











![]()












If racing is abandoned after the first race has been run, we regret that no refunds can be made in respect of admission charges.
If badges or tickets are lost they will unfortunately not be replaced. Transfers between enclosures are available at the entrances to the enclosures.
We regret that barbeques are not permitted on this racecourse due to safety regulations Communications/Mobile Phones Mobile telephones, laptops, tablets and any other electronic devices may not be used on the racecourse for betting purposes. Cellular phones may be used for other purposes but only in the areas behind the stands and away from designated betting areas.
FAILURE TO COMPLY COULD RESULT IN YOUR REMOVAL FROM THE PREMISES AS PER OUR TERMS AND CONDITIONS OF ENTRY
Racegoers are not permitted to bring dogs into any enclosure. In car parks dogs must be kept on leads at all times. During hot weather it should be remembered that Police and RSPCA officials reserve the right to force entry into any vehicle to release an animal if suffering.
No T Shirts, casual shorts or trainers are permitted in the Premier Enclosure. Shirts must be worn at all times in all enclosures.
Although alcohol is not permitted to be brought onto the Racecourse, and in some cases bags will be searched at the entrances, picnics are permitted on the lawn adjacent to the track itself but not in any other areas You are requested not to take glass bottles and glasses outside of the bars, hospitality and restaurant areas.
Although everyone is welcome at Southwell, we do reserve the right, in extreme circumstances, either to refuse admission or to eject any person from the racecourse
The Horserace Betting Levy Board prize fund schemes provide for the estimated inclusion of £821,104 in ratecard and incremental prize money at this racecourse from 1st January to 28th March 2025
Racegoers may take photographs for private use from within the enclosures. Flash photography is not permitted at any time. Press and commercial photographers may pre-arrange the necessary permission with the Secretary’s Office at least 7 days before the race meeting Press and Official Photographers’ attention is drawn to the current British Horseracing Authority Instructions
Today’s race conditions can be found at the back of the racecard
In the interests of public safety all visitors to the racecourse must follow the directions of the Safety Stewards on the Stands and the Raceday Staff throughout the racecourse. Please do not leave bags or your possessions unattended at any time as this could cause a security alert. Please be aware that horses can be unpredictable, therefore care and attention is necessary within the vicinity of the horses. UNDER NO CIRCUMSTANCES WILL DRINK AND/OR GLASSES BE ALLOWED ON TO GRANDSTANDS, VIEWING AREAS IN FRONT OF GRANDSTANDS OR AROUND THE PERIMETER OF THE PARADE RING RACEGOERS DISREGARDING THIS REGULATION OR BEHAVING IN A DISORDERLY MANNER WILL BE REMOVED FROM THE RACECOURSE.
Smoking is not permitted inside any buildings but is permitted in all outdoor areas, this includes the use of all electronic cigarettes that omit vapour.
Nothing matters more to us when racing than the safety and welfare of both horse and rider. Central to that is the track itself and our groundstaff do everything in their power to provide an optimum racing surface On duty today we also have a dedicated and experienced team of highly-qualified Vets, Doctors and Paramedics following the action at every stage Their key responsibility is to monitor and provide care to the competitors throughout their time at the racecourse The locations and vehicle movements of these skilled specialists during racing are designed to provide a rapid response to any incident across the site. We also have a high-specification horse ambulance in attendance at every fixture to enable safe transport of a horse from the track to our on-site veterinary treatment facility for further treatment, or to the nearest equine referral hospital
It is our standard practice to erect screens around any horse or jockey requiring attention on the course as this provides privacy and a safe, calm environment in which to accurately diagnose and treat the patient as necessary Please do not assume the worst if screens are erected around a horse. We are fully committed to minimizing risk in our sport, to dealing professionally and efficiently with any injury, and to maintaining the highest possible quality of care for the horses and jockeys racing here today. To find out more about our Equine Welfare policy, please visit our website www.southwell-racecourse.co.uk






THE SOUTHWELL RACECOURSE EXECUTIVE WOULD LIKE TO THANK OUR SPONSORS AND WISH THEM AN ENJOYABLE AND PROSPEROUS DAY’S RACING.

(UNDER THE RULES OF RACING)

SIMON CONNAWAY (Chief Steward), CHRISTOPHER BENNETT (Stewards’ Panel Chair)
BRIDGET CHAMBERLAIN (Trainee Stewards’ Panel Chair)
BETH DOWSWELL, LOUISE MOORE, LOUISE NEALE, SARAH RUSSELL
STARTERS
ROBERT SUPPLE
PHILLIP DENNIS
JUDGE
KATIE DOWSON
CLERK OF THE SCALES
WAYNE BURNELL
VETERINARY OFFICER
DAVID GREEN
SENIOR VETERINARY
SURGEON
MATT BUTTERELL,
VETERINARY SURGEON
KATE KING
ORIANE ABDOUS
SENIOR MEDICAL OFFICER
Dr STEPHEN WROE
MEDICAL OFFICER
Dr SIMEON RAYNER
Dr TOM HORNE
NURSE
NINA GODDARD
EQUINE WELFARE AND INTEGRITY OFFICERS
SHAUN MITCHELL
KAREN WEST
LISA COOK
SAM DAVIS
BETTING RING MANAGER
CRAIG ANDERSON
COMMENTATOR
MARTIN HARRIS
EXECUTIVE DIRECTOR
MARK CLAYTON
CLERK OF THE COURSE
JOHN HOLLIDAY
SAFEGUARDING LEAD
MARK CLAYTON
SAFEGUARDING DEPUTY
JOHN HOLLIDAY

colour graphic
horse’s saddlecloth number


No. of days since last ran
horse’s name birthplace of horse if not Great Britain
form guide previous performances /=new season -=new year
Bold type shows point-to-point form
C=course winner
D=distance winner
CD=course & distance winner
BF=beaten favourite
3 CHAMP (IRE) (30) 3/135-45 CD
B g King’s Theatre (IRE) - China Sky (IRE)
age weight st-lbs
12 11-10
Jonjo O’Neill Jr
Mr John P. McManus Nicky Henderson, Lambourn Br Philip and Mrs Jane Myerscough
TIMEFORM VIEW Very talented hurdler/chaser in his prime (won the Sefton over C&D in 2019) but comfortably held in Long Walk Hurdle and Cleeve Hurdle both starts this season First-time cheekpieces. TFR BHA156
KEY Owner Breeding Breeder Jockey Trainer Sponsor Star Ratings Explained
Each horse has been given a star rating, these are defined below: S Br
Selected to win the race
Good chance of being placed
By no means out of the reckoning but at least one or two hold stronger claims.
Unlikely to win but not totally without hope Can be given little or no chance.
The BHA Handicappers allot ratings to horses once they have taken part in a sufficient number of races to enable the Handicappers to make a numerical assessment of each horse’s ability.
The principal purpose of the ratings is to determine the weight to be carried by each runner in handicap races, with the Handicappers aiming to provide each participant with an equal chance based on its best recent form under its optimum conditions A horse rated 100, for example, would be set to carry 1lb more than a horse rated 99 (ignoring any penalties or allowances)
The ratings published in the racecard for handicap races are the ratings that were used to calculate the weight to be carried by each horse, whilst in non-handicaps races the rating shown is that of each runner at the time that the entries for the race were confirmed Any subsequently published change to a rating, either up or down, is shown in brackets following the rating
For novice steeple chasers, the latest hurdle race rating may be shown until such time as the Handicappers allot a separate steeple chase rating Such ratings are prefixed by the letter h.

