: our country’s biggest bookseller, Dymocks, has put its faith in a continuing upward trajectory, announcing it will open at least 20 more stores between now and 2024. New technology is an integral part of the retail expansion – but the freshly prosperous bricks and mortar model will see the household name grow its network across the nation from 50 to 75 That’soutlets.great news for the chain begun by William Dymock in Sydney in 1879 and that remains Australian-owned today. Dymocks’ vast landmark store on George Street, Sydney, is an ✦ One of the most enduringly popular gifts for Father’s Day - this year on Sunday September 4 - is a good book. Susie Boswell suggests a couple of new titles suitable for the occasion.

A small section of Australia’s biggest book store, Dymocks.

This year, the Vladimir Putin-led invasion of Russian troops into Ukraine has no doubt occupied many of those conversations. The atrocities, the inhumanity, the despair – as we, so far away in Australia, grapple with news that’s as mystifying as it is horrifying, the root of it all possibly escapes many of us in our own preoccupations such as whether to wear a mask, or the length of the airport queue. So a new release by award-wining author and historian Orlando Figes is a timely exposition of the myriad events and ideologies behind the brutal Russian incursion, with Ukraine the locus of a “clash of London-borncivilisations”.Figesstudied history at the University of Cambridge and has held teaching posts at Cambridge and at the University of London. His nine bestsellers on Russian and European Check out the property ➹

100 A LOOK AT A BOOK

Photo: Susie Boswell ➸

BRILLIANT FATHER'S DAY

The Quiz Masters by Brydon Coverdale Behind the self-effacing mien of Channel 7’s The Chase’s Brydon Coverdale lies a razor-sharp memory that has taken Coverdale on a remarkable journey across Australian TV’s main quiz shows over almost three decades. If ever a book was “unputdownable”, Coverdale’s fluid, easy-reading style - perhaps honed by 11 years as a leading cricket journalist - means this one is it.

Popular identities come to life: Tony Barber, David Poltorak, David Astle, Rob Brough, John Burgess, Jennifer Byrne, Peter Carey, Tony Delroy, Philip Clark, Jack Davey, John Dease, Larry Emdur, Anne Hegerty, Barry Jones, Mark Labbett, Virginia Noel, Fran Powell, Simon Reeve and so many more, each evoking memories reaching back sometimes 50 years and into the present day. An entertaining, fun device on every page is that questions the author poses as part of his narrative are answered for reference in the footnotes, offering the reader a quizzing game en route. Allen & Unwin. In stores now. RRP: $32.99

101 history have been translated into more than 30 languages. His End Notes alone are a rich lode of further reference sources. Bloomsbury. Publication date August 30. RRP: $32.99

From Trivial Pursuit as a child and a win at eight at his Scouts Quiz Night, Coverdale went on as a 15-year-old to twice win ABC Radio’s midnight quiz, The Challenge. There followed Sale of the Century in the year 2000, when the then young uni student failed to score well enough in his first audition; persisting, seven months later he became the show’s “carry-over champion” in a reign that won him prizes such as lingerie and a sewing Hismachine.appetite, though, was whetted and he subsequently appeared on numerous series including The Weakest Link, Pass the Buck (winning a car), Wheel of Fortune, Deal or No Deal, and Million Dollar Minute ($300,000), also today writing thousands of questions annually for daily newspaper quizzes. Aside, however, the book is a ride through many fascinating interviews with personalities and anecdotes from the world of quizzing, including the surprisingly intricate process of compiling questions; tricks to getting selected as a contestant and memorising facts; tips for and pitfalls to success; the great British Millionaire cheating scandal; the failure of the Aussie versions of Pointless and similar imported shows; and nods to world-renowned Jeopardy, the movie Slumdog Millionaire, and other famous aspects of quiz history.

102

103 ✦ ✴ TRAVEL Brilliant BRILLIANT TRAVEL

AURORA LIGHT SHOW DAZZLED VISITORS!

The performance was attended by over 60,000 visitors from the community and region and everyone from the youngest to the oldest loved the experience! In fact, it delighted visitors so much there was a request for it to be extended! a glimpse of the dazzling display of lights!

✦ Be dazzled by this creative display of lights in the Albury Botanic Gardens!

AURORA was a hit over the school holidays in July, with tens of thousands flocking to the Albury Botanic Gardens for this immersive outdoor lighting Theexperience.AlburyBotanic Gardens was transformed into a kaleidoscope of colours with the use of lasers, holograms, vivid lighting, digital artistry, immersive soundscapes, and many other sensory mediums. Visitors went on a journey through the gardens experiencing a different way of seeing nature´s vibrant spirit.

If you´ve seen Laservision´s AURORA Light Show, you´ll never look at lights the same way again.

➹

Get

104

From magical looking owls to colourful dinosaurs, huge trees dripping with liquid lights to pathways glowing with mysterious colours, it was an experience you had to see for yourself. Who would have thought one could do so many amazing things with light? Kudos to the people who came up with the creative ideas and those who put everything together to make something so magical a reality!

105

LASERVISION are creators of unique and unforgettable sensory experiences. We harness the power of light, water, fire and other high impact mediums to evoke the senses, connect audiences with their environments and create enduring memories.

Every path is light up➸ The cold also clearly did not put people off. Many came wellwrapped up in spite of the cold to experience a new way of seeing the Botanic Gardens. If you´ve missed it this time, mark this on your calendars because AURORA is set to return to Albury in Winter 2023!

BRILLIANT TRAVEL

About LASERVISION

v Colourful dinosaur➸

“Together with Albury City Council, we were very happy to extend the show for an additional week,” said Matthew Tuey, Director of Marketing at LASERVISION. “The overwhelming response from the community, social media, local F&B and hospitality providers made it clear there was significant demand for this show. It was the talk of the town and region and we had many patrons driving up to 5 hours away to see AURORA. It was humbling to hear the positive feedback and reviews of our show and we were happy to accommodate the extension.”

Gayle and Trevor Kee➸

106 SPOT THE SS MARLOO SHIPWRECK

Located about 4-kilometres northwest of Waddy Point off the east coast of K'gari Fraser Island, lays the remains of ex-steel steamer, the SS Marloo. Shipwrecked in 1914, she now sits in about 8-metres of water, making her one of the island's best-kept secrets.

Gayle and Trevor Kee spot this very rare sighting of the SS Marloo ✦ Fraser Island's Treasure Hunt SS Marloo➸

Turn static files into dynamic content formats.

Create a flipbook
Brilliant-online-magazine-August-2022 by brilliant-online - Issuu