TWO MILES ABOUT FOUR AND A HALF FURLONGS (2M 4F 88YDS) FOR FIVE YRS OLD AND UPWARDS THE WATCH UNBRIDLED ON ATTHERACES.COM HANDICAP STEEPLE CHASE (CLASS 4) (GBB RACE)
Total prize fund £8900 ¨ Owners Prize Money. 1st £3595, 2nd £1797, 3rd £899, 4th £449, 5th £224. (Penalty Value £4700.09)

LEADING COURSE TRAINER (20-25): Dr R Newland & J Insole (12 wins from 71 runners, 17%) run RAJJAMATAZ TRAINER-IN-FORM (LAST 14 DAYS): E Williams (4 wins from 23 runners, 17%) runs IDEALLKO LONGEST TRAVELLER: PITWOOD ROAD trained by T O’brien, Ireland.
ZESTFUL HOPE has been knocking on the door in recent months and shades preference ahead of the hat-trick seeking Ideallko It’s by no means a two-horse race, though, with Golden de Coeur seemingly getting the hang of things over fences and Rajjamataz likely to strip fitter following his reappearance spin at Uttoxeter.
B g Racinger (FR) - Polka de Coeur (FR)
9 12-0
James Bowen
Alan & Andrew Turner Warren Greatrex, Upper Lambourn
Br O. Burlot, N. Burlot & M. Burlot
1Account Ltd
TIMEFORM VIEWFair hurdler form and has left his inauspicious chase debut form well behind the last twice, latterly finding just one too good at Hereford (21f, good to soft). The winner didn’t do much for the form when pulled up next time but this 9-y-o at least appears to be going the right way over fences. TFR###!! BHA110
WEST WARHORSE (IRE) (90) 01P3-55 D
B g Westerner - An Banog (IRE)
7 11-10
Jack Quinlan
Mr R. S. Brookhouse B F Brookhouse, Newmarket
Br Ms M. Kavanagh Tote
TIMEFORM VIEW Fair winning hurdler but below par on return here in October and subsequent chase debut at Sedgefield wasn’t particularly inspiring Now tried in a tongue strap. TFR##!!! BHA106
3 PITWOOD ROAD (GB) (44) 21-P004
B m Proconsul - Overyou
7 11-10
Jonathan Burke
Mr Derrick Mossop Terence O’Brien, Ireland
Br D. Mossop Jacksons Timber Ltd
TIMEFORMVIEWBumper/hurdles winner and also successful sole start between the flags. Best effort yet in this sphere when fourth of 14 in a 25f Thurles handicap in December but this Irish raider will need to improve if she’s to open her chase account. TFR##!!! BHA106
4 ZESTFUL HOPE (FR) (19) 044232 D
B g Zanzibari (USA) - Chamdespoir (FR)
8 11-9
David Bass
Ms G. E. Morgan Charlie Longsdon, Chipping Norton
Br Mr Jean-Pierre Cordonnier Merriebelle Stable Llc
TIMEFORMVIEWFair handicap hurdler/chaser who, fitted with cheekpieces, went agonisingly close to getting off the mark in this sphere at Uttoxeter in November Delivered another good shift at Hereford recently and it’s not hard to envisage this 8-y-o playing a leading role TFR##### BHA105
5 RAJJAMATAZ (IRE) (71) 5P-1225
Ch g Rajj (IRE) - Miss Muldoon (IRE)
7 11-8
Charlie Hammond Foxtrot Racing Rajjamataz
Dr Richard Newland & Jamie Insole, Droitwich
Br Mrs B. Byrne Foxtrot Racing
TIMEFORMVIEWOff the mark over fences at Fontwell last May and followed that with a couple of decent efforts in defeat. Didn’t find much when it came to the crunch on his reappearance at Uttoxeter in November but he is at least entitled to come on for that run. TFR###!! BHA104
6 FEVER DREAM (IRE) (19) 25P403
Ch g Sholokhov (IRE) - O What A Girl (IRE)
7 11-5
Jack Tudor Bedford & Noel & The Can’t Say no
Christian Williams, Bridgend
Br John O’Donovan Dodson and Horrell
TIMEFORM VIEWWinner over hurdles at Perth last summer and followed that with a couple of respectable efforts in defeat Yet to trouble the judge in this sphere and while his latest third at Hereford was a creditable effort, he has a fair bit to find with Golden de Coeur on that evidence TFR##!!! BHA101
7 IDEALLKO (FR) (14) 5F24-11 D
7 10-3
B g Cokoriko (FR) - Umiska de Beaumont (FR) Adam Wedge R J Gambarini Racing Evan Williams, Llancarfan
Br Mr Rafael Gourmaux & Mrs Karine Perreau Office Visions (Wales) Limited
TIMEFORMVIEWWinner of handicap chases at Ffos Las and Plumpton during early stages of last season and notched third success over fences at Windsor on New Year’s Eve. Followed up back hurdling at Warwick recently and he has to be feared now returned to the larger obstacles. TFR####! BHA85
The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly. And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB
CHE CK YOUR T ICK ET S E K YOU R I E T

Customers of the Boards and Rails bookmakers should check their itemised tickets immediately upon receipt, as mistakes cannot be rectified after the “off”. Customers are reminded to retain all betting tickets until after the weigh-in, as immediate payment will be made only on production of the original ticket. All tickets will remain valid for one month

If you require any assistance today please ask any member of the staff who will be happy to help you. For more information please visit www.southwell-racecourse.co.uk




Thank you for both running your horse(s) and attending today. Your dedicated facility is on the First Floor of the Grandstand, in this facility is complimentary tea, coffee and a meal. You should have received a meal voucher on entry. Good luck with your runner(s). www.arenaracingcompany.co.uk RACING THROUGHOUT 2025 book now southwell-racecourse.co.uk


































































































































































































































































































































ABOUT THREE MILES (3M 60YDS) FOR FIVE YRS OLD AND UPWARDS
THE JOIN SOUTHWELL GOLF CLUB HANDICAP STEEPLE CHASE (CLASS 4)
Total prize fund £8900 ¨ Owners Prize Money. 1st £3595, 2nd £1797, 3rd £899, 4th £449, 5th £224. (Penalty Value £4700.09)

LEADING COURSE TRAINER (20-25): M Keighley (23 wins from 143 runners, 16%) runs MYFANWY’S MAGIC TRAINER-IN-FORM (LAST 14 DAYS): N Twiston-Davies (6 wins from 25 runners, 24%) runs SLIEVEGAR LONGEST TRAVELLER: FAIRLAWN FLYER trained by P & M Bowen, Haverfordwest, 281 miles.
PRINCE CLENI arrives at the top of his game so this three-time C&D scorer looks the way to go at the chief expense of Martalmix’jac who figures on a handy mark on the back of his resurgent Ludlow second last time out. Finn Lough can also have a say at these weights if shrugging off a lesser effort at Doncaster
1 BALKARDY (FR) (23) 0P-1530 D
Ch g Balko (FR) - Kalimnos (FR)
8 12-2
Isabel Williams (3)
Mr W. J. Evans Evan Williams, Llancarfan
Br Mr Hugo Merienne & Mr Yann Hamon Tote
TIMEFORMVIEWLanded handicap chase at Stratford (22.6f) in October and generally respectable efforts since over hurdles and fences, seventh in 3m Ffos Las handicap hurdle 23 days ago. No forlorn hope TFR###!! BHA112
2 FINN LOUGH (IRE) (10) 62221P D BF
6 12-1
B g Milan - Jerica Toby Wynne (3) Bowen, Boyes, Coxon, Haycock, Smith Oliver Greenall & Josh Guerriero, Malpas
Br Thistletown Stud Swansway
TIMEFORM VIEW Got off the mark in 3m handicap chase at Doncaster in December but pulled up early there 10 days ago after a bad mistake. Handily weighted if getting back on track. TFR###!! BHA111
3 MYFANWY’S MAGIC (GB) (34) 2542-2P BF
8 11-8
B g Mr Medici (IRE) - Lady Myfanwy Sean Bowen
360 Racing Club
Martin Keighley, Cheltenham
Br PB Miles & Mrs M Miles FBC Manby Bowdler
TIMEFORM VIEW A fair maiden hurdler but pulled up in handicap chase (7/2) at Uttoxeter (24f, heavy) on his debut over fences 34 days ago. Has something to prove TFR##!!! BHA104
4 SLIEVEGAR (GB) (32) 43-232P D
B g Westerner - Love Train (IRE)
9 11-8
Mr Toby McCain-Mitchell (7) Ms J. McCain Nigel Twiston-Davies, Cheltenham
Br Mrs L. Suenson-Taylor
TIMEFORM VIEW Multiple point winner who bagged a small-field Kelso hunter in May 2023 Winless between the flags since though and pulled up on yard debut in 2m4f handicap at Huntingdon last month. TFR##!!! BHA104
5 FAIRLAWN FLYER (GB) (29) 21PP-40 D
9 11-7
B g Dr Massini (IRE) - She’s Our Native (IRE) James Bowen
Mr Ross Williams
Br Miss E. Nicholas & R. Williams
Peter & Michael Bowen, Haverfordwest
Peter and Karen Bowen Racing
TIMEFORMVIEWA fair 25f chase winner but he came in last of 7 in handicap chase at Chepstow (26.2f, heavy) 29 days ago. Much more is required. TFR##!!! BHA103
6 ALI STAR BERT (GB) (34) P52P2P CD
B g Phoenix Reach (IRE) - Clumber Pursuits
9 11-6
Jack Quinlan
Mr S. A. Harris Shaun Harris, Worksop
Br Mr Wilf Hobson
TIMEFORM VIEW Took this 12 months ago but pulled up in handicap chase at Uttoxeter (24f, heavy) 34 days ago. Needs to bounce back TFR###!! BHA102
7 PRINCE CLENI (FR) (10) 140312 CD 7 10-3
B g Doctor Dino (FR) - Cleni River (FR) Jack Tudor Daffodil Racing Cleni Christian Williams, Bridgend
Br S.C.E.A de La Metairie Dodson and Horrell
TIMEFORMVIEWA 3-time C&D winner, latest in January, and he comes here on the back of a good second of 11 in handicap chase at Doncaster (24f, good to soft) 10 days ago, closing all way to line Merits serious consideration nudged up 1lb. TFR##### BHA85
Gr g Lord du Sud (FR) - Andria (FR)
High and Low
Br Mrs L. & Mr J. Grandchamp Des Raux
8 10-3
Tabitha Worsley (3)
Mel Rowley, Bridgnorth
Bob Price & Son Groundworks
TIMEFORM VIEW Back on song when second of 11 in handicap chase at Ludlow (20f, soft) 47 days ago.
Much respected off the same mark now back up in trip TFR####! BHA85
9 FLEMEN’S TIPPLE (IRE) (33) 6-1P435 D
B g Flemensfirth (USA) - Marie des Anges (FR)
Jokulhlaup Syndicate
8 10-2
Caoilin Quinn
Andy Irvine, East Grinstead
Br Miss Lisa Pyne Funnel Fuel
TIMEFORMVIEWFinally opened his account in 3m chasse at Huntingdon but only fifth of 7 in handicap hurdle at Fakenham (23.4f, soft) 33 days ago. Not taken lightly returned to this sphere if back on his A-game TFR###!! BHA84
2024: TASTE THE FEAR (IRE) 9 11 12 Sam Twiston-Davies 8-1 (Dr Richard Newland & Jamie Insole) 13 ran
DECLARED RUNNERS 9
Tongue Strap worn by No. 2, 4, 8, 9. Sheepskin Cheek Pieces worn by No. 2, 5, 8, 9.
Stewards Note:
FINN LOUGH: Following its run on 24/1/2025 it was reported that the horse didn’t travel and made a mistake.
MYFANWY’S MAGIC: Following its run on 31/12/2024 it was reported that the trainer could not explain the poor run.
FAIRLAWN FLYER: Following its run on 5/1/2025 it was reported that the horse lost a shoe.
Probable S.P’s: 7-2 Prince Cleni (FR), 4-1 Finn Lough (IRE), 5-1 Martalmix’jac (FR), 9-1 Myfanwy’s Magic (GB), 10-1 Ali Star Bert (GB), 12-1 Flemen’s Tipple (IRE), 14-1 Slievegar (GB), 16-1 Balkardy (FR), 22-1 Fairlawn Flyer (GB)
The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly. And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British.









SATURDAY 22 FEBRUARY




FEATURING Live Music THROUGHOUT THEDAY



ABOUT TWO MILES (1M 7F 182YDS) FOR MAIDEN FOUR YRS OLD AND UPWARDS
THE GRACE AND DOTTY FEDORA’S AND FEATHERS MAIDEN HURDLE RACE (CLASS 4) (DIV I) (GBB RACE)
Total prize fund £7700 ¨ Owners Prize Money. 1st £3213, 2nd £1607, 3rd £803, 4th £402. (Penalty Value £4193.42)

LEADING COURSE TRAINER (20-25): D Skelton (36 wins from 187 runners, 19%) runs HESTINA HILL TRAINER-IN-FORM (LAST 14 DAYS): O Murphy (8 wins from 38 runners, 21%) runs KARTON PLEIN
LONGEST TRAVELLER: GOLDEN ECHO trained by A Honeyball, Beaminster, 221 miles.
KARTON PLEIN gets a narrow vote over Fergal O’Brien’s Unleash The Beast in a maiden hurdle where previous form is very thin on the ground Anthony Honeyball Flat recruit Golden Echo is another who could have a part to play.
1 BARLEYTHORPE (GB) (270) 0-6
Ch g Mukhadram - Beyeh (IRE)
5 11-7
Charlie Hammond
Mr Terry Pryke Michael Appleby, Oakham
Br Pryke Bloodstock
TIMEFORM VIEW Well held both starts in bumpers last spring for Pam Sly. Could only consider if backed now hurdling for Mick Appleby. TFR##!!! BHA-
2 BERKSHIRE LAD (IRE) (33) 0-356
B g Berkshire (IRE) - Katsca (IRE)
Oliver Signy Racing Club
Br Ms Mary Tucker
5 11-7
James Davies
Oliver Signy, Lambourn
Oliver Signy Racing Llp
TIMEFORMVIEW Fair form in bumpers. Made a disappointing start to his hurdle career at Fakenham on New Year’s Day but it’s too soon to write him off in this sphere. TFR####! BHA-
3 HESTINA HILL (IRE) (32) 00
Ch g Kingston Hill - Hestina (FR)
Coral Racing Club for Colleagues
Br Dan Skelton
5 11-7
Charlie Todd
Dan Skelton, Alcester
Ladbrokes, The Air Ambulance Service (Warks & Northants)
TIMEFORM VIEW In top hands but well beaten in a bumper and maiden hurdle in recent months First-time cheekpieces need to have a transformative effect TFR##!!! BHA-
4 KARTON PLEIN (FR) (11) 2-54
B g Karaktar (IRE) - Porta Romana (FR)
5 11-7
Sean Bowen
Mr Aiden Murphy Olly Murphy, Wilmcote
Br Philippe Thriet, Michel Larobe, Vincent Motaclan
TIMEFORM VIEW Runner-up in a point. Has shown definite ability when fifth in a bumper and maiden hurdle for Olly Murphy and may prove the answer here. TFR##### BHA-
5 PAY THE TAB (IRE) (114) P36-6
B g Getaway (GER) - The Tabster (IRE)
James White
Br Joe Sloan
6 11-7
David Bass
Max Comley, Naunton
TIMEFORMVIEWFair form standout effort in bumpers but took little interest when pulled on Downpatrick hurdle debut Has left Gordon Elliott and percentage call is to look elsewhere Hooded first time TFR##!!! BHA-
6 UNLEASH THE BEAST (IRE) (55) 565
6 11-7
B g Malinas (GER) - Cloth Fair (IRE) Jonathan Burke
Mr Nic Brereton Fergal O’Brien, Cheltenham
Br Mr S. Spillane Bresbet
TIMEFORMVIEWMalinas gelding who is bred to stay very well and has shaped that way in a bumper/2 maiden hurdles so far. Sticks at 2m again but still much respected in a race where few boast compelling claims TFR####! BHA-
7 URBLEREAGH (FR) (714) 6/-
Ch g High Rock (IRE) - Kelly des Cotieres (FR)
D. R. & E. E. Brown
8 11-7
David Noonan
Tom Gretton, Inkberrow
Br Mr Marcel Basset JMC Surfacing Contractors
TIMEFORM VIEW 150/1 when well held in a Carlisle maiden hurdle in February 2023
Absent since and can only watch with a tongue tie added now TFR##!!! BHA-
8
GEMI CAT (FR) (16) P60
Ch m Gemix (FR) - Beautiful Cat (FR)
Ms S. Howell and Partner 1
5 11-0
Jack Tudor
Christian Williams, Bridgend
Br Gaec de La Seguegne & J.M. Campos Dodson and Horrell
TIMEFORM VIEW No form in 3 hurdles
B m Golden Horn - My Call
TFR#!!!! BHA-
5 11-0
Sam Twiston-Davies Owners Group 141
Anthony Honeyball, Beaminster
Br Godolphin Owners Group
TIMEFORM VIEW Modest on Flat (stays 1 1/2m) but did win a Hamilton handicap on her final outing for Julie Camacho and starts out over hurdles in an ordinary race Enters the reckoning TFR####! BHA-
B m Milan - Shuil Forth (IRE)
5 11-0
Adam Wedge Encore Racing
Christian Williams, Bridgend
Br Charlie Harnett Dodson and Horrell
TIMEFORM VIEW Fell in point in Ireland and well beaten in 2 hurdles here
2024: NO CORRESPONDING RACE LAST YEAR
TFR#!!!! BHA-
DECLARED RUNNERS 10 Hood worn first time by No. 5. Tongue Strap worn first time by No. 7. Sheepskin Cheek Pieces worn first time by No. 3.
Probable S.P’s: 9-4 Karton Plein (FR), 4-1 Berkshire Lad (IRE), 5-1 Unleash The Beast (IRE), 6-1 Golden Echo (IRE), 10-1 Hestina Hill (IRE), 11-1 Pay The Tab (IRE), 40-1 Barleythorpe (GB), Urblereagh (FR), 66-1 Gemi Cat (FR), Majestic Mia (IRE)
The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly. And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.






ABOUT TWO MILES (1M 7F 182YDS) FOR MAIDEN FOUR YRS OLD AND UPWARDS
THE GRACE AND DOTTY FEDORA’S AND FEATHERS MAIDEN HURDLE RACE (CLASS 4) (DIV II) (GBB RACE)
Total prize fund £7700 ¨ Owners Prize Money. 1st £3213, 2nd £1607, 3rd £803, 4th £402. (Penalty Value £4193.42)

LEADING COURSE TRAINER (20-25): D Skelton (36 wins from 187 runners, 19%) runs SPECTRE ONE TRAINER-IN-FORM (LAST 14 DAYS): O Murphy (8 wins from 38 runners, 21%) runs WATCHING OVER YOU LONGEST TRAVELLERS: COMETH THE HOUR & RULE ME IN trained by C Williams, Bridgend, 190 miles.
HEART OVER HEAD shaped well in a bumper last February and might prove the answer to the second division of this maiden hurdle Flat winner Elforleather is second choice ahead of My Cullen and Irish point recruit Rule Me In.
colours no horse age st lb
1 COMETH THE HOUR (IRE) (848) 6/-
8 11-7
B g Imperial Monarch (IRE) - Back And Fore (IRE) Adam Wedge
Diamond Racing Ltd Christian Williams, Bridgend
Br Ita Sheridan & Frank O’Meara Dodson and Horrell
TIMEFORM VIEW Sixth of 7 in a Ffos Las bumper for Rebecca Curtis in October 2022 and not seen since Can only be watched. TFR##!!! BHA-
2 HEART OVER HEAD (IRE) (349) 2-
B g Soldier of Fortune (IRE) - Oscar Bird (IRE)
6 11-7
Jonathan Burke
Mr Nic Brereton Fergal O’Brien, Cheltenham
Br Bryan Mangan Bresbet
TIMEFORM VIEW Half-brother to connections useful hurdler Alaphilippe who produced a promising first effort when second in a Market Rasen bumper just under a year ago. Has had wind surgery ahead of this switch to hurdles. Gets the vote TFR##### BHA-
3 LITTLE DIPPER (GB) (94) 4-4
B g Telescope (IRE) - Milliegait
The Derbyshire Optimists
Br The Hon Mrs E. J. Wills
5 11-7
Charlie Deutsch
Mel Rowley, Bridgnorth
Bob Price & Son Groundworks
TIMEFORM VIEW Half-brother to 3 winners, including the useful Gaitway, and had shown a fair level of ability when fourth in bumpers 6 months apart. Makes hurdle debut after a further 3 months off. TFR###!! BHA-
4 MY CULLEN (IRE) (19) 6305
B g Jet Away - Annalore (IRE)
Up the wall Racing
Br Kenneth Parkhill
5 11-7
Brendan Powell
Henrietta C Knight, Wantage
The Injured Jockeys Fund
TIMEFORMVIEWShaped with some promise in a brace of bumpers and shrugged aside a disappointing hurdle debut when fifth of 13 in 2m Newbury novice 19 days ago. Likely capable of better again. TFR####! BHA-
5 RULE ME IN (IRE) (58) 2
B g Mahler - Don’t Rule Me Out (IRE)
Sue Howell
6 11-7
Jack Tudor
Christian Williams, Bridgend
Br Robert Haverty Dodson and Horrell
TIMEFORM VIEW £32,000 buy after finishing runner-up in an Irish point in December. Would need considering if the betting suggests he’s expected to go well TFR####! BHA-
6 SPECTRE ONE (IRE) (32) 0
Ch g Kingston Hill - Andreas Pride (IRE)
Spectre Racing - Spectre One
5 11-7
Fergus Gillard
Dan Skelton, Alcester
Br Joseph Sheahan Ladbrokes, The Air Ambulance Service (Warks & Northants)
TIMEFORMVIEW Never involved in a Huntingdon bumper last month but from a leading stable and no surprise were he to prove a different proposition now hurdling. TFR###!! BHA-
Ch g Nathaniel (IRE) - Sonnetation (IRE)
01/-0
6 11-7
Kevin Brogan
JRB Williams & Jane Lewis Olly Murphy, Wilmcote
Br The ‘In Recovery’ Partnership Motaclan
TIMEFORMVIEWBumper winner for Milton Harris in February 2023 but not seen again until well held in a Uttoxeter maiden hurdle for Olly Murphy just 9 days ago. Needs to have come on a lot in a short time TFR##!!! BHA-
8
YOU MOVED ON (GB) (211) 0
Gr g Outstrip - Forgotten Me (IRE)
Mr Nick Carter
Br Aiden Murphy
5 11-7
Tabitha Worsley (3)
Jake Coulson, Heaton
Jake Coulson Racing, Bearda Hill Racing
TIMEFORMVIEW Well held in a Market Rasen bumper for Olly Murphy last autumn Likely outsider now hurdling for a new yard TFR##!!! BHA-
(50) 15 D
Gr m Soldier of Fortune (IRE) - Topless (IRE)
BDRSyndicates
Br Pat & Eddie Barry
5 11-0
David Bass
Max Comley, Naunton
TIMEFORM VIEW 22/1, distant fifth of 10 in bumper at Carlisle (17f, soft) on debut 50 days ago. Makes hurdles debut TFR##!!! BHA-
B g Postponed (IRE) - Mistaken Love (USA)
Million in Mind Partnership
4 10-9
Tom Cannon
Alan King, Barbury Castle
Br Brookside Stud Ltd Goffs UK Ltd
TIMEFORM VIEW Fair Flat winner for Jack Channon Should be up to making his presence felt in a race like this now hurdling for Alan King TFR####! BHA2024:(See Div 1)
Tongue Strap worn by No. 2. Running for the first time since Wind Surgery No. 2.
DECLARED RUNNERS 10
Probable S.P’s: 5-2 Heart Over Head (IRE), 5-1 Rule Me In (IRE), 6-1 Elforleather (GB), 15-2 Spectre One (IRE), 9-1 My Cullen (IRE), 14-1 Little Dipper (GB), 16-1 Watching Over You (GB), 20-1 Lady Fortune (IRE), 33-1 Cometh The Hour (IRE)
The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly. And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB



TWO MILES ABOUT FOUR AND A HALF FURLONGS (2M 4F 88YDS) FOR NOVICE FOUR YRS OLD AND UPWARDS FILLIES AND MARES
THE DOWNLOAD THE AT THE RACES APP MARES’ NOVICES’ LIMITED HANDICAP HURDLE RACE (CLASS 5)
Total prize fund
£6150 ¨ Owners Prize Money. 1st £2484, 2nd £1242, 3rd £621, 4th £311, 5th £155. (Penalty Value £3247.81) 3 Eliminated Under Rules (I)9 and (I)10.

LEADING COURSE TRAINER (20-25): O Murphy (30 wins from 139 runners, 22%) runs WILMCOTE TRAINER-IN-FORM (LAST 14 DAYS): O Murphy (8 wins from 38 runners, 21%) runs WILMCOTE
LONGEST TRAVELLER: LADY HARRIETT trained by P & M Bowen, Haverfordwest, 281 miles.
While this drop back in trip is of dubious benefit, HEY MAMA ROCK ME is nevertheless appealing on the back of an improved reappearance second upped to a trip just shy of 3m at Musselburgh. Conversely,Wilmcote is going up in trip following a decent effort over the minimum distance at Uttoxeter and she will be a threat if, as expected, this stiffer test helps eke out a little more. Lyle View and handicap debutante Princess Keri are also shortlisted.
KEY Owner Breeding Breeder Jockey Trainer Sponsor Br
B m Shirocco (GER) - Hot Choice
Beyond Redemption Syndicate
6 11-12
Miss Victoria Malzard (5)
Harry Derham, Newbury
Br Thomas Norris OLBG
TIMEFORMVIEWWinless following 8 attempts between the flags and hasn’t made much of an impact in mares ’ maiden/novice hurdles so far. Still, better could be forthcoming now upped in trip for this handicap debut for her up-and-coming yard Watch the betting. TFR##!!! BHA95
2 TIME FOR TEA (IRE) (26) P-0434P 6 11-12
B m Youmzain (IRE) - Elsie (IRE)
Mr David Gibbons
Isabelle Ryder (7)
Barry Brennan, Upper Lambourn
Br Ms Helga Moore K & M (Hauliers) Ltd
TIMEFORM VIEW Fair maiden hurdler at best for Henry de Bromhead in Ireland but she’s difficult to make a case for on the back of an unimpressive debut performance for this yard at Taunton. TFR#!!!! BHA95
3 ICI LA REINE (IRE) (285) 10/5560- 7 11-11
B m Presenting - Reine Angevine (FR)
Mrs Julien Turner & Mr Andrew Merriam
Br Padraig Higgins & Larry Murphy
Charlie Deutsch
Mel Rowley, Bridgnorth
Bob Price & Son Groundworks
TIMEFORMVIEWDual AW bumper winner who shaped fairly well when fifth on 20.5f Market Rasen hurdles debut in November 2023 However, she has failed to build on that in 3 subsequent starts and needs to get back on track returning from 9 months for her new yard TFR##!!! BHA94
4 GOTTHEREINTHEEND (IRE) (44) 2/560-24 6 11-10
B m Soldier of Fortune (IRE) - Highland Flower (IRE)
Charlie Price (3)
Martin Redman & Maurice Thomas Robbie Llewellyn, Swindon
Br Mrs Deborah Hobson
TIMEFORM VIEWShowed a bit in bumpers and improved on previous hurdling efforts when a staying-on second in a novice at Warick last spring Not so good in a first-time tongue strap (retained here) on return and handicap/yard debut at Ascot in December but she’s probably worth another chance TFR###!! BHA93
5 OMAHA WISH (FR) (39) 1F0503
B m Night Wish (GER) - Chattleya (FR)
Mr M Dunlevy and Mrs H McGuinness
7 11-5
Charlie Todd
Sam Allwood, Whitchurch
Br E.A.R.L Haras de Montaigu Allwood Horse Transport
TIMEFORMVIEW Opened account over fences for Dan Skelton at Fakenham last summer but efforts for present yard have left a fair bit to be desired. TFR##!!! BHA88
6 LADDIE COOPER MIA (IRE) (49) 455-265 5 11-3
B m Diamond Boy (FR) - Thelunarschooner (IRE)
Molly and Paul Willis
David Noonan
Nigel Hawke, Tiverton
Br Ballinaroone Stud Ltd Junction 24 Ltd
TIMEFORMVIEWShaped like a stayer in 3 bumpers and remote second of 4 in novice hurdle at Sedgefield (19.8f, good) on hurdles bow in November Safely held next 2 starts and needs to raise her game now pitched into a handicap. TFR#!!!! BHA86
7 WILMCOTE (GB) (45) 550063
B m Jack Hobbs - Maiden Voyage
6 11-1
Sean Bowen
Deva Racing JH Olly Murphy, Wilmcote
Br Whitson Bloodstock Limited Deva Racing Group
TIMEFORM VIEWShowed ability amidst greenness in 2 bumpers and bettered her novice exploits in this sphere when third of 11 on handicap debut at Uttoxeter (15.8f, heavy) just before Christmas. 1lb lower now and promises to be suited by this stiffer test, so there’s certainly cause for optimism. TFR###!! BHA84
8
(GB) (34) 20410P D
B m Black Sam Bellamy (IRE) - Matrow’s Lady (IRE)
Mr Steven John Matthews
Br Steven Matthews
6 11-0
Shane Fenelon (5)
Peter & Michael Bowen, Haverfordwest
Matthews Roofing Bristol Ltd
TIMEFORM VIEW Opened account at Ffos Las in November but has followed that with two heavy defeats and now finds herself with a point to prove TFR##!!! BHA83
9
(IRE) (74) 30-2000
B m Walk In The Park (IRE) - Burkes Lady (IRE)
IWEC Electrical Racing
Br Grangeclare Stud
5 10-13
Adam Wedge
Evan Williams, Llancarfan
TIMEFORMVIEWFrom the family of Welsh Grand National winner Potters Corner Little impact in 3 runs under Rules so far but she’s another who could be seen in a better light now switched to handicap company. TFR##!!! BHA82
10 LYLE VIEW (IRE) (34) 2-400P4
Br m Mahler - Devils Pride (IRE)
Equi ex Incertis Partners
Br C. & H. Persse
5 10-12
Richie McLernon
Neil Mulholland, Limpley Stoke
TIMEFORMVIEWRunner-up on the last of 3 outings in points and fared a bit better in a first-time hood when fourth in an 11-runner Uttoxeter handicap (15.8f, heavy) on New Year’s Eve. Now 2lb lower and live each-way claims now moving back up in trip TFR###!! BHA81
11 HEY MAMA ROCK ME (IRE) (33) 0646-2
Ch m Mahler - Ballybrowney Hall (IRE)
6 10-10
James Bowen
S Townshend & S Lowther Daragh Bourke, Lockerbie
Br Miss Lisa Pyne
TIMEFORMVIEWStoutly bred and produced by far her best effort yet when chasing home an improver upped to 23.8f on return at Musselburgh (soft) on New Year’s Day. Provided that this drop back in trip doesn’t count against her, she should make a bold bid to go
B m Walk In The Park (IRE) - Back To Loughadera (IRE)
Mr Stephen Sugden
James Best
Martin Keighley, Cheltenham
Br J J. Harty & Roger Harty Optima Self Store
TIMEFORM VIEW Reappearance second at Leicester represented a step forward but she has failed to build on that since and not sure that this step back up in trip is what she wants. TFR###!! BHA79
13 EXTRA COVER (GB) (33) 400-0P4
B m Jack Hobbs - Rosita Bay
Hot To Trot Jumping
Br Overbury Stallions Ltd
6 10-7
Sam Twiston-Davies
Henry Daly, Ludlow
Hot To Trot Racing Ltd
TIMEFORM VIEW Hasn’t offered much in a bumper nor 5 starts over hurdles and hopes now pinned on the first-time visor sparking improvement TFR##!!! BHA76
14 MISTING (GB) (33) 0-650PP
B m Scorpion (IRE) - Dream Performance (IRE)
6 10-7
Jack Quinlan
Mrs A Maundrell & Mr D Smith Neil King, Burderop
Br S. W. Maundrell Ltd
The Injured Jockeys Fund
TIMEFORM VIEW Little promise in bumpers and similar story over hurdles so far, showing signs of temperament but not a great deal in the way of ability TFR#!!!! BHA76
2024: NO CORRESPONDING RACE LAST YEAR
DECLARED RUNNERS 14 Visor worn first time by No. 13. Tongue Strap worn first time by No. 14 Sheepskin Cheek Pieces worn first time by No. 9. Tongue Strap worn by No. 4. Sheepskin Cheek Pieces worn by No. 8, 12.
Probable S.P’s: 4-1 Hey Mama Rock Me (IRE), 11-2 Wilmcote (GB), 13-2 Gotthereintheend (IRE), 8-1 Lyle View (IRE), 17-2 Oneforthefairgreen (IRE), 14-1 Extra Cover (GB), 20-1 Ici La Reine (IRE), Princess Keri (IRE), 22-1 Omaha Wish (FR), 25-1 Loud And Proud (IRE), 28-1 Lady Harriett (GB), Misting (GB), 40-1 Laddie Cooper Mia (IRE), 100-1 Time For Tea (IRE)

TWO MILES ABOUT FOUR AND A HALF FURLONGS (2M 4F 88YDS) FOR FOUR YRS OLD AND UPWARDS
Total prize fund £7700 ¨ Owners Prize Money. 1st £3110, 2nd £1555, 3rd £778, 4th £389, 5th £194. (Penalty Value £4066.37)

LEADING COURSE TRAINER (20-25): O Murphy (30 wins from 139 runners, 22%) runs BOBBY SOCKS & BREAD AND BUTTER TRAINER-IN-FORM (LAST 14 DAYS): O Murphy (8 wins from 38 runners, 21%) runs BOBBY SOCKS & BREAD AND BUTTER
WEIGHTWATCHER: SHARED won off a handicap mark of 121, his rating is now down 5lb to 116. LONGEST TRAVELLER: STRATTON OAKMONT trained by K Woollacott, Crewkerne, 228 miles.
BOBBY SOCKS showed he retains plenty of ability when finishing a promising third on the back of a 17-month absence and he’s the most interesting runner here. Toonagh Warrior has run some creditable races over the winter and should be in the mix once again. Paul O’Brien has a tough job aboard the enigmatic Shared, but he’s capable if on a going day.
B g Shantou (USA) - Whats Up Britta (IRE)
Elliott England (10) Co-Foundations Ltd
Ben Pauling, Naunton
Br Stone Electrical Ltd Fitzdares TIMEFORMVIEWVeteranisn’ttheeasiesttowinwith Well-backedwhenheadgearbackonatCheltenhaminNovemberbutashadedisappointingthatday.Regressed when tenth of 13 in handicap hurdle (20/1) at Ascot (21.6f, good to soft) 45 days ago. Blinkers tried today but others have stronger claims. TFR###!! BHA122
2 THE WINSLOW BOY (GB) (45) 5/40-310
B g Dartmouth - Mizzurka
6 11-10
Ben Poste
Chase The Dream and Partner Tom Symonds, Hentland
Br Golden Cap Gun Dog Gin Ltd
TIMEFORMVIEWMadeitfourthtimeluckyoverhurdlesin2mChepstownoviceinNovember Couldn’tdefyatough-lookingopeningmarkonhandicapdebutwhen fourteenth of 18 in a handicap hurdle at Ascot. Tackles longer trip today but needs to improve to overcome current handicap mark TFR###!! BHA116
3 SHARED (GB) (91) 30P-434 BF
B g Almanzor (FR) - Between Us
6 11-10
Paul O’Brien
Mr Colm Donlon Harry Derham, Newbury
Br Cheveley Park Stud Limited OLBG
TIMEFORM VIEWImproved when taking a 2m Chepstow handicap on reappearance last season and ended that campaign with a creditable effort at Warwick. His tendency to race lazily has been evident this season, although not suited by sharper test at Plumpton last time Claims if on a going day back up in trip TFR####! BHA116
4 CHURCHILLS BOY (IRE) (666) 1/P11P4/-
B g Malinas (GER) - Lindas Last (IRE)
8 11-8
James Davies
Mrs H Allan & Mrs L Meagher Nick Gifford, Findon
Br M. F. Condon Avtrade Limited
TIMEFORM VIEW Bumper winner and already a dual winner in this sphere in 2022/2023. Bounced back from disappointing effort when a respectable fourth at Plumpton (20.5f, good) back in April 2023 but off the track since and likely to need the outing here TFR##!!! BHA114
5 BREAD AND BUTTER (IRE) (35) 401113 D
Br g Westerner - Wells Diamond (IRE)
10 11-8
Lewis Saunders (7)
Mr Bill Hawkins Olly Murphy, Wilmcote
Br Longrove Stud Motaclan
TIMEFORM VIEWRight back to form since undergoing a wind op, winning 3 on the bounce under Lewis Saunders before respectable third of 8 in handicap hurdle at Taunton (19f, good to soft), faring best of those who raced off the pace Can be competitive again but handicapper has made life tougher now. TFR###!! BHA114
6 TOONAGH WARRIOR (IRE) (19) 4-62206
7 11-7
Ch g Well Chosen - Duffys Chelsea (IRE) Charlie Hammond Noble Sovereign Racing Stuart Edmunds, Leighton Buzzard
Br Mrs Kathleen Duff Science Supplements
TIMEFORM VIEWPlaced in brace of Southwell handicaps at up to this trip with cheekpieces fitted this winter. Jumped well and was better value than his finishing position when sixth of 9 in handicap hurdle at Newbury (24.2f), had his stamina stretched. Should be in the mix back down in trip in first-time blinkers. TFR####! BHA113
7 D’JO DELA BARRIERE (FR) (37) 5-40145
6 11-7
B g Choeur du Nord (FR) - Morning Rose (GER) Adam Wedge Baytree Evan Williams, Llancarfan
Br Mrs Joselita Planchenault
TIMEFORMVIEWStruck at the second time of asking for Evan Williams in 2m Hereford novice earlier this season Struggled to make an impact back over fences and returns to smaller obstacles, making his handicap debut in this sphere. Not many miles on the clock but others preferred here. TFR###!! BHA113
8
OAKMONT (IRE) (44) 2221-3P C 9 11-7
B g Ask - Foxwood Girl (IRE)
Kayley Woollacott Racing Club
Br Mrs Margaret McGauran
Ben Godfrey
Kayley Woollacott, Crewkerne
The Firehouse Somerset
TIMEFORM VIEW Course winner returned with a good third at Ffos Las in November Disappointed at Haydock 6 weeks later but he’s not the type to stay down for long TFR###!! BHA113
(IRE) (66) 264-343 7 11-4
Ch g Well Chosen - Whatareyousaying (IRE)
Jonathan Burke
Mark & Liz Thomas Fergal O’Brien, Cheltenham
Br John Dunford (Jnr)
TIMEFORMVIEWHasyettobuildonthepromiseofhishurdledebutsecondinIreland,hasranokayintwostarsforFergalO’Brien,latestthirdof9inanovicehurdle(7/1) at Doncaster (20.8f, good) 66 days ago. Should be more at home in handicaps but we may not see the best of him until he tackles fences. TFR###!! BHA110
10 BOBBY SOCKS (GB) (77) 36/411-3 CD
8 11-1
B g Kayf Tara - Bobs Present Sean Bowen
Stephen R Hodgkinson & Partner Olly Murphy, Wilmcote
Br Aiden Murphy Motaclan
TIMEFORMVIEWOntheupin2023winningbraceof21/2mhandicaps,oneoverC&D.Showedhestillretainsplentyofabilitywhenthirdof10inahandicaphurdleatLeicester (15.5f) on the back of a 17-month absence Entiled to come on for that and had another wind surgery since Interesting contender for top yard. TFR##### BHA107
B m Shantou (USA) - All The Best Mate (IRE)
Both Ways Partnership
Br M. Sheehy
7 11-0
James Bowen
Warren Greatrex, Upper Lambourn
1Account Ltd
TIMEFORM VIEWIrish point winner who built on hurdles debut promise when landing a 7-runner maiden at Cartmel (2 3/4m, good to soft) in May. May have needed the run back on testing ground when fifth of 9 in a handicap hurdle at Leicester (20.5f,
2024: HIGH TREASON 5 11 10 Sam Twiston-Davies 4-1 (Nigel Twiston-Davies) 12 ran DECLARED RUNNERS 11 Blinkers worn first time by No. 1, 6. Tongue Strap worn by No. 1, 5. Sheepskin Cheek Pieces worn by No. 3. Running for the first time since Wind Surgery No. 10.
Stewards Note: STRATTON OAKMONT: Following its run on 21/12/2024 it was reported that the horse weakened quickly.
Probable S.P’s: 7-2 Bobby Socks (GB), 11-2 Shared (GB), 13-2 Bread And Butter (IRE), 9-1 Toonagh Warrior (IRE), 10-1 Whatsupwithyou (IRE), The Winslow Boy (GB), 14-1 Stratton Oakmont (IRE), 16-1 Shantwopointfive (IRE), 20-1 Whatsyourproblem (IRE), 25-1 Churchills Boy (IRE), D’Jo Dela Barriere (FR)






































ABOUT THREE MILES (3M 60YDS) FOR FOUR YRS OLD AND UPWARDS
Total prize fund £6150 ¨ Owners Prize Money. 1st £2484, 2nd £1242, 3rd £621, 4th £311, 5th £155. (Penalty Value £3247.81)
Weights raised 5lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable.

LEADING COURSE TRAINER (20-25): B Pauling (19 wins from 112 runners, 17%) runs JUST CHASING MAY TRAINER-IN-FORM (LAST 14 DAYS): B Pauling (4 wins from 28 runners, 14%) runs JUST CHASING MAY LONGEST TRAVELLER: SMALL TOWN HERO & FADED FANTASY trained by C Williams, Bridgend, 190 miles.
Neil Mulholland has been a master at taking low-grade handicappers on a winning sequence this season and that trend may continue with the progressive JONGLEUR D’ETOILES, who can overcome a 6lb rise Maiden StarVantage finished third at Wetherby in a race that is working out particularly well, so he can run well and gain compensation at a later date. Edgewell, who chased home the selection last time out, should go well again if in the same form here.
1 JUST CHASING MAY (GB) (34) F12232
6 12-0
B g Isfahan (GER) - Just For Show (IRE) Callum Pritchard (5)
Mrs F Hook Ben Pauling, Naunton
Br Gestut Elsetal Fitzdares
TIMEFORM VIEWWinner at Uttoxeter in June and has continued in good nick, third of 8 in a handicap hurdle at Lingfield (23f, good to soft) in November before solid second of 14 in a handicap hurdle at Uttoxeter (23.3f, heavy), having made the running. Should be competitive again. TFR###!! BHA95
2 SMALL TOWN HERO (IRE) (85) 10-560
5 11-12
B g Jet Away - Moray Firth (UAE) Jack Tudor
Phil Cunningham Christian Williams, Bridgend
Br R. McCabe Dodson and Horrell
TIMEFORM VIEWPoint winner who has been brought along steadily in this sphere having shown some promise in qualifying runs. Makes handicap debut tackling 3m for the first time but could only be of interest if market speaks in his favour One to note in the betting. TFR##!!! BHA93
B g It’s Gino (GER) - Salika (FR)
Mr John P. McManus
(FR) (33) 0-P0511 6 11-11
Richie McLernon
Neil Mulholland, Limpley Stoke
Br Mr Guy Cherel & Mlle Martine Glais
TIMEFORMVIEWAtypicalimproverfromayardwhodosowellwiththistypeofhorse ArriveshereonthebackofadoublehavinglandedvictoriesatWincanton(beating Keable, a progressive sort) and Catterick, scoring by 1/2 length from Edgewell (25.3f) Up 6lb but should make a bold bid for the hat-trick here. TFR##### BHA92
(43) 504204 C BF
B g Make Believe - Miss Dela (IRE)
6 11-11
David Noonan
Sue Howell Christian Williams, Bridgend
Br Stonepark Farms Ltd Dodson and Horrell
TIMEFORMVIEWCoursewinnernotwonsinceJune2023,wentcloseonfirstattemptoverfencesatHereford (25f)inNovemberhe’slookedadifficultrideontwooccasions since, when tried in different headgear. Clearly has his own ideas about the game and not one to rely on with all headgear removed today. TFR##!!! BHA92
5 GOOD BYE (GER) (11) 0P0P06 10 11-10
Ch g Tertullian (USA) - Guantana (GER)
Harry Bannister
Mr Liam Murray Sara Ender, Malton
Br Stall Ullmann Yorkshire Equine Salt Therapy
TIMEFORMVIEWProvedamodelofconsistencyduring2022/23campaignforthisyard buthastakenhistimetowarmupsincereturningfrom17-monthabsenceinJune.
Step in the right direction when sixth of 16 in handicap hurdle at Wetherby (19.7f) 11 days ago but hard to be confident that he’ll back that up TFR##!!! BHA91
6 EDGEWELL (IRE) (33) 606162 D
7 11-6
B g Well Chosen - One Edge (IRE) Conor O’Farrell
Mr E. A. Brook Rebecca Menzies, Sedgefield
Br Hugh J. Holohan Bluegrass Horse Feeds
TIMEFORM VIEWOff the mark over fences with a cosy success in handicap at Downpatrick (23.7f) in October and back to form in this sphere when chasing home Jongleur D’etoiles last time (wore visor) Up 5lb for finishing second given progressive nature of winner andcan go well again if headgear has same impact. TFR####! BHA87
7 JUST FOUR FAME (IRE) (17) 45PP06
B g Fame And Glory - Justfour (IRE)
The David Dennis Racing Club
8 11-3
Tom Bellamy
David Dennis, Banbury
Br Mr Colm McHenry DD Racing Ltd
TIMEFORM VIEWThird in an Aintree bumper in May 2022 but hurdling efforts have been uninspiring in the main, faring no better in handicaps, first-time visor having little impact when well-beaten at Market Rasen (16.6f) last month. Back to 3m here and others have stronger claims. TFR##!!! BHA84
B g Lope de Vega (IRE) - Oh Sedulous (IRE)
J & A Young (Racing) Limited
6 11-2
Brendan Powell
Henrietta C Knight, Wantage
Br Dubois Holdings Ltd & Lope de Vega Synd Jayplas
TIMEFORMVIEWAfrustratingmaidenonFlat.Promiseinfirst-timecheekpieceswhenthirdof11(20.5f,Southwell)onhandicapdebutbutletdownbyhishurdlingwhen third of 7 in handicap hurdle at Fakenham (23.4f, good to soft, 12/1) 15 days ago. Cheekpieces back on in a bid to sharpen up his jumping. TFR###!! BHA83
(38) 0F-0043
B g Ocovango - Laura’s Star (IRE)
Holmfirth Racing
8 10-13
Aaron Anderson (5)
Rebecca Menzies, Sedgefield
Br Miss Laura Sleator J S Landscapes, Bluegrass Horse Feeds
TIMEFORMVIEWRemains a maiden after 17 runs but he shaped encouragingly when third of 16 in a handicap hurdle at Wetherby (24.1f, soft), in a race that is working out extremely well with 1st, 4th and 5th all having won since Must enter calculations here TFR####! BHA80
(70) P-00006
Ch g Getaway (GER) - Parkview Delight (IRE)
6 10-11
Adam Wedge Baytree Evan Williams, Llancarfan
Br Mr Daniel Keating
TIMEFORMVIEWFailed to complete both starts in points and only poor form over hurdles, making no impact when sixth of 7 in a handicap hurdle at Ludlow (15.8f, soft, 33/1) 70 days ago. Opposable on first try at this trip, unless market offers any hope. TFR##!!! BHA78
0P01/0-4
Ch g Zoffany (IRE) - Tiangua
7 10-7
Caoilin Quinn
Mr Bob Wilson David Bridgwater, Stow-on-the-Wold
Br Stiftung Gestut Fahrhof TIMEFORMVIEWBenefittedfromthestepupintripwhenlanding4-runnerFontwellhandicap(25.8f)inApril2023.Returnedfrom20-monthabsenceandabreathingoperation when fair fourth of 12 in a handicap hurdle (50/1) at Uttoxeter (19.9f, heavy) 45 days ago. Up in trip but needs to prove he can build on that.
2024: NO CORRESPONDING RACE LAST YEAR
DECLARED RUNNERS 11 Sheepskin Cheek Pieces worn first time by No. 10. Blinkers worn by No. 5. Visor worn by No. 6. Tongue Strap worn by No. 3. Hood, Tongue Strap worn by No. 9. Visor, Tongue Strap worn by No. 7. Sheepskin Cheek Pieces worn by No. 3, 8.
Probable S.P’s: 3-1 Jongleur d’Etoiles (FR), 5-1 Star Vantage (IRE), 7-1 Edgewell (IRE), 15-2 Just Chasing May (GB), 9-1 De Vega’s Warrior (IRE), 14-1 Tellairsue (GER), 16-1 Faded Fantasy (IRE), 18-1 Just Four Fame (IRE), 25-1 Pooroldmackley (IRE), 33-1 Small Town Hero (IRE), Good Bye (GER)










All owners can enjoy 20 syndicate badges at all fixtures, on all ARC tracks
*
All ARC Tracks operate dedicated and exclusive syndicate lounge facilities on racedays.

*Terms & Conditions apply.
First Race 1.10 - THE WATCH UNBRIDLED ON attheraces.com HANDICAP STEEPLE CHASE (CLASS 4) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £4700 to the winning horse The second to receive £2162, the third £1081, the fourth £541 and the fifth £269. for five yrs old and upwards, Rated 0-110 (also open to such horses rated 111 and 112 - see Standard Conditions). £41 stake if the horse is rated 84 or higher, or £8 stake if the horse is rated 83 or lower with £33 extra if the horse is declared to run Declare by 10.00 a.m. February 1st. Penalties, after January 25th, 2025, for each steeple chase won 7lb. Sky Sports Racing will give a prize to the person who, in their opinion, is responsible for the horse judged to be the best turned out in this race. 24 entries at £41. - Closed January 28th, 2025. Owners Prize Money. Winner £3595; Second £1797; Third £899; Fourth £449; Fifth £224. (Penalty Value £4700.09) SEE PAGE 6 FOR THIS RACE.
Second Race 1.40 - THE JOIN SOUTHWELL GOLF CLUB HANDICAP STEEPLE CHASE (CLASS 4) (GBB RACE)
Distributed in accordance with the Stakes and Prize Money Code. £4700 to the winning horse The second to receive £2162, the third £1081, the fourth £541 and the fifth £269. for five yrs old and upwards, Rated 0-110 (also open to such horses rated 111 and 112 - see Standard Conditions). £41 stake if the horse is rated 84 or higher, or £8 stake if the horse is rated 83 or lower with £33 extra if the horse is declared to run Declare by 10.00 a.m.
February 1st. Penalties, after January 25th, 2025, for each steeple chase won 7lb. The sponsors of this race will give a prize to the person who, in their opinion, is responsible for the horse judged to be the best turned out in this race 21 entries at £41. - Closed January 28th, 2025. Owners Prize Money Winner £3595; Second £1797; Third £899; Fourth £449; Fifth £224. (Penalty Value £4700.09)
SEE PAGE 8 FOR THIS RACE.
Third Race 2.10 - THE GRACE AND DOTTY FEDORA’S AND FEATHERS MAIDEN HURDLE RACE (CLASS 4) (DIV I) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £4193 to the winning horse The second to receive £1931, the third £965 and the fourth £483. for maiden four yrs old and upwards. Enter by noon, January 28th and pay £38 stake, Declare by 10.00 a.m. February 1st. Weights: 4-y-o 10st 9lb; 5-y-o and up 11st 7lb Fillies and mares allowed 7lb. The sponsors of this race will give a prize to the person who, in their opinion, is responsible for the horse judged to be the best turned out in this race 13 entries at £38.Closed January 28th, 2025. Owners Prize Money. Winner £3213; Second £1607; Third £803; Fourth £402. (Penalty Value £4193.42)
SEE PAGE 12 FOR THIS RACE.
Fourth Race 2.45 - THE GRACE AND DOTTY FEDORA’S AND FEATHERS MAIDEN HURDLE RACE (CLASS 4) (DIV II) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code. £4193 to the winning horse The second to receive £1931, the third £965 and the fourth £483. for maiden four yrs old and upwards. Enter by noon, January 28th and pay £38 stake, Declare by 10.00 a.m. February 1st. Weights: 4-y-o 10st 9lb; 5-y-o and up 11st 7lb Fillies and mares allowed 7lb. The sponsors of this race will give a prize to the person who, in their opinion, is responsible for the horse judged to be the best turned out in this race 13 entries at £38.Closed January 28th, 2025. Owners Prize Money Winner £3213; Second £1607; Third £803; Fourth £402. (Penalty Value £4193.42)
SEE PAGE 14 FOR THIS RACE.
Fifth Race 3.18 - THE DOWNLOAD THE AT THE RACES APP MARES’ NOVICES’ LIMITED HANDICAP HURDLE RACE (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code. £3247 to the winning horse The second to receive £1494, the third £747, the fourth £373 and the fifth £186. for novice four yrs old and upwards fillies and mares only, Rated 0-95. Enter by noon, January 28th and pay £30 stake, Declare by 10.00 a.m. February 1st. Lowest weight 10st 5lb; Highest weight 11st 12lb Penalties, after January 25th, 2025, for each hurdle race won 7lb. The sponsors of this race will give a prize to the person who, in their opinion, is responsible for the horse judged to be the best turned out in this race 20 entries at £30. - Closed January 28th, 2025. Owners Prize Money. Winner £2484; Second £1242; Third £621; Fourth £311; Fifth £155. (Penalty Value £3247.81) 3 Eliminated Under Rules (I)9 and (I)10. SEE PAGE 16 FOR THIS RACE.
Sixth Race 3.50 - THE GOLF AND GALLOP PACKAGE HANDICAP HURDLE RACE (CLASS 4) Distributed in accordance with the Stakes and Prize Money Code. £4066 to the winning horse The second to receive £1871, the third £935, the fourth £468 and the fifth £233. for four yrs old and upwards, Rated 0-120 (also open to such horses rated 121 and 122 - see Standard Conditions). £35 stake if the horse is rated 94 or higher, or £7 stake if the horse is rated 93 or lower with £28 extra if the horse is declared to run Declare by 10.00 a.m. February 1st. Penalties, after January 25th, 2025, for each hurdle race won 7lb. The sponsors of this race will give a prize to the person who, in their opinion, is responsible for the horse judged to be the best turned out in this race 24 entries at £35. - Closed January 28th, 2025. Owners Prize Money. Winner £3110; Second £1555; Third £778; Fourth £389; Fifth £194. (Penalty Value £4066.37)
SEE PAGE 18 FOR THIS RACE.
Seventh Race 4.20 - THE PLAY AT THE RACES STABLEDUEL HANDICAP HURDLE RACE (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code. £3247 to the winning horse The second to receive £1494, the third £747, the fourth £373 and the fifth £186. for four yrs old and upwards, Rated 0-100. Enter by noon, January 28th and pay £27 stake, Declare by 10.00 a.m. February 1st. Penalties, after January 25th, 2025, for each hurdle race won 7lb. Sky Sports Racing will give a prize to the person who, in their opinion, is responsible for the horse judged to be the best turned out in this race 25 entries at £27. - Closed January 28th, 2025. Owners Prize Money. Winner £2484; Second £1242; Third £621; Fourth £311; Fifth £155. (Penalty Value £3247.81) Weights raised 5lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable.
SEE PAGE 20 FOR THIS RACE.


Wed 1
JANUARY New Year’s Day Raceday
Fri 3 (FL)
Sat 4 (FL)
Tue 14
Wed 15 Fri 17 (FL)
Thu 23 (FL) Fri 24 (FL) Thu 30 Fri 31 (FL)


(FL) Fri 4 (FL)
(FL)
15
20
27
Mon 3
Thu 6 (FL)
Fri 7 (FL)
Wed 12
Fri 14
Sat 15 (FL)
Mon 17
Fri 21 (FL)
Sat 22 (FL)
Fri 28 (FL)

Thu 1 Mon 12 Tue 20 Sat 31 MAY

Derby Evening

and

Sat 1 (FL)
Mon 3
Tue 4 (FL)
Tue 11 (FL)
Fri 14 (FL)
Sat 15 (FL)
Mon 17
Wed 19 (FL)
Fri 21 (FL)
Thu 27
Fri 28 (FL)












Thu Fri 3 (FL) Tue 7 (FL) Thu (FL) Thu (FL) Fri (FL) Thu (FL) Fri (FL) Afternoon Gents Evening Evening Evening Evening Evening Evening Halloween Racenight 3 (FL) Fri Thu 20 (FL) Fri (FL)









Afternoon Evening Evening Tue 25 26 Fri (FL)